Citrus Sinensis ID: 005499

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690---
MADSGEYEGDDGGSARELCVNGACMKAAEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNVEGALRVFDGIDLHAAIQRLQPSFSEKSASKKCRSRSDSHVSVSQHAASLVLEAIYLKAKSLQKLGRLTEAANECKSVLDAVERIFQQGIPDAQVDNRLQETVSRAVELLPELWKQVGCDHDALAAYRRAVLSQWNLDNECCARIQKRFAVFLLHSGVEAGPPSLGSQVEGSYAPKNNLEEAILLLLILMKKYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLRSDRWNALALCYSAIGQNDAALNLLRKSLHKHERPNDLMALLLAAKICSEDCHLAAEGIQYARTALSNAQGKDEHLKGVGLRMLGLCLGRHAKVSSSDYERSRLQSEALKSLDGASTFENNNADLFFDLEQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTDAALDETTKWEQGPILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQIEDDKVNEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGRIADAADCFQAASMLEESDPIESFSSIA
cccccccccccccccHHHccccccccHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHccccccHHHcccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccc
ccccccccccccccccHcccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEcc
madsgeyegddggsareLCVNGACMKAAEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEyqrgnvegalrvFDGIDLHAAIQRlqpsfseksaskkcrsrsdshvsvSQHAASLVLEAIYLKAKSLQKLGRLTEAANECKSVLDAVERIFQQgipdaqvdNRLQETVSRAVELLPELWKQVGCDHDALAAYRRAVLSQWNLDNECCARIQKRFAVFLLHsgveagppslgsqvegsyapknNLEEAILLLLILMKKYHlgkikwdpaVMEHLTYALSLCSQTSILAKQLEeimpgvflrsDRWNALALCYSAIGQNDAALNLLRKSLHKHERPNDLMALLLAAKICSEDCHLAAEGIQYARTALsnaqgkdehlkGVGLRMLGLClgrhakvsssdyeRSRLQSEALKsldgastfennnadlffDLEQRNLSTALRYAKQYidatggsvLKGWKLLALVLSAQQRFseaevvtdaaldettkweqgpiLRLKAKLKIAQALPMDAIETYRYLLALVQAQRksfgplrclsqieddkVNEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMlhtegvmhegcgqTHEALRAYINALLiepsyvpckvlvgslfsklgpkaLPVARSLLSDalrieptnrKAWYYLGLvhkddgriadAADCFQAASmleesdpiesfssia
madsgeyegddggsarELCVNGACMKAAEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNVEGALRVFDGIDLHAAIQRLqpsfseksaSKKCRSRSDSHVSVSQHAASLVLEAIYLKAKSLQKLGRLTEAANECKSVLDAVERIFQQGIPDAQVDNRLQETVSRAVELLPELWKQVGCDHDALAAYRRAVLSQWNLDNECCARIQKRFAVFLLHSGVEAGPPSLGSQVEGSYAPKNNLEEAILLLLILMKKYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLRSDRWNALALCYSAIGQNDAALNLLRKSLHKHERPNDLMALLLAAKICSEDCHLAAEGIQYARTALSNAQGKDEHLKGVGLRMLGLCLGRHAkvsssdyerSRLQSEALKSLDGASTFENNNADLFFDLEQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTdaaldettkweqgpilrLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQIEDDKVNEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGRIADAADCFQAASmleesdpiesfssia
MAdsgeyegddggsARELCVNGACMKAAEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNVEGALRVFDGIDLHAAIQRLQPSFSEKSASKKCRSRSDSHVSVSQHAASLVLEAIYLKAKSLQKLGRLTEAANECKSVLDAVERIFQQGIPDAQVDNRLQETVSRAVELLPELWKQVGCDHDALAAYRRAVLSQWNLDNECCARIQKRFAVFLLHSGVEAGPPSLGSQVEGSYAPKNNleeaillllilMKKYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLRSDRWNALALCYSAIGQNDAALNLLRKSLHKHERPNDLMALLLAAKICSEDCHLAAEGIQYARTALSNAQGKDEHLKGVGLRMLGLCLGRHAKVSSSDYERSRLQSEALKSLDGASTFENNNADLFFDLEQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTDAALDETTKWEQGPILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQIEDDKVNEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGRIADAADCFQAASMLEESDPIESFSSIA
*****************LCVNGACMKA***********************SLNFEEARALLGRLEYQRGNVEGALRVFDGIDLHAAIQR***************************AASLVLEAIYLKAKSLQKLGRLTEAANECKSVLDAVERIFQQGIPDAQVDNRLQETVSRAVELLPELWKQVGCDHDALAAYRRAVLSQWNLDNECCARIQKRFAVFLLHSGVE*****************NNLEEAILLLLILMKKYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLRSDRWNALALCYSAIGQNDAALNLLRKSLHKHERPNDLMALLLAAKICSEDCHLAAEGIQYARTALSNAQGKDEHLKGVGLRMLGLCLGRHA****************************NNADLFFDLEQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTDAALDETTKWEQGPILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQIEDDKVNEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGRIADAADCFQA*****************
************************************GNIQEAESSLREGLSLNFEEARALLGRLEYQRGNVEGALRVFDGIDLHAAIQRLQPSFSEKSAS**********VSVSQHAASLVLEAIYLKAKSLQKLGRLTEAANECKSVLDAVERIFQQGIPDAQVDNRLQETVSRAVELLPELWKQVGCDHDALAAYRRAVLSQWNLDNECCARIQKRFAVFLLHSGVEAGPPSLGSQVEGSYAPKNNLEEAILLLLILMKKYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLRSDRWNALALCYSAIGQNDAALNLLRKSLHKHERPNDLMALLLAAKICSEDCHLAAEGIQYARTALSNAQGKDEHLKGVGLRMLGLCLGRHAKVSSSDYERSRLQSEALKSLDGASTFENNNADLFFDLEQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTDAALDETTKWEQGPILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQIEDDKVNEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGRIADAADCFQAASMLEESDPIESFSSIA
*************SARELCVNGACMKAAEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNVEGALRVFDGIDLHAAIQRLQPS**********************HAASLVLEAIYLKAKSLQKLGRLTEAANECKSVLDAVERIFQQGIPDAQVDNRLQETVSRAVELLPELWKQVGCDHDALAAYRRAVLSQWNLDNECCARIQKRFAVFLLHSGVEAGPPSLGSQVEGSYAPKNNLEEAILLLLILMKKYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLRSDRWNALALCYSAIGQNDAALNLLRKSLHKHERPNDLMALLLAAKICSEDCHLAAEGIQYARTALSNAQGKDEHLKGVGLRMLGLCLGRHA************QSEALKSLDGASTFENNNADLFFDLEQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTDAALDETTKWEQGPILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQIEDDKVNEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGRIADAADCFQAASMLEE***********
***********************************EGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNVEGALRVFDGIDLHAAIQRLQPSFSEK**************SVSQHAASLVLEAIYLKAKSLQKLGRLTEAANECKSVLDAVERIFQQGIPDAQVDNRLQETVSRAVELLPELWKQVGCDHDALAAYRRAVLSQWNLDNECCARIQKRFAVFLLHSGVEAGPPSLGSQVEGSYAPKNNLEEAILLLLILMKKYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLRSDRWNALALCYSAIGQNDAALNLLRKSLHKHERPNDLMALLLAAKICSEDCHLAAEGIQYARTALSNAQGKDEHLKGVGLRMLGLCLGRHAKVSSSDYERSRLQSEALKSLDGASTFENNNADLFFDLEQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTDAALDETTKWEQGPILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQIEDDKVNEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGRIADAADCFQAASMLEESDPIESFSSIA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADSGEYEGDDGGSARELCVNGACxxxxxxxxxxxxxxxxxxxxxLREGLSLNFEEARALLGRLEYQRGNVEGALRVFDGIDLHAAIQRLQPSFSEKSASKKCRSRSDSHVSVSQHAASLVLEAIYLKAKSLQKLGRLTEAANECKSVLDAVERIFQQGIPDAQVDNRLQETVSRAVELLPELWKQVGCDHDALAAYRRAVLSQWNLDNECCARIQKRFAVFLLHSGVEAGPPSLGSQVEGSYAPKNNLEEAILLLLILMKKYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLRSDRWNALALCYSAIGQNDAALNLLRKSLHKHERPNDLMALLLAAKICSEDCHLAAEGIQYARTALSNAQGKDEHLKGVGLRMLGLCLGRHAKVSSSDYERSRLQSEALKSLDGASTFENNNADLFFDLEQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTDAALDETTKWEQGPILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQIEDDKVNEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGRIADAADCFQAASMLEESDPIESFSSIA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query693 2.2.26 [Sep-21-2011]
Q86TV6843 Tetratricopeptide repeat yes no 0.642 0.527 0.257 4e-18
Q8BGB2858 Tetratricopeptide repeat no no 0.639 0.516 0.261 2e-17
Q9ULT0858 Tetratricopeptide repeat no no 0.637 0.515 0.263 1e-16
Q57711338 TPR repeat-containing pro yes no 0.213 0.437 0.221 0.0004
>sp|Q86TV6|TTC7B_HUMAN Tetratricopeptide repeat protein 7B OS=Homo sapiens GN=TTC7B PE=1 SV=3 Back     alignment and function desciption
 Score = 94.0 bits (232), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 137/532 (25%), Positives = 213/532 (40%), Gaps = 87/532 (16%)

Query: 240 EGSYAPKNNLEEAILLLLIL---------------MKKYHLGKIKWDPAVMEHLTYALSL 284
           E  + P+ N EEA+LLLLI                 K   L  ++    V + LT AL  
Sbjct: 316 ENIFCPQENTEEALLLLLISESMANRDAVLSRIPEHKSDRLISLQSASVVYDLLTIALGR 375

Query: 285 CSQTSILAKQLEEIMPGVFLRSDRWNALALCYSAIGQNDAALNLLRKSLHKHERPNDLMA 344
             Q  +L++ LE  M   F     W   AL   A G++  A+ +L++ +    +P+D   
Sbjct: 376 RGQYEMLSECLERAMKFAFEEFHLWYQFALSLMAAGKSARAVKVLKECIRL--KPDDATI 433

Query: 345 LLLAAKICSEDCHLAAEGIQYARTALSNAQGKDEHLKGVGLRMLGLCLGRHAKVSSSDYE 404
            LLAAK+C    H   E  ++A+T +   + K    K  G   LGL     A  +S    
Sbjct: 434 PLLAAKLCMGSLHWLEEAEKFAKTVVDVGE-KTSEFKAKGYLALGLTYSLQATDASLRGM 492

Query: 405 RSRLQSEALKSLDGASTFE--NNNADLFFDLE---QRNLSTALRYAKQYIDATGGSVLKG 459
           +  LQ +AL +   A +    ++ A  +  L+    R +  AL Y +Q +   G      
Sbjct: 493 QEVLQRKALLAFQRAHSLSPTDHQAAFYLALQLAISRQIPEALGYVRQALQLQGDDA-NS 551

Query: 460 WKLLALVLSAQQRFSEAEVVTDAALDETTKWEQGPILRLKAKLKIAQALPMDAIETYRYL 519
             LLAL+LSAQ+ + +A  + D AL E    E   +L  K KL+     P +A+ T +++
Sbjct: 552 LHLLALLLSAQKHYHDALNIIDMALSEYP--ENFILLFSKVKLQSLCRGPDEALLTCKHM 609

Query: 520 LALVQ----------------------AQRKSFGPL------------------------ 533
           L + +                      A R+    +                        
Sbjct: 610 LQIWKSCYNLTNPSDSGRGSSLLDRTIADRRQLNTITLPDFSDPETGSVHATSVAASRVE 669

Query: 534 RCLSQIEDD------KVNEFQVWHGLANL-------YSGLSHWKDVAICMGKARELKAYS 580
           + LS++         K      W  LA +       Y G+    +   C  +A  L   S
Sbjct: 670 QALSEVASSLQSSAPKQGPLHPWMTLAQIWLHAAEVYIGIGKPAEATACTQEAANLFPMS 729

Query: 581 AEMLHTEGVMHEGCGQTHEALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLL 640
             +L+  G + E  G   EA R Y  AL I P++V     +  +  +LG  +L  A  +L
Sbjct: 730 HNVLYMRGQIAELRGSMDEARRWYEEALAISPTHVKSMQRLALILHQLGRYSL--AEKIL 787

Query: 641 SDALRIEPTNRKAWYYLGLVHKDDGRIADAADCFQAASMLEESDPIESFSSI 692
            DA+++  T  + W  LG V +  G  A A +CF  A  LE S P   F+ I
Sbjct: 788 RDAVQVNSTAHEVWNGLGEVLQAQGNDAAATECFLTALELEASSPAVPFTII 839

Homo sapiens (taxid: 9606)
>sp|Q8BGB2|TTC7A_MOUSE Tetratricopeptide repeat protein 7A OS=Mus musculus GN=Ttc7a PE=1 SV=1 Back     alignment and function description
>sp|Q9ULT0|TTC7A_HUMAN Tetratricopeptide repeat protein 7A OS=Homo sapiens GN=TTC7A PE=1 SV=3 Back     alignment and function description
>sp|Q57711|Y941_METJA TPR repeat-containing protein MJ0941 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0941 PE=4 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
255547047701 o-linked n-acetylglucosamine transferase 0.989 0.978 0.793 0.0
225429868702 PREDICTED: tetratricopeptide repeat prot 0.979 0.967 0.754 0.0
449463603708 PREDICTED: tetratricopeptide repeat prot 0.988 0.967 0.768 0.0
224062591686 predicted protein [Populus trichocarpa] 0.972 0.982 0.747 0.0
356531507694 PREDICTED: tetratricopeptide repeat prot 0.991 0.989 0.732 0.0
297828005704 hypothetical protein ARALYDRAFT_483406 [ 0.987 0.971 0.765 0.0
30689234704 tetratricopeptide repeat-containing prot 0.975 0.960 0.768 0.0
356560871694 PREDICTED: tetratricopeptide repeat prot 0.979 0.978 0.739 0.0
356495252694 PREDICTED: tetratricopeptide repeat prot 0.985 0.984 0.725 0.0
147804770700 hypothetical protein VITISV_011972 [Viti 0.952 0.942 0.716 0.0
>gi|255547047|ref|XP_002514581.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] gi|223546185|gb|EEF47687.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1135 bits (2935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/693 (79%), Positives = 620/693 (89%), Gaps = 7/693 (1%)

Query: 5   GEYEGDDGGSARELCVNGACMKAAEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRL 64
           GEYE  +    RE+C NG CMK  EVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRL
Sbjct: 10  GEYE--EQTLVREVCANGICMKTTEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRL 67

Query: 65  EYQRGNVEGALRVFDGIDLHAAIQRLQPSFSEKSASKKCRSRSDSHVSVSQHAASLVLEA 124
           EYQRGNVEGALRVFDGIDL AAI+RLQP+FS+K +SKK R RSDS  +VSQHAASLVLEA
Sbjct: 68  EYQRGNVEGALRVFDGIDLQAAIERLQPAFSDKQSSKKGRPRSDSQHAVSQHAASLVLEA 127

Query: 125 IYLKAKSLQKLGRLTEAANECKSVLDAVERIFQQGIPDAQVDNRLQETVSRAVELLPELW 184
           IYLKAKSLQKLGR+ +AA ECKSVLDAVE+IF QGIPDAQVDNRLQ+TVS+AVELLPELW
Sbjct: 128 IYLKAKSLQKLGRINDAAKECKSVLDAVEKIFHQGIPDAQVDNRLQDTVSQAVELLPELW 187

Query: 185 KQVGCDHDALAAYRRAVLSQWNLDNECCARIQKRFAVFLLHSGVEAGPPSLGSQVEGSYA 244
           KQVGC  +A++AYRRA+LSQWNLD+ECCARIQK FAVFLLHSGVEAGP SL + ++GSY 
Sbjct: 188 KQVGCYDEAMSAYRRALLSQWNLDDECCARIQKGFAVFLLHSGVEAGPLSLAAHIDGSYV 247

Query: 245 PKNNLEEAILLLLILMKKYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFL 304
           PK+NLEEA+LLL+IL++K +LGK KWD +V+EHLT+ALSLCSQTSILAKQLEEIMPG+F 
Sbjct: 248 PKHNLEEAVLLLMILIRKSYLGKTKWDSSVVEHLTFALSLCSQTSILAKQLEEIMPGLFH 307

Query: 305 RSDRWNALALCYSAIGQNDAALNLLRKSLHKHERPNDLMALLLAAKICSEDCHLAAEGIQ 364
           R DRWN LALCY   G++D A+NLLRKSLHKHERP+DLMALLLAAKICSED HLAAEG+ 
Sbjct: 308 RVDRWNTLALCYCGAGKHDVAINLLRKSLHKHERPDDLMALLLAAKICSEDSHLAAEGVG 367

Query: 365 YARTALSNAQGKDEHLKGVGLRMLGLCLGRHAKVSSSDYERSRLQSEALKSLDGASTFEN 424
           YA+ A+SN+QG DEHLKGV +RMLGLCLGR AKVSSSD+ERSRLQSEALKSLDGA TFE 
Sbjct: 368 YAQRAISNSQGIDEHLKGVAIRMLGLCLGRQAKVSSSDFERSRLQSEALKSLDGAITFEP 427

Query: 425 NNADLFFDL-----EQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVV 479
           NN DL FDL     EQRNL+ ALR+AKQ+IDATGGS+LKGW+LLALVLSAQQRF EAEVV
Sbjct: 428 NNPDLVFDLGVQYAEQRNLNAALRFAKQFIDATGGSILKGWRLLALVLSAQQRFPEAEVV 487

Query: 480 TDAALDETTKWEQGPILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQI 539
           TDAALDET KWEQGP+LRLKAKLKI+Q+LPMDA+ETYRYLLALVQA+RKSFGPLR  SQ 
Sbjct: 488 TDAALDETAKWEQGPLLRLKAKLKISQSLPMDAVETYRYLLALVQARRKSFGPLRSSSQA 547

Query: 540 EDDKVNEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHE 599
           ED+KVNEF+VW GLA LYS LSHWKDV +C+GKARELK YSAE+L+TEG+M EG GQ  E
Sbjct: 548 EDEKVNEFEVWQGLAGLYSRLSHWKDVEVCLGKARELKPYSAELLYTEGIMCEGRGQVQE 607

Query: 600 ALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGL 659
           A+  YINALL++PSYVPCK+L+G+L SK+GP ALPVARS+LSDALRIEPTNR AWYYLG+
Sbjct: 608 AMCCYINALLLDPSYVPCKILIGALLSKIGPNALPVARSILSDALRIEPTNRMAWYYLGM 667

Query: 660 VHKDDGRIADAADCFQAASMLEESDPIESFSSI 692
           VH+DDGR+ADA DCF AASMLEESDPIESFS++
Sbjct: 668 VHRDDGRMADATDCFLAASMLEESDPIESFSTL 700

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225429868|ref|XP_002283407.1| PREDICTED: tetratricopeptide repeat protein 7B [Vitis vinifera] gi|296081806|emb|CBI20811.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449463603|ref|XP_004149521.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Cucumis sativus] gi|449517393|ref|XP_004165730.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224062591|ref|XP_002300857.1| predicted protein [Populus trichocarpa] gi|222842583|gb|EEE80130.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356531507|ref|XP_003534319.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Glycine max] Back     alignment and taxonomy information
>gi|297828005|ref|XP_002881885.1| hypothetical protein ARALYDRAFT_483406 [Arabidopsis lyrata subsp. lyrata] gi|297327724|gb|EFH58144.1| hypothetical protein ARALYDRAFT_483406 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30689234|ref|NP_850382.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|27450574|gb|AAO14644.1|AF474176_1 pollen-specific calmodulin-binding protein [Arabidopsis thaliana] gi|209529807|gb|ACI49798.1| At2g43040 [Arabidopsis thaliana] gi|330255108|gb|AEC10202.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356560871|ref|XP_003548710.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Glycine max] Back     alignment and taxonomy information
>gi|356495252|ref|XP_003516493.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Glycine max] Back     alignment and taxonomy information
>gi|147804770|emb|CAN67088.1| hypothetical protein VITISV_011972 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
TAIR|locus:2053707704 NPG1 "no pollen germination 1" 0.975 0.960 0.755 2.2e-272
TAIR|locus:2139860739 NPGR2 "AT4G28600" [Arabidopsis 0.962 0.902 0.444 1.6e-143
TAIR|locus:2016029694 NPGR1 "no pollen germination r 0.923 0.922 0.408 9.8e-119
UNIPROTKB|E1C895857 E1C895 "Uncharacterized protei 0.206 0.166 0.324 4e-24
UNIPROTKB|E1BDL2858 TTC7A "Uncharacterized protein 0.206 0.166 0.344 5.6e-24
UNIPROTKB|F1PM89760 TTC7A "Uncharacterized protein 0.206 0.188 0.344 1.4e-23
UNIPROTKB|F5H4E1504 TTC7A "Tetratricopeptide repea 0.206 0.283 0.344 2.6e-23
UNIPROTKB|Q9ULT0858 TTC7A "Tetratricopeptide repea 0.206 0.166 0.344 3.7e-23
MGI|MGI:1920999858 Ttc7 "tetratricopeptide repeat 0.258 0.208 0.312 4.6e-23
ZFIN|ZDB-GENE-070105-3844 ttc7b "tetratricopeptide repea 0.350 0.287 0.271 9.3e-23
TAIR|locus:2053707 NPG1 "no pollen germination 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2619 (927.0 bits), Expect = 2.2e-272, P = 2.2e-272
 Identities = 518/686 (75%), Positives = 586/686 (85%)

Query:    16 RELCVNGACMKAAEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNVEGAL 75
             R+LC NG CMK  EVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGN+EGAL
Sbjct:    19 RQLCANGICMKTTEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNLEGAL 78

Query:    76 RVFDGIDLHAAIQRLQPSFS-EKSASKKCRSRSDSHVSVSQHAASLVLEAIYLKAKSLQK 134
             RVF+GIDL AAIQRLQ S   EK A+KK R R     SVSQHAA+LVLEAIYLKAKSLQK
Sbjct:    79 RVFEGIDLQAAIQRLQVSVPLEKPATKKNRPREPQQ-SVSQHAANLVLEAIYLKAKSLQK 137

Query:   135 LGRLTEAANECKSVLDAVERIFQQGIPDAQVDNRLQETVSRAVELLPELWKQVGCDHDAL 194
             LGR+TEAA+ECKSVLD+VE+IFQQGIPDAQVDN+LQETVS AVELLP LWK+ G   +A+
Sbjct:   138 LGRITEAAHECKSVLDSVEKIFQQGIPDAQVDNKLQETVSHAVELLPALWKESGDYQEAI 197

Query:   195 AAYRRAVLSQWNLDNECCARIQKRFAVFLLHSGVEAGPPSLGSQVEGSYAPKNNXXXXXX 254
             +AYRRA+LSQWNLDN+CCARIQK FAVFLLHSGVEA PPSLGSQ+EGSY P+NN      
Sbjct:   198 SAYRRALLSQWNLDNDCCARIQKDFAVFLLHSGVEASPPSLGSQIEGSYIPRNNIEEAIL 257

Query:   255 XXXXXMKKYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLRSDRWNALAL 314
                  +KK++LGK KWDP+V EHLT+ALSLCSQT++LAKQLEE+MPGVF R +RWN LAL
Sbjct:   258 LLMILLKKFNLGKAKWDPSVFEHLTFALSLCSQTAVLAKQLEEVMPGVFSRIERWNTLAL 317

Query:   315 CYSAIGQNDAALNLLRKSLHKHERPNDLMALLLAAKICSEDCHLAAEGIQYARTALSNAQ 374
              YSA GQN AA+NLLRKSLHKHE+P+DL+ALLLAAK+CSE+  LAAEG  YA+ A++NAQ
Sbjct:   318 SYSAAGQNSAAVNLLRKSLHKHEQPDDLVALLLAAKLCSEEPSLAAEGTGYAQRAINNAQ 377

Query:   375 GKDEHLKGVGLRMLGLCLGRHAKVSSSDYERSRLQSEALKSLDGASTFENNNADLFFDL- 433
             G DEHLKGVGLRMLGLCLG+ AKV +SD+ERSRLQSE+LK+LDGA  FE+NN DL F+L 
Sbjct:   378 GMDEHLKGVGLRMLGLCLGKQAKVPTSDFERSRLQSESLKALDGAIAFEHNNPDLIFELG 437

Query:   434 ----EQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTDAALDETTK 489
                 EQRNL  A RYAK++IDATGGSVLKGW+ LALVLSAQQRFSEAEVVTDAALDET K
Sbjct:   438 VQYAEQRNLKAASRYAKEFIDATGGSVLKGWRFLALVLSAQQRFSEAEVVTDAALDETAK 497

Query:   490 WEQGPILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQIEDDKVNEFQV 549
             W+QGP+LRLKAKLKI+Q+ P +A+ETYRYLLALVQAQRKSFGPLR LSQ+E+DKVNEF+V
Sbjct:   498 WDQGPLLRLKAKLKISQSNPTEAVETYRYLLALVQAQRKSFGPLRTLSQMEEDKVNEFEV 557

Query:   550 WHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAYINALL 609
             WHGLA LYS LSHW DV +C+ KA ELK YSA MLHTEG M EG  +   AL A+++ LL
Sbjct:   558 WHGLAYLYSSLSHWNDVEVCLKKAGELKQYSASMLHTEGRMWEGRKEFKPALAAFLDGLL 617

Query:   610 IEPSYVPCKVLVGSLFSKLGPK---ALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGR 666
             ++ S VPCKV VG+L S+ G      LPVARSLLSDALRI+PTNRKAWYYLG+VHK DGR
Sbjct:   618 LDGSSVPCKVAVGALLSERGKDHQPTLPVARSLLSDALRIDPTNRKAWYYLGMVHKSDGR 677

Query:   667 IADAADCFQAASMLEESDPIESFSSI 692
             IADA DCFQAASMLEESDPIESFS+I
Sbjct:   678 IADATDCFQAASMLEESDPIESFSTI 703
GO:0005634 "nucleus" evidence=ISM
GO:0005516 "calmodulin binding" evidence=ISS;IDA
GO:0016132 "brassinosteroid biosynthetic process" evidence=RCA
TAIR|locus:2139860 NPGR2 "AT4G28600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016029 NPGR1 "no pollen germination related 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C895 E1C895 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDL2 TTC7A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PM89 TTC7A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F5H4E1 TTC7A "Tetratricopeptide repeat protein 7A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULT0 TTC7A "Tetratricopeptide repeat protein 7A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1920999 Ttc7 "tetratricopeptide repeat domain 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070105-3 ttc7b "tetratricopeptide repeat domain 7B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-07
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information 
 Score = 47.8 bits (114), Expect = 7e-07
 Identities = 29/102 (28%), Positives = 47/102 (46%), Gaps = 2/102 (1%)

Query: 582 EMLHTEGVMHEGCGQTHEALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLS 641
           E L   G ++   G   EAL  Y  AL ++P        + + + KLG      A     
Sbjct: 1   EALLNLGNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEE--ALEDYE 58

Query: 642 DALRIEPTNRKAWYYLGLVHKDDGRIADAADCFQAASMLEES 683
            AL ++P N KA+Y LGL +   G+  +A + ++ A  L+ +
Sbjct: 59  KALELDPDNAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100

Length = 100

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 693
KOG4162799 consensus Predicted calmodulin-binding protein [Si 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 100.0
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.98
PLN03077 857 Protein ECB2; Provisional 99.97
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.97
PLN03077 857 Protein ECB2; Provisional 99.97
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.96
KOG0547606 consensus Translocase of outer mitochondrial membr 99.96
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.95
KOG1126638 consensus DNA-binding cell division cycle control 99.95
PLN03218 1060 maturation of RBCL 1; Provisional 99.94
PRK14574 822 hmsH outer membrane protein; Provisional 99.94
KOG1126638 consensus DNA-binding cell division cycle control 99.94
PLN03218 1060 maturation of RBCL 1; Provisional 99.94
PRK14574 822 hmsH outer membrane protein; Provisional 99.94
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.94
KOG0547606 consensus Translocase of outer mitochondrial membr 99.94
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.94
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.94
KOG2076895 consensus RNA polymerase III transcription factor 99.93
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.93
KOG2003840 consensus TPR repeat-containing protein [General f 99.93
KOG2003 840 consensus TPR repeat-containing protein [General f 99.93
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.92
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.9
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.9
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.89
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.89
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.89
KOG2076 895 consensus RNA polymerase III transcription factor 99.88
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.87
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.86
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.85
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.84
PRK12370553 invasion protein regulator; Provisional 99.84
PRK12370553 invasion protein regulator; Provisional 99.83
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.83
PRK11189296 lipoprotein NlpI; Provisional 99.82
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.82
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.82
KOG1129478 consensus TPR repeat-containing protein [General f 99.81
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.81
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.8
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.8
KOG1125579 consensus TPR repeat-containing protein [General f 99.8
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.79
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.79
KOG1125579 consensus TPR repeat-containing protein [General f 99.78
PLN02789320 farnesyltranstransferase 99.78
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.77
KOG1129478 consensus TPR repeat-containing protein [General f 99.77
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.76
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.76
PRK11189296 lipoprotein NlpI; Provisional 99.76
KOG1915677 consensus Cell cycle control protein (crooked neck 99.76
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.75
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.75
KOG2376652 consensus Signal recognition particle, subunit Srp 99.73
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.73
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.72
PLN02789320 farnesyltranstransferase 99.72
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.72
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.71
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.71
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.71
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.69
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.67
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.63
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.62
PRK15359144 type III secretion system chaperone protein SscB; 99.59
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.59
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.59
PRK15359144 type III secretion system chaperone protein SscB; 99.58
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.58
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.57
PRK10370198 formate-dependent nitrite reductase complex subuni 99.57
PRK04841 903 transcriptional regulator MalT; Provisional 99.52
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.52
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.52
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.51
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.5
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.49
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.49
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.48
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.47
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.47
PRK10370198 formate-dependent nitrite reductase complex subuni 99.47
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.46
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.46
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.44
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.44
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.44
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.43
KOG0553304 consensus TPR repeat-containing protein [General f 99.42
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.41
PRK04841903 transcriptional regulator MalT; Provisional 99.4
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.39
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.39
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.35
KOG0553 304 consensus TPR repeat-containing protein [General f 99.35
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.34
KOG1128777 consensus Uncharacterized conserved protein, conta 99.32
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.31
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.29
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.25
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.21
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.19
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.17
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.16
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.14
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.13
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.12
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.1
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.09
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.09
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.08
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.05
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.04
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.03
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.02
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.01
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.0
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.99
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.98
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.97
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.96
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.94
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.94
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.93
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.93
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.92
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.92
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.91
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.91
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.89
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.89
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.88
PRK11906458 transcriptional regulator; Provisional 98.88
COG3898531 Uncharacterized membrane-bound protein [Function u 98.87
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.87
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.87
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.86
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.86
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.86
PRK15331165 chaperone protein SicA; Provisional 98.85
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.84
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.84
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.83
PRK10803263 tol-pal system protein YbgF; Provisional 98.81
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.79
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.78
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.78
PRK15331165 chaperone protein SicA; Provisional 98.76
PRK10803263 tol-pal system protein YbgF; Provisional 98.76
PRK11906458 transcriptional regulator; Provisional 98.76
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.76
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.75
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.71
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.69
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.69
PF12688120 TPR_5: Tetratrico peptide repeat 98.68
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.68
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.68
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.67
COG4700251 Uncharacterized protein conserved in bacteria cont 98.67
PF12688120 TPR_5: Tetratrico peptide repeat 98.65
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.63
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.59
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.57
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.56
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.56
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.56
PF1337173 TPR_9: Tetratricopeptide repeat 98.56
KOG4234271 consensus TPR repeat-containing protein [General f 98.53
COG4700251 Uncharacterized protein conserved in bacteria cont 98.52
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.51
PF13512142 TPR_18: Tetratricopeptide repeat 98.49
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 98.49
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.48
KOG4234271 consensus TPR repeat-containing protein [General f 98.48
KOG2300 629 consensus Uncharacterized conserved protein [Funct 98.48
PF1337173 TPR_9: Tetratricopeptide repeat 98.48
PF13512142 TPR_18: Tetratricopeptide repeat 98.46
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.46
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.45
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.42
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.42
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.37
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.37
KOG2471696 consensus TPR repeat-containing protein [General f 98.36
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.34
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.34
KOG4555175 consensus TPR repeat-containing protein [Function 98.33
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.3
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.3
KOG2471696 consensus TPR repeat-containing protein [General f 98.29
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.26
KOG1258577 consensus mRNA processing protein [RNA processing 98.2
KOG4555175 consensus TPR repeat-containing protein [Function 98.2
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.19
KOG4507 886 consensus Uncharacterized conserved protein, conta 98.18
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 98.15
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.04
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.03
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.02
KOG1586288 consensus Protein required for fusion of vesicles 98.01
PF1343134 TPR_17: Tetratricopeptide repeat 97.98
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.98
KOG1586288 consensus Protein required for fusion of vesicles 97.98
PF1342844 TPR_14: Tetratricopeptide repeat 97.96
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.91
PF1342844 TPR_14: Tetratricopeptide repeat 97.91
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.88
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.88
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 97.85
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.84
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.83
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.82
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.81
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.79
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.76
PF1343134 TPR_17: Tetratricopeptide repeat 97.75
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.74
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.71
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.67
KOG1585308 consensus Protein required for fusion of vesicles 97.67
KOG1585308 consensus Protein required for fusion of vesicles 97.65
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.62
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.57
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.57
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.56
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.55
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.55
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.53
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.53
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.5
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.47
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.47
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.47
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.45
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.43
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.43
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.41
KOG1550552 consensus Extracellular protein SEL-1 and related 97.35
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.33
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.27
KOG1258 577 consensus mRNA processing protein [RNA processing 97.24
KOG1550552 consensus Extracellular protein SEL-1 and related 97.23
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.18
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.18
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.14
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.08
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.05
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 97.01
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.98
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.98
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.96
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.91
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.91
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 96.9
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.89
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.82
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.7
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.66
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.6
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.59
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.59
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.53
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.45
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.41
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 96.3
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.25
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.24
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.18
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.13
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 96.1
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.08
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.93
KOG2041 1189 consensus WD40 repeat protein [General function pr 95.87
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.86
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.79
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.78
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.77
PRK10941269 hypothetical protein; Provisional 95.77
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 95.7
PRK10941269 hypothetical protein; Provisional 95.69
PF1304150 PPR_2: PPR repeat family 95.68
KOG2041 1189 consensus WD40 repeat protein [General function pr 95.45
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.45
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.35
PF1304150 PPR_2: PPR repeat family 95.31
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 95.29
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.23
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.09
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.07
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 94.95
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.83
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 94.82
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.81
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.68
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.63
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.62
COG5191 435 Uncharacterized conserved protein, contains HAT (H 94.57
COG4976 287 Predicted methyltransferase (contains TPR repeat) 94.57
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 94.49
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 94.47
COG4976 287 Predicted methyltransferase (contains TPR repeat) 94.35
KOG1310 758 consensus WD40 repeat protein [General function pr 94.14
KOG3783546 consensus Uncharacterized conserved protein [Funct 94.11
KOG3364149 consensus Membrane protein involved in organellar 94.09
KOG3783546 consensus Uncharacterized conserved protein [Funct 94.03
KOG3364149 consensus Membrane protein involved in organellar 93.65
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.56
COG5191 435 Uncharacterized conserved protein, contains HAT (H 93.5
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.27
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.15
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.13
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.9
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 92.89
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 92.8
KOG4814 872 consensus Uncharacterized conserved protein [Funct 92.75
PF1285434 PPR_1: PPR repeat 92.73
PF1285434 PPR_1: PPR repeat 92.51
KOG4814 872 consensus Uncharacterized conserved protein [Funct 92.5
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 92.41
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 92.35
KOG15381081 consensus Uncharacterized conserved protein WDR10, 92.27
KOG2422 665 consensus Uncharacterized conserved protein [Funct 92.27
KOG2581 493 consensus 26S proteasome regulatory complex, subun 92.19
KOG1310 758 consensus WD40 repeat protein [General function pr 91.86
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.72
PF1286294 Apc5: Anaphase-promoting complex subunit 5 91.4
KOG0529 421 consensus Protein geranylgeranyltransferase type I 91.39
KOG2422 665 consensus Uncharacterized conserved protein [Funct 91.34
COG5159421 RPN6 26S proteasome regulatory complex component [ 91.29
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 91.29
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 91.27
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 90.9
PF1286294 Apc5: Anaphase-promoting complex subunit 5 90.88
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.24
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.18
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 90.03
COG2912269 Uncharacterized conserved protein [Function unknow 89.97
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 89.94
KOG2581 493 consensus 26S proteasome regulatory complex, subun 89.26
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.21
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 89.17
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 89.14
COG2912269 Uncharacterized conserved protein [Function unknow 89.1
COG1747 711 Uncharacterized N-terminal domain of the transcrip 89.1
KOG0529421 consensus Protein geranylgeranyltransferase type I 88.89
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 88.75
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 88.72
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 88.6
KOG1463411 consensus 26S proteasome regulatory complex, subun 88.55
PRK11619 644 lytic murein transglycosylase; Provisional 88.25
COG1747 711 Uncharacterized N-terminal domain of the transcrip 88.21
PF1381234 PPR_3: Pentatricopeptide repeat domain 87.75
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 87.39
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 86.77
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 86.57
COG3629280 DnrI DNA-binding transcriptional activator of the 86.51
COG3629280 DnrI DNA-binding transcriptional activator of the 86.38
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 85.46
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 84.84
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 84.4
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 83.96
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 83.71
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.1
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 82.72
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 82.31
COG4941415 Predicted RNA polymerase sigma factor containing a 82.09
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 81.27
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 81.12
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 81.02
COG5159421 RPN6 26S proteasome regulatory complex component [ 80.59
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-54  Score=434.09  Aligned_cols=673  Identities=42%  Similarity=0.604  Sum_probs=582.3

Q ss_pred             hhcccCcccchhhhhcccCCcCHHHHHHHhhhccCCCHHHHHHHHHHHHhhcCCHHHHHhhhccCCcchhhhhccccchh
Q 005499           17 ELCVNGACMKAAEVEAKLDEGNIQEAESSLREGLSLNFEEARALLGRLEYQRGNVEGALRVFDGIDLHAAIQRLQPSFSE   96 (693)
Q Consensus        17 ~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~l~~~~~~a~~~lg~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~   96 (693)
                      -.+-++++.........++.+.+.+|+..+++.++.+..++...+|..-+++|+.+.|+.+|+++............+..
T Consensus        64 ~~~~s~i~~~~~~~~~~~~~~~l~Ea~~il~~glsle~ee~~~~s~~~~~qr~~~e~al~vFe~~~i~~~~~~~e~~i~~  143 (799)
T KOG4162|consen   64 NFSASGIDNQYSENLPLLDLRLLAEAEAILREGLSLEYEEARALSGRLEYQRGNDEAALRVFEGIDILAITYLQELEIVQ  143 (799)
T ss_pred             HHHHhhcccccccccchhhhhhHHHHHHHHhhhcccchhhhhhhhhhHHHhhcCcHHHHHHhcccchhHHHHHHHHHHHh
Confidence            45566888888888999999999999999999999999999999999999999999999999998654443322111111


Q ss_pred             hh-----hhhccCCCCCCCccchhhHHHHHHHHHHHHHHHhHhhCChHHHHHHHHHHHHHHHHhhhcCCCChhhhh-hHH
Q 005499           97 KS-----ASKKCRSRSDSHVSVSQHAASLVLEAIYLKAKSLQKLGRLTEAANECKSVLDAVERIFQQGIPDAQVDN-RLQ  170 (693)
Q Consensus        97 ~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~~~~-~~~  170 (693)
                      ..     ....+..........+.+......++...++..+.+.|++.+|++.++.++++.+...+++.++..+.. .+.
T Consensus       144 ~s~~s~~~~s~~~~a~~p~~~~s~~~~~Le~~l~~lk~k~L~~~~~iqea~e~cr~~L~~ve~~~t~~~~~~~s~~~~l~  223 (799)
T KOG4162|consen  144 NSNSSLRQRSKASFAIEPSTVMSAHGAILEAELIKLKAKSLKRLGRIQEAAEECRSVLDIVETKATQGSKDTESGALKLQ  223 (799)
T ss_pred             ccCccccCCCccccccCCCcHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCcchHHHHHHHH
Confidence            10     000111111222444556666778888889999999999999999999999999999999999865444 889


Q ss_pred             HHHHHHHhhhHHHHhhcCCchHHHHHHHHHhcccCCCChhHHHHHHHHHHHHhhhcccccCCCCCcCCCCCcccCCChhH
Q 005499          171 ETVSRAVELLPELWKQVGCDHDALAAYRRAVLSQWNLDNECCARIQKRFAVFLLHSGVEAGPPSLGSQVEGSYAPKNNLE  250 (693)
Q Consensus       171 ~~~~~a~~~l~~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~~~~a~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  250 (693)
                      +++.++...++.+|...+..++++..|++++..+++.++.+...+...++.+..+++.+..  .....+...++++++.+
T Consensus       224 ~vl~~~~~~~~~Lw~~~~~~~~~i~s~~~~l~~~w~~~~l~ka~l~~~~~~f~~~~~~Ee~--~Lllli~es~i~Re~~~  301 (799)
T KOG4162|consen  224 EVLSRAVELLPILWKKLSGPKEAIKSYRRALLRSWSLDPLTKARLYKGFALFLPKSGQEEV--ILLLLIEESLIPRENIE  301 (799)
T ss_pred             HHHHHHHHHhHHHhcCCCCchHHHHhhhHHhhcccccchhHHHHHhhcccccCCCCcHHHH--HHHHHHHhhccccccHH
Confidence            9999999999999999999999999999999999999998888877777766655555422  22234456789999999


Q ss_pred             HHHHHHHHHHHHHhhcCCCCcHHHHHHHHHHHHhcCCHHHHHHHHHhhcCCCCCcHHHHHHHHHHHHHCCCcHHHHHHHH
Q 005499          251 EAILLLLILMKKYHLGKIKWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLRSDRWNALALCYSAIGQNDAALNLLR  330 (693)
Q Consensus       251 ~a~~~~~~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~e~~l~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~  330 (693)
                      +++..+....++.......+++.+|+++.+++.++|+++.+.++||+++++.+...+.|+.++.++...|.-..|+.+++
T Consensus       302 d~ilslm~~~~k~r~~~~qnd~ai~d~Lt~al~~~g~f~~lae~fE~~~~~~~~~~e~w~~~als~saag~~s~Av~ll~  381 (799)
T KOG4162|consen  302 DAILSLMLLLRKLRLKKFQNDAAIFDHLTFALSRCGQFEVLAEQFEQALPFSFGEHERWYQLALSYSAAGSDSKAVNLLR  381 (799)
T ss_pred             HHHHHHHHHHHHHHHhhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhhhhhHHHHHHHHHHHHHhccchHHHHHHH
Confidence            99999999988888888889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhccCCCCCHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhhcCCCcchhHhHHHHHHHHHhhhhcccCChHHHhHHHH
Q 005499          331 KSLHKHERPNDLMALLLAAKICSEDCHLAAEGIQYARTALSNAQGKDEHLKGVGLRMLGLCLGRHAKVSSSDYERSRLQS  410 (693)
Q Consensus       331 ~~l~~~~~p~~~~~~~~~a~~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~lg~~~~~~~~~~~~~~~~~~~~~  410 (693)
                      +......+|+++..+++.+++|.....+.+++++|..+++........++.+.++..+|.+|..+...+..+++|.....
T Consensus       382 ~~~~~~~~ps~~s~~Lmasklc~e~l~~~eegldYA~kai~~~~~~~~~l~~~~~l~lGi~y~~~A~~a~~~seR~~~h~  461 (799)
T KOG4162|consen  382 ESLKKSEQPSDISVLLMASKLCIERLKLVEEGLDYAQKAISLLGGQRSHLKPRGYLFLGIAYGFQARQANLKSERDALHK  461 (799)
T ss_pred             hhcccccCCCcchHHHHHHHHHHhchhhhhhHHHHHHHHHHHhhhhhhhhhhhHHHHHHHHHHhHhhcCCChHHHHHHHH
Confidence            99996666999999999999999999999999999999999776666778899999999999999999999999999999


Q ss_pred             HHHHHHHHHHhcCCCChHHHHHH-----HhCCHHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHcCChHHHHHHHHHHHh
Q 005499          411 EALKSLDGASTFENNNADLFFDL-----EQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTDAALD  485 (693)
Q Consensus       411 ~A~~~~~~al~~~p~~~~~~~~l-----~~~~~~~A~~~~~~al~~~p~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~  485 (693)
                      ++++.++++++.+|+|+.+.+++     .+++.+.|+.+.++++++++.+...+|..++.++...+++.+|+.+.+.++.
T Consensus       462 kslqale~av~~d~~dp~~if~lalq~A~~R~l~sAl~~~~eaL~l~~~~~~~~whLLALvlSa~kr~~~Al~vvd~al~  541 (799)
T KOG4162|consen  462 KSLQALEEAVQFDPTDPLVIFYLALQYAEQRQLTSALDYAREALALNRGDSAKAWHLLALVLSAQKRLKEALDVVDAALE  541 (799)
T ss_pred             HHHHHHHHHHhcCCCCchHHHHHHHHHHHHHhHHHHHHHHHHHHHhcCCccHHHHHHHHHHHhhhhhhHHHHHHHHHHHH
Confidence            99999999999999999999998     8999999999999999997766559999999999999999999999999999


Q ss_pred             hcCCCCchHHHHHHHHHHHHhCChhHHHHHHHHHHHHHHhhhhhcCCcc--cc----------c-c--------------
Q 005499          486 ETTKWEQGPILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLR--CL----------S-Q--------------  538 (693)
Q Consensus       486 ~~p~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~--~~----------~-~--------------  538 (693)
                      ..|  +|.........+....++.++|+.++...+..+...+.+-..+.  ..          . +              
T Consensus       542 E~~--~N~~l~~~~~~i~~~~~~~e~~l~t~~~~L~~we~~~~~q~~~~~g~~~~lk~~l~la~~q~~~a~s~sr~ls~l  619 (799)
T KOG4162|consen  542 EFG--DNHVLMDGKIHIELTFNDREEALDTCIHKLALWEAEYGVQQTLDEGKLLRLKAGLHLALSQPTDAISTSRYLSSL  619 (799)
T ss_pred             Hhh--hhhhhchhhhhhhhhcccHHHHHHHHHHHHHHHHhhhhHhhhhhhhhhhhhhcccccCcccccccchhhHHHHHH
Confidence            999  88888888999999999999999999999998863332110000  00          0 0              


Q ss_pred             ----------------------hhhhcccHHHHHHHHHHHHHhCCChHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHCCC
Q 005499          539 ----------------------IEDDKVNEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQ  596 (693)
Q Consensus       539 ----------------------~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~  596 (693)
                                            ....+......|...+..+...+..++|..++.++-.+.|..+.+|+..|.++..+|+
T Consensus       620 ~a~~~~~~~se~~Lp~s~~~~~~~~~~~~~~~lwllaa~~~~~~~~~~~a~~CL~Ea~~~~~l~~~~~~~~G~~~~~~~~  699 (799)
T KOG4162|consen  620 VASQLKSAGSELKLPSSTVLPGPDSLWYLLQKLWLLAADLFLLSGNDDEARSCLLEASKIDPLSASVYYLRGLLLEVKGQ  699 (799)
T ss_pred             HHhhhhhcccccccCcccccCCCCchHHHHHHHHHHHHHHHHhcCCchHHHHHHHHHHhcchhhHHHHHHhhHHHHHHHh
Confidence                                  0011112356788999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHhhCCCChhHHHHHHHHHHHhCCCChHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCChHHHHHHHHH
Q 005499          597 THEALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGRIADAADCFQA  676 (693)
Q Consensus       597 ~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~l~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~  676 (693)
                      +++|.+.|..++.++|+++++...+|.++.+.|+..+.++..++..+++++|.++++|+.+|.++..+|+.++|.++|+.
T Consensus       700 ~~EA~~af~~Al~ldP~hv~s~~Ala~~lle~G~~~la~~~~~L~dalr~dp~n~eaW~~LG~v~k~~Gd~~~Aaecf~a  779 (799)
T KOG4162|consen  700 LEEAKEAFLVALALDPDHVPSMTALAELLLELGSPRLAEKRSLLSDALRLDPLNHEAWYYLGEVFKKLGDSKQAAECFQA  779 (799)
T ss_pred             hHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHhCCcchHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHccchHHHHHHHHH
Confidence            99999999999999999999999999999999999833444499999999999999999999999999999999999999


Q ss_pred             HHhcccCCCCCccccCC
Q 005499          677 ASMLEESDPIESFSSIA  693 (693)
Q Consensus       677 al~l~p~~~~~~~~~i~  693 (693)
                      |+++++++|+.||++|+
T Consensus       780 a~qLe~S~PV~pFs~ip  796 (799)
T KOG4162|consen  780 ALQLEESNPVLPFSNIP  796 (799)
T ss_pred             HHhhccCCCcccccccC
Confidence            99999999999999985

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 5e-06
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 2e-04
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure 
Iteration: 1

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 57/134 (42%), Gaps = 2/134 (1%)
Query: 548 QVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAYINA 607
           + W+ L N Y     + +      KA EL   SAE  +  G  +   G   EA+  Y  A
Sbjct: 2   EAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKA 61
Query: 608 LLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGRI 667
           L ++P        +G+ + K G      A      AL ++P + +AWY LG  +   G  
Sbjct: 62  LELDPRSAEAWYNLGNAYYKQGD--YDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDY 119
Query: 668 ADAADCFQAASMLE 681
            +A + +Q A  L+
Sbjct: 120 DEAIEYYQKALELD 133
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-13
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-06
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-13
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-06
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-11
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-10
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 7e-09
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 3e-07
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 8e-07
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-10
2gw1_A 514 Mitochondrial precursor proteins import receptor; 7e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-10
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 9e-07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-10
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-04
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-09
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-05
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-09
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-05
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-04
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 8e-09
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 9e-09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 7e-05
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 3e-08
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 8e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-07
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-08
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-07
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 5e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-06
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 7e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 8e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 9e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 6e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 9e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-06
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 4e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-04
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 1e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 8e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-04
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
 Score = 71.4 bits (174), Expect = 5e-13
 Identities = 30/137 (21%), Positives = 55/137 (40%), Gaps = 2/137 (1%)

Query: 545 NEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAY 604
                 + LAN+     + ++      KA E+    A        + +  G+  EAL  Y
Sbjct: 7   THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHY 66

Query: 605 INALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDD 664
             A+ I P++      +G+   ++    +  A    + A++I P    A   L  +HKD 
Sbjct: 67  KEAIRISPTFADAYSNMGNTLKEMQ--DVQGALQCYTRAIQINPAFADAHSNLASIHKDS 124

Query: 665 GRIADAADCFQAASMLE 681
           G I +A   ++ A  L+
Sbjct: 125 GNIPEAIASYRTALKLK 141
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 693
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-13
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-10
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-05
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.004
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 3e-04
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 0.003
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 69.3 bits (168), Expect = 4e-13
 Identities = 56/374 (14%), Positives = 108/374 (28%), Gaps = 5/374 (1%)

Query: 312 LALCYSAIGQNDAALNLLRKSLHKHERPNDLMALLLAAKICSEDCHLAAEGIQYARTALS 371
           LA      G  +AA     +   +   P++   LLL + I  +   L      ++  A+ 
Sbjct: 5   LAHREYQAGDFEAAERHCMQLWRQE--PDNTGVLLLLSSIHFQCRRLD-RSAHFSTLAIK 61

Query: 372 NAQGKDEHLKGVGLRMLGLCLGRHAKVSSSDYERSRLQSEALKSLDGASTFENNNADLFF 431
                 E    +G         + A        R +           A+     + +   
Sbjct: 62  QNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAV 121

Query: 432 DLEQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTDAALDETTKWE 491
                 L           D        G    A     +   ++       +        
Sbjct: 122 QAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNA 181

Query: 492 QGPILRLKAKLKIAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQIEDDKVNEFQVWH 551
           QG I       + A  L  + ++ Y  L  +++  R     +    +      N   V  
Sbjct: 182 QGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHG 241

Query: 552 GLANLYSGLSHWKDVAICMGKARELKAYSAEMLHTEGVMHEGCGQTHEALRAYINALLIE 611
            LA +Y              +A EL+ +  +         +  G   EA   Y  AL + 
Sbjct: 242 NLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC 301

Query: 612 PSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKDDGRIADAA 671
           P++      + ++  + G   +  A  L   AL + P    A   L  V +  G++ +A 
Sbjct: 302 PTHADSLNNLANIKREQG--NIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEAL 359

Query: 672 DCFQAASMLEESDP 685
             ++ A  +  +  
Sbjct: 360 MHYKEAIRISPTFA 373
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.94
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.94
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.87
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.87
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.84
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.82
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.81
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.8
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.77
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.75
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.65
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.64
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.58
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.57
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.5
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.43
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.42
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.4
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.34
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.33
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.31
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.31
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.26
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.24
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.2
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.19
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.17
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.16
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.15
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.1
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.09
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.03
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.0
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.0
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.97
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.89
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.82
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.76
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.7
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.69
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.52
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.5
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.5
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.46
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.42
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.55
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.35
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.32
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.15
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.05
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-34  Score=266.74  Aligned_cols=354  Identities=20%  Similarity=0.165  Sum_probs=292.2

Q ss_pred             CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCHHHHHHH
Q ss_conf             99578999999999932898999999994369999967899999999998799289999999986123899997999999
Q 005499          269 KWDPAVMEHLTYALSLCSQTSILAKQLEEIMPGVFLRSDRWNALALCYSAIGQNDAALNLLRKSLHKHERPNDLMALLLA  348 (693)
Q Consensus       269 p~~~~~~~~l~~~~~~~g~~~~a~~~~e~~l~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~~~p~~~~~~~~~  348 (693)
                      |.++.++..++.++...|+++.|+..|+++++..|.....|+.+|.++...|++++|+..+..+..  .+|.........
T Consensus        30 p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~--~~~~~~~~~~~~  107 (388)
T d1w3ba_          30 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALR--LKPDFIDGYINL  107 (388)
T ss_dssp             TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHH--HCTTCHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCC--CCCCCCCCCCCC
T ss_conf             998999999999999869999999999999985999899999999996420002222222221211--222222222222


Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHH
Q ss_conf             99997539968999999999987105987403476899999788641034677688749899999999997742988747
Q 005499          349 AKICSEDCHLAAEGIQYARTALSNAQGKDEHLKGVGLRMLGLCLGRHAKVSSSDYERSRLQSEALKSLDGASTFENNNAD  428 (693)
Q Consensus       349 a~~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~lg~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p~~~~  428 (693)
                      ........... .............+   ..  .......+......+..           ..+...+.+.+...|.+..
T Consensus       108 ~~~~~~~~~~~-~~~~~~~~~~~~~~---~~--~~~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~~~  170 (388)
T d1w3ba_         108 AAALVAAGDME-GAVQAYVSALQYNP---DL--YCVRSDLGNLLKALGRL-----------EEAKACYLKAIETQPNFAV  170 (388)
T ss_dssp             HHHHHHHSCSS-HHHHHHHHHHHHCT---TC--THHHHHHHHHHHTTSCH-----------HHHHHHHHHHHHHCTTCHH
T ss_pred             CCCCCCCCCCC-CCCCCCCCCCCCCC---CC--CCCCCCCCCCCCCCCHH-----------HHHHHHHHHHHCCCCCHHH
T ss_conf             22222222222-22222111222222---22--22222222222110001-----------3567888874025861068


Q ss_pred             HHHHH-----HHCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             88889-----7189989999999999963999299999999999982994799999999984237988538999999999
Q 005499          429 LFFDL-----EQRNLSTALRYAKQYIDATGGSVLKGWKLLALVLSAQQRFSEAEVVTDAALDETTKWEQGPILRLKAKLK  503 (693)
Q Consensus       429 ~~~~l-----~~~~~~~A~~~~~~al~~~p~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~la~~~  503 (693)
                      .+..+     ..++++.|...++++++.+|++. .++..+|.++...|++++|+..++++....|  .....+..+|.++
T Consensus       171 ~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~-~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~--~~~~~~~~l~~~~  247 (388)
T d1w3ba_         171 AWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFL-DAYINLGNVLKEARIFDRAVAAYLRALSLSP--NHAVVHGNLACVY  247 (388)
T ss_dssp             HHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCH-HHHHHHHHHHHTTTCTTHHHHHHHHHHHHCT--TCHHHHHHHHHHH
T ss_pred             HHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCH-HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH--HHHHHHHHHHHHH
T ss_conf             998636301024719999999999998494649-9999971552200529999999998577755--4799999999999


Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHH
Q ss_conf             99099369999999999999951542097322220001002389999999999980999589999999988208799999
Q 005499          504 IAQALPMDAIETYRYLLALVQAQRKSFGPLRCLSQIEDDKVNEFQVWHGLANLYSGLSHWKDVAICMGKARELKAYSAEM  583 (693)
Q Consensus       504 ~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~  583 (693)
                      ...|++++|+..|+++++..                    |....++..+|.++...|++.+|+..++.++...|.....
T Consensus       248 ~~~~~~~~A~~~~~~al~~~--------------------p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~  307 (388)
T d1w3ba_         248 YEQGLIDLAIDTYRRAIELQ--------------------PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADS  307 (388)
T ss_dssp             HHTTCHHHHHHHHHHHHHTC--------------------SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHH
T ss_pred             HHCCCHHHHHHHHHHHHHHC--------------------CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCHH
T ss_conf             98789999999999999849--------------------9989999999999997487999999998654048730010


Q ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             99999999978994899999999994099990689999999998099996999999999996099999999999999997
Q 005499          584 LHTEGVMHEGCGQTHEALRAYINALLIEPSYVPCKVLVGSLFSKLGPKALPVARSLLSDALRIEPTNRKAWYYLGLVHKD  663 (693)
Q Consensus       584 ~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~l~~A~~~~~~al~~~p~~~~~~~~lg~~~~~  663 (693)
                      +..+|.++...|++++|+..|+++++.+|+++.++.++|.++..+|+++  +|+..|+++++++|+++.+|.++|.+|..
T Consensus       308 ~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~--~A~~~~~~al~l~P~~~~a~~~lg~~~~~  385 (388)
T d1w3ba_         308 LNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQ--EALMHYKEAIRISPTFADAYSNMGNTLKE  385 (388)
T ss_dssp             HHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCH--HHHHHHHHHHTTCTTCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHH--HHHHHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             1579999998789999999999999868898999999999999859999--99999999997099989999999999998


Q ss_pred             CCC
Q ss_conf             599
Q 005499          664 DGR  666 (693)
Q Consensus       664 ~g~  666 (693)
                      +|+
T Consensus       386 ~~D  388 (388)
T d1w3ba_         386 MQD  388 (388)
T ss_dssp             TCC
T ss_pred             CCC
T ss_conf             589
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure