Citrus Sinensis ID: 005542

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-
METKTAYIDVCDDTSNSQPAKSFEVKAITANIPAVTSEGIYPGQLRHLDLGNNHFVGKIPASLDNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTTPTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSRKLRRVIRRGRAGRRSLLVHL
ccccccEEEcccccccccccccccccccEEEcccccccccccccccEEEcccccccccccccccccccccccccccccccccEEEccccccEEEEccHHHcccccccEEEcccEEEEEEcccccccccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHHHHccccccEEEccccccccccccccccccEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccEEEEEccccccccccccEEEccccccccccccccccccccEEEccccccEEcccccccccccccEEEccccEEEEcccHHHHccccccEEEcccccccccccHHccccccccEEEcccccccEEccccccccccccccEEEcccccccccccHHHHHcHHHHccccccccEEEccccccccEEEEEEEEEEccHHHHHHHccccEEEEcccccccccccHHHHccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccEEEEEEEHHcccccccccccc
cccccccccccccccccEEEEEcccccccccccccHccHHccccccEEEcccccccccccHHHcccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEEcccccccccccHHHHHHcHcccEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccccEEEEccccccccccccccccccEEEcccccccccccHHHcccccccccccEEEEEccccEEccccHHHHHcccccEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccccEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccEEEEcccccccccccHHHcccccEEEEEcccccEEccccHHHHHcccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccHHHccHHHcccccEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHcccccEEEEc
metktayidvcddtsnsqpaksfevkaitanipavtsegiypgqlrhldlgnnhfvgkipasldnqligsipssIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNIslsvstkltvnssfpnlwalglsacnisefpdilktqhqldwldlsenqirgripswmwdigvHTLFRLDLSRNfltsidhlpwknlefLTLDSnllqgslpnlpphmtyakgcnltylrlsgnhlegplppslsncvnlqvldvgnnnlsgpipeclgnstrlsfldvrnnnlsgpipeclgnstslsfldvgnnslsgpipeylgnstLEVLDMRMnkfsgslpqtfgkSCVLVSLKlngnrlegplppslvncrhlevidvgnnqinetfphwldvlpeLQVLtlrsnrfcgpigdtktrvpfpklriidlsynqftgvlpiwyLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATidlssnrfQGEISEVLGKLNSlkslnishnnltggipsslrnltelesldlssnklagriptqlASLNYLSVLNlsnnqlegpipggpqfntfgidsysgnvglcgfplskicrideapepttptgfiegddasswFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSRKLRRVIRRGRAGRRSLLVHL
metktayidvcddtsnsqpaKSFEVKAITANIPAVTSEGIYPGQLRHLDLGNNHFVGKIPASLDNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRfcgpigdtktrvpfPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTTPTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERqqsrklrrvirrgragrrsllvhl
METKTAYIDVCDDTSNSQPAKSFEVKAITANIPAVTSEGIYPGQLRHLDLGNNHFVGKIPASLDNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQlaslnylsvlnlsnnqlEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTTPTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSrklrrvirrgragrrSLLVHL
**********************FEVKAITANIPAVTSEGIYPGQLRHLDLGNNHFVGKIPASLDNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGI*******************LAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTTPTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIER************************
METKTAYIDVCDDTSNSQPAKSFEVKAITANIPAVTSEGIYPGQLRHLDLGNNHFVGKIPASLDNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFK**************MRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGF*****************************FDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSRKLRRVIRRGRAGR**L****
METKTAYIDVCDDTSNSQPAKSFEVKAITANIPAVTSEGIYPGQLRHLDLGNNHFVGKIPASLDNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTTPTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSRKLRRVIRRGRAGRRSLLVHL
METKTAYIDVCDDTSNSQPAKSFEVKAITANIPAVTSEGIYPGQLRHLDLGNNHFVGKIPASLDNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKIC*********************SWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSRKLRRVIRR******S*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METKTAYIDVCDDTSNSQPAKSFEVKAITANIPAVTSEGIYPGQLRHLDLGNNHFVGKIPASLDNQLIGSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTTPTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQSRKLRRVIRRGRAGRRSLLVHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query691 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 yes no 0.861 0.702 0.357 8e-99
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.772 0.426 0.324 3e-60
C0LGQ5 1249 LRR receptor-like serine/ no no 0.798 0.441 0.322 1e-57
Q9FL28 1173 LRR receptor-like serine/ no no 0.790 0.465 0.320 3e-54
Q8VZG8 1045 Probable LRR receptor-lik no no 0.716 0.473 0.312 4e-53
Q9LP24 1120 Probable leucine-rich rep no no 0.777 0.479 0.290 4e-51
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.739 0.423 0.324 9e-51
Q8L899 1207 Systemin receptor SR160 O N/A no 0.739 0.423 0.324 4e-50
Q9ZPS9 1143 Serine/threonine-protein no no 0.816 0.493 0.3 4e-49
O82318 960 Probably inactive leucine no no 0.794 0.571 0.299 1e-48
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  362 bits (928), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 241/675 (35%), Positives = 355/675 (52%), Gaps = 80/675 (11%)

Query: 44  QLRHLDLGNNHFVGKIPASL------------DNQLIGSIPSSIFELVNLTFVSLSFNNF 91
           QLR+L L +N+ +G+IP+SL             NQL+G +P+SI  L+ L  +S   N+ 
Sbjct: 207 QLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENNSL 266

Query: 92  SGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQ 151
           SG++ +  FA L  L   +LS+ + +                        S FP  +   
Sbjct: 267 SGNIPI-SFANLTKLSIFVLSSNNFT------------------------STFPFDMSIF 301

Query: 152 HQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTS----IDHLPWKNLEFLTLD 207
           H L++ D+S N   G  P  +  + + +L  + L  N  T      +      L+ L L 
Sbjct: 302 HNLEYFDVSYNSFSGPFPKSL--LLIPSLESIYLQENQFTGPIEFANTSSSTKLQDLILG 359

Query: 208 SNLLQGSLPNLPPHMTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGP 267
            N L G +P      + ++  NL  L +S N+  G +PP++S  VNL  LD+  NNL G 
Sbjct: 360 RNRLHGPIPE-----SISRLLNLEELDISHNNFTGAIPPTISKLVNLLHLDLSKNNLEGE 414

Query: 268 IPECLG--NSTRLSF------------------LDVRNNNLSGPIPECLGNSTSLSFLDV 307
           +P CL   N+  LS                   LD+ +N+  GPIP  +   +SL FLD+
Sbjct: 415 VPACLWRLNTMVLSHNSFSSFENTSQEEALIEELDLNSNSFQGPIPYMICKLSSLGFLDL 474

Query: 308 GNNSLSGPIPEYLGN--STLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPP 365
            NN  SG IP  + N   +++ L++  N FSG+LP  F K+  LVSL ++ N+LEG  P 
Sbjct: 475 SNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPK 534

Query: 366 SLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRI 425
           SL+NC+ LE+++V +N+I + FP WL+ LP L VL LRSN+F GP+      + F  LRI
Sbjct: 535 SLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRI 594

Query: 426 IDLSYNQFTGVLPIWYLNGFKAM--MRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQM 483
           ID+S+N F+G LP +Y + +K M  +  + +     + R  + SYY  + +  KG D+  
Sbjct: 595 IDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEFWRYAD-SYYHEMEMVNKGVDMSF 653

Query: 484 ERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDL 543
           ERI   F  ID S N+  G I E LG L  L+ LN+S N  T  IP  L NLT+LE+LD+
Sbjct: 654 ERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDI 713

Query: 544 SSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSK 603
           S NKL+G+IP  LA+L++LS +N S+N L+GP+P G QF      S+  N GL G  L  
Sbjct: 714 SRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYG--LED 771

Query: 604 ICRIDEAPEPTT--PTGFIEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWF 661
           ICR   A  PT+  P    E ++  + F+W  A + Y  GV+ GL IG+  + +   +WF
Sbjct: 772 ICRDTGALNPTSQLPEDLSEAEE--NMFNWVAAAIAYGPGVLCGLVIGHF-YTSHNHEWF 828

Query: 662 VRMIERQQSRKLRRV 676
                R+Q + L  V
Sbjct: 829 TEKFGRKQHKALTSV 843
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query691
357493485 1060 Receptor-like protein kinase [Medicago t 0.874 0.569 0.445 1e-137
357493471 1109 Receptor-like protein kinase [Medicago t 0.848 0.528 0.443 1e-136
224116970 921 predicted protein [Populus trichocarpa] 0.820 0.615 0.475 1e-136
357493411 1140 Receptor-like protein kinase [Medicago t 0.871 0.528 0.441 1e-134
357493481 1087 Receptor-like protein kinase [Medicago t 0.878 0.558 0.443 1e-133
296082718745 unnamed protein product [Vitis vinifera] 0.833 0.773 0.446 1e-131
225462116 1001 PREDICTED: receptor-like protein 12-like 0.887 0.612 0.423 1e-130
359493539 1001 PREDICTED: receptor-like protein 12-like 0.793 0.547 0.448 1e-129
357471225 1385 Receptor-like protein kinase [Medicago t 0.842 0.420 0.440 1e-126
359493479 814 PREDICTED: receptor-like protein 12-like 0.751 0.637 0.464 1e-124
>gi|357493485|ref|XP_003617031.1| Receptor-like protein kinase [Medicago truncatula] gi|355518366|gb|AES99989.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
 Score =  494 bits (1273), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 293/658 (44%), Positives = 395/658 (60%), Gaps = 54/658 (8%)

Query: 45   LRHLDLGNNHFVGKIP-------ASLD---NQLIGSIPSSIFELVNLTFVSLSFNNFSGS 94
            L  L L +NH  G I         SLD   N L G  P+SIF+L NLT++ LS  N SG 
Sbjct: 441  LLELGLSDNHLTGFIGEFSTYSLQSLDLSNNNLQGHFPNSIFQLQNLTYLYLSSTNLSGV 500

Query: 95   VELYDFAKLKNLKYLILS-NISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQHQ 153
            V+ + F+KL  L YL+LS N  LS++   +++S  PNL++L LS+ NI+ FP        
Sbjct: 501  VDFHQFSKLNKLWYLVLSHNTFLSINIDSSIDSIIPNLFSLDLSSANINSFPKF--QARN 558

Query: 154  LDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQG 213
            L  LDLS N I G+IP W      HT          L S     WK++ ++ L  N+LQG
Sbjct: 559  LQTLDLSNNNIHGKIPKWF-----HT--------KLLNS-----WKDIRYIDLSFNMLQG 600

Query: 214  SLPNLPPHMTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSG--PIPEC 271
             LP +PP         + Y  LS N+  G +  +  N  +L  L++ +NN  G  PIP  
Sbjct: 601  DLP-IPP-------SGIQYFSLSNNNFTGNISSTFRNASSLYTLNLAHNNFQGDLPIPP- 651

Query: 272  LGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGN-STLEVLDM 330
                + + +  + NNN +G I     N++SL  LD+ +N+L G IP+ LG    L VLDM
Sbjct: 652  ----SGIQYFSLSNNNFTGYISSTFCNASSLYVLDLAHNNLKGMIPQCLGTFPNLYVLDM 707

Query: 331  RMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHW 390
            +MN   GS+P+TF K     ++KLNGN+LEG LP SL NC +LEV+D+G+N + +TFP W
Sbjct: 708  QMNNLYGSIPRTFTKGNAFETIKLNGNQLEGSLPQSLANCSYLEVLDLGDNNVEDTFPDW 767

Query: 391  LDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMR 450
            L+ LPELQV++LRSN   G I  + T+  FPKLRI D+S N F+G LP   +  F+ MM+
Sbjct: 768  LETLPELQVISLRSNNLHGAITCSSTKHTFPKLRIFDVSNNNFSGPLPASCIKNFQGMMK 827

Query: 451  RDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGK 510
             +D  I++ YMR  N  Y +S+ +T+KG  I++ RILT F TIDLS+N F+GEI +V+G+
Sbjct: 828  VNDKKIDLQYMR--NGYYNDSVVVTVKGFFIELTRILTAFTTIDLSNNMFEGEIPQVIGE 885

Query: 511  LNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNN 570
            LNSLK LN+S+N +T  IP SL +L  LE LDLS N+L G IP  L +LN+LSVLNLS N
Sbjct: 886  LNSLKGLNLSNNGITSSIPQSLSHLRNLEWLDLSCNQLKGEIPVALTNLNFLSVLNLSQN 945

Query: 571  QLEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTTPTGFIEGDDASSWFD 630
             LEG IP G QFNTFG DS+ GN  LCGFPLSK C+ +E   P + +     D+  S F 
Sbjct: 946  HLEGIIPKGQQFNTFGNDSFEGNTMLCGFPLSKSCKNEEDLPPHSTS----EDEEESGFG 1001

Query: 631  WKLAMLGYASGVVIGLSIGY-MAFVTGRPQWFVRMIERQQSRKLRRVIRRGRAGRRSL 687
            WK   +GYA G + GL  GY + F TG+P+W VR +E     +L+R   R  A RR +
Sbjct: 1002 WKAVAIGYACGAIFGLLFGYNVFFFTGKPEWLVRHVEHMFDIRLKRTNNRAIANRRRM 1059

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357493471|ref|XP_003617024.1| Receptor-like protein kinase [Medicago truncatula] gi|355518359|gb|AES99982.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|224116970|ref|XP_002331797.1| predicted protein [Populus trichocarpa] gi|222874493|gb|EEF11624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357493411|ref|XP_003616994.1| Receptor-like protein kinase [Medicago truncatula] gi|355518329|gb|AES99952.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357493481|ref|XP_003617029.1| Receptor-like protein kinase [Medicago truncatula] gi|355518364|gb|AES99987.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|296082718|emb|CBI21723.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462116|ref|XP_002263233.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493539|ref|XP_002267388.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357471225|ref|XP_003605897.1| Receptor-like protein kinase [Medicago truncatula] gi|355506952|gb|AES88094.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|359493479|ref|XP_003634609.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query691
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.876 0.715 0.363 9.6e-89
TAIR|locus:2825389784 RLP11 "AT1G71390" [Arabidopsis 0.876 0.772 0.360 4.4e-84
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.888 0.701 0.348 2.2e-82
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.882 0.598 0.347 5.2e-81
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.842 0.673 0.348 2.2e-80
TAIR|locus:2046600800 RLP26 "receptor like protein 2 0.897 0.775 0.331 3.7e-80
TAIR|locus:2180587811 RLP52 "receptor like protein 5 0.918 0.782 0.339 9.7e-80
TAIR|locus:2086979890 RLP42 "receptor like protein 4 0.875 0.679 0.343 1.1e-78
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.874 0.631 0.340 4.8e-78
TAIR|locus:2046585808 RLP27 "receptor like protein 2 0.874 0.747 0.336 7.9e-78
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 886 (316.9 bits), Expect = 9.6e-89, P = 9.6e-89
 Identities = 236/650 (36%), Positives = 339/650 (52%)

Query:    44 QLRHLDLGNNHFVGKIPASLDN------------QLIGSIPSSIFELVNLTFVSLSFNNF 91
             QLR+L L +N+ +G+IP+SL N            QL+G +P+SI  L+ L  +S   N+ 
Sbjct:   207 QLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENNSL 266

Query:    92 SGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNIS-EFPDILKT 150
             SG++ +  FA L  L   +LS+ + + +    + S F NL    +S  + S  FP  L  
Sbjct:   267 SGNIPI-SFANLTKLSIFVLSSNNFTSTFPFDM-SIFHNLEYFDVSYNSFSGPFPKSLLL 324

Query:   151 QHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFL-----TSIDHLPWKNLEFLT 205
                L+ + L ENQ  G I  +        L  L L RN L      SI  L   NLE L 
Sbjct:   325 IPSLESIYLQENQFTGPI-EFANTSSSTKLQDLILGRNRLHGPIPESISRL--LNLEELD 381

Query:   206 LDSNLLQGSLPNLPPHMTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLS 265
             +  N   G++P   P  T +K  NL +L LS N+LEG +P  L   +N  VL   +N+ S
Sbjct:   382 ISHNNFTGAIP---P--TISKLVNLLHLDLSKNNLEGEVPACLWR-LNTMVLS--HNSFS 433

Query:   266 GPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGN--S 323
                         +  LD+ +N+  GPIP  +   +SL FLD+ NN  SG IP  + N   
Sbjct:   434 S-FENTSQEEALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSG 492

Query:   324 TLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQI 383
             +++ L++  N FSG+LP  F K+  LVSL ++ N+LEG  P SL+NC+ LE+++V +N+I
Sbjct:   493 SIKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKI 552

Query:   384 NETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLN 443
              + FP WL+ LP L VL LRSN+F GP+      + F  LRIID+S+N F+G LP +Y +
Sbjct:   553 KDIFPSWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFS 612

Query:   444 GFKAM--MRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQ 501
              +K M  +  + +     + R  + SYY  + +  KG D+  ERI   F  ID S N+  
Sbjct:   613 NWKDMTTLTEEMDQYMTEFWRYAD-SYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKIN 671

Query:   502 GEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQXXXXXX 561
             G I E LG L  L+ LN+S N  T  IP  L NLT+LE+LD+S NKL+G+IP        
Sbjct:   672 GNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSF 731

Query:   562 XXXXXXXXXXXEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSKICRIDEAPEPTT--PTGF 619
                        +GP+P G QF      S+  N GL G  L  ICR   A  PT+  P   
Sbjct:   732 LSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYG--LEDICRDTGALNPTSQLPEDL 789

Query:   620 IEGDDASSWFDWKLAMLGYASGVVIGLSIGYMAFVTGRPQWFVRMIERQQ 669
              E ++  + F+W  A + Y  GV+ GL IG+  + +   +WF     R+Q
Sbjct:   790 SEAEE--NMFNWVAAAIAYGPGVLCGLVIGHF-YTSHNHEWFTEKFGRKQ 836
GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC;RCA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2825389 RLP11 "AT1G71390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046600 RLP26 "receptor like protein 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086979 RLP42 "receptor like protein 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query691
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-62
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-46
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-38
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-17
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  222 bits (568), Expect = 7e-62
 Identities = 175/561 (31%), Positives = 266/561 (47%), Gaps = 65/561 (11%)

Query: 69  GSIPSSIFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSF 128
           G I S+IF L  +  ++LS N  SG +    F    +L+YL LSN + + S       S 
Sbjct: 83  GKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIP---RGSI 139

Query: 129 PNLWALGLSACNIS-EFPDILKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSR 187
           PNL  L LS   +S E P+ + +   L  LDL  N + G+IP+ + ++   +L  L L+ 
Sbjct: 140 PNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLT--SLEFLTLAS 197

Query: 188 NFLTSIDHLP-----WKNLEFLTLDSNLLQGSLPN---------------------LPPH 221
           N L     +P      K+L+++ L  N L G +P                      +P  
Sbjct: 198 NQLVG--QIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSS 255

Query: 222 MTYAKGCNLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFL 281
           +   K  NL YL L  N L GP+PPS+ +   L  LD+ +N+LSG IPE +     L  L
Sbjct: 256 LGNLK--NLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEIL 313

Query: 282 DVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLG-NSTLEVLDMRMNKFSGSLP 340
            + +NN +G IP  L +   L  L + +N  SG IP+ LG ++ L VLD+  N  +G +P
Sbjct: 314 HLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIP 373

Query: 341 QTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVL 400
           +    S  L  L L  N LEG +P SL  CR L  + + +N  +   P     LP +  L
Sbjct: 374 EGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFL 433

Query: 401 TLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNY 460
            + +N   G I   K  +P   L+++ L+ N+F G LP               +S     
Sbjct: 434 DISNNNLQGRINSRKWDMP--SLQMLSLARNKFFGGLP---------------DSFGSKR 476

Query: 461 MRSLNYS---YYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSL 517
           + +L+ S   +  ++   +          L+    + LS N+  GEI + L     L SL
Sbjct: 477 LENLDLSRNQFSGAVPRKL--------GSLSELMQLKLSENKLSGEIPDELSSCKKLVSL 528

Query: 518 NISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQLEGPIP 577
           ++SHN L+G IP+S   +  L  LDLS N+L+G IP  L ++  L  +N+S+N L G +P
Sbjct: 529 DLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLP 588

Query: 578 GGPQFNTFGIDSYSGNVGLCG 598
               F      + +GN+ LCG
Sbjct: 589 STGAFLAINASAVAGNIDLCG 609

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 691
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.6
PLN03150623 hypothetical protein; Provisional 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
PLN03150623 hypothetical protein; Provisional 99.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.07
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.07
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.04
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.03
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.03
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.98
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.81
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.79
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.69
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.31
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.28
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.26
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.2
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.18
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.12
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.1
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.08
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.87
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.77
PRK15386426 type III secretion protein GogB; Provisional 97.76
PRK15386426 type III secretion protein GogB; Provisional 97.73
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.67
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.58
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.33
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.25
KOG4341483 consensus F-box protein containing LRR [General fu 97.18
KOG4341483 consensus F-box protein containing LRR [General fu 97.12
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.08
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.82
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.73
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.52
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.96
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.49
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.18
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.17
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.97
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.93
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.72
KOG4308478 consensus LRR-containing protein [Function unknown 92.42
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.05
KOG4308478 consensus LRR-containing protein [Function unknown 91.25
smart0037026 LRR Leucine-rich repeats, outliers. 89.97
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.97
smart0037026 LRR Leucine-rich repeats, outliers. 89.03
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.03
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.58
KOG0473326 consensus Leucine-rich repeat protein [Function un 82.68
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.17
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1e-62  Score=583.80  Aligned_cols=552  Identities=32%  Similarity=0.480  Sum_probs=446.8

Q ss_pred             cccccccccCCCCCCCcCc-ceeeeeeeec-cCCcc-cCCCCCCCCcEEECcCCcccccCCCCCCCCccccCCcccc-CC
Q 005542            3 TKTAYIDVCDDTSNSQPAK-SFEVKAITAN-IPAVT-SEGIYPGQLRHLDLGNNHFVGKIPASLDNQLIGSIPSSIF-EL   78 (691)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~-~~~~~-~~~~~~~~L~~LdLs~n~l~~~~~~~~~n~~~g~lp~~l~-~l   78 (691)
                      .|..+.++|.|.+.+|... .+....+.++ +.... .....+++|++|||++|+++|.+|            ..+. .+
T Consensus        50 ~w~~~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip------------~~~~~~l  117 (968)
T PLN00113         50 NWNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIP------------DDIFTTS  117 (968)
T ss_pred             CCCCCCCCCcCcceecCCCCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCC------------hHHhccC
Confidence            4666788999998887642 2222222221 11111 112257899999999998875544            5554 78


Q ss_pred             CCCCEEEccCccCccccChhhhcCCCCCCEEEccCCCceeeeeccCCC-CCCCccEEEccCCCCC-CchhhhhCCCCCCE
Q 005542           79 VNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNS-SFPNLWALGLSACNIS-EFPDILKTQHQLDW  156 (691)
Q Consensus        79 ~~L~~L~Ls~n~~~~~i~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~-~l~~L~~L~L~~n~l~-~lp~~l~~l~~L~~  156 (691)
                      ++|++|+|++|.+++.+|   ...+++|++|+|++|.  ..+..|... .+++|++|++++|.+. .+|..+.++++|++
T Consensus       118 ~~L~~L~Ls~n~l~~~~p---~~~l~~L~~L~Ls~n~--~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~  192 (968)
T PLN00113        118 SSLRYLNLSNNNFTGSIP---RGSIPNLETLDLSNNM--LSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEF  192 (968)
T ss_pred             CCCCEEECcCCccccccC---ccccCCCCEEECcCCc--ccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCe
Confidence            889999998888887777   2557888899998888  445555433 5888899999888886 67888888888999


Q ss_pred             EEccCCcCCccCChhHhhcCcCcccEEECCCCcCCccCC---CCCCCcCEEeccCccCcccCCCCCCcccccCCCCccEE
Q 005542          157 LDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDH---LPWKNLEFLTLDSNLLQGSLPNLPPHMTYAKGCNLTYL  233 (691)
Q Consensus       157 L~Ls~n~l~~~~p~~~~~~~~~~L~~L~ls~n~l~~~~~---~~~~~L~~L~L~~n~l~~~~~~~~~~~~~~~~~~L~~L  233 (691)
                      |++++|.+.+.+|..+..+  ++|++|++++|.+.+..+   ..+++|++|++++|.+.+.+|..+..     +++|++|
T Consensus       193 L~L~~n~l~~~~p~~l~~l--~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~-----l~~L~~L  265 (968)
T PLN00113        193 LTLASNQLVGQIPRELGQM--KSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGN-----LKNLQYL  265 (968)
T ss_pred             eeccCCCCcCcCChHHcCc--CCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhC-----CCCCCEE
Confidence            9998888888888888877  888889988888887666   46788888889888888888877766     7788888


Q ss_pred             EccCCCCCCCCCccccCCCCCCEEEeeCCcCCCCcCcccCCCCCCCEEEccCCcccccCcccccCCCCCcEEEccCcccc
Q 005542          234 RLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLS  313 (691)
Q Consensus       234 ~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~  313 (691)
                      ++++|.+.+.+|..+..+++|++|++++|.+.+.+|..+..+++|++|++++|.+.+..|..+..+++|+.|++++|.+.
T Consensus       266 ~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~  345 (968)
T PLN00113        266 FLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFS  345 (968)
T ss_pred             ECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCc
Confidence            88888888888888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             ccccchhhcc-CCCeEEccCCcccccCCccccCCCCccEEEccCCcccCCCCccccCCCCccEEEccCCCCCcCcchhhc
Q 005542          314 GPIPEYLGNS-TLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLD  392 (691)
Q Consensus       314 ~~~~~~~~~~-~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~  392 (691)
                      +.+|..+... +|+.|++++|.+.+.+|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++|++++..|..+.
T Consensus       346 ~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~  425 (968)
T PLN00113        346 GEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFT  425 (968)
T ss_pred             CcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHh
Confidence            8887766543 888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             CCCCccEEEcccCcCcCcCCCCCCCCCCCCccEEEcCCCcCccCCChHhhhcccccccccCCccccccccccccccceee
Q 005542          393 VLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESI  472 (691)
Q Consensus       393 ~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~L~~L~ls~n~l~~~~p~~~~~~~~~l~~~~~~~~~~~~l~~~~~~~~~~~  472 (691)
                      .++.|+.|++++|.+++.++...  ..+++|+.|++++|++.+.+|..+  ....+..++...+.+..            
T Consensus       426 ~l~~L~~L~Ls~N~l~~~~~~~~--~~l~~L~~L~L~~n~~~~~~p~~~--~~~~L~~L~ls~n~l~~------------  489 (968)
T PLN00113        426 KLPLVYFLDISNNNLQGRINSRK--WDMPSLQMLSLARNKFFGGLPDSF--GSKRLENLDLSRNQFSG------------  489 (968)
T ss_pred             cCCCCCEEECcCCcccCccChhh--ccCCCCcEEECcCceeeeecCccc--ccccceEEECcCCccCC------------
Confidence            88888888888888888777655  567888888888888888877542  23444444443332210            


Q ss_pred             EEEecCCchhhhhhcccccEEEccCCcccccCChhhhccCCCcceeccccccccCccccccCCCCCCEEeCCCCcCCCcC
Q 005542          473 SLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRI  552 (691)
Q Consensus       473 ~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~  552 (691)
                            ........+++|+.|+|++|.+.+.+|..+.++++|++|+|++|.+++.+|..++.+++|+.|+|++|++++.+
T Consensus       490 ------~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~  563 (968)
T PLN00113        490 ------AVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEI  563 (968)
T ss_pred             ------ccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccC
Confidence                  00111233788999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCCCCCEEEccCCeeeccCCCCCCCCccCCcccCCCCCCCCCC
Q 005542          553 PTQLASLNYLSVLNLSNNQLEGPIPGGPQFNTFGIDSYSGNVGLCGFP  600 (691)
Q Consensus       553 p~~l~~l~~L~~L~ls~N~l~g~ip~~~~~~~~~~~~~~gn~~lcg~~  600 (691)
                      |..+..+++|+.|++++|+++|.+|...++.++...+|.||+.+||.+
T Consensus       564 p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        564 PKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             ChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            999999999999999999999999999999999999999999999864

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query691
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-42
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-31
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-42
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-31
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-14
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-14
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-04
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 4e-05
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 4e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  169 bits (429), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 189/635 (29%), Positives = 273/635 (42%), Gaps = 92/635 (14%)
Query: 22  SFEVKAITAN-------IPAVTSEGIYPGQLRHLDLGNNHFVGKIPASLDNQLIGSIPSS 74
           S EV  ++AN       +  V S+G   G+L+HL +  N   G +  S            
Sbjct: 149 SLEVLDLSANSISGANVVGWVLSDGC--GELKHLAISGNKISGDVDVS------------ 194
Query: 75  IFELVNLTFVSLSFNNFSGSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWAL 134
               VNL F+ +S NNFS  +          L++L +S   LS      + S+   L  L
Sbjct: 195 --RCVNLEFLDVSSNNFSTGIPF--LGDCSALQHLDISGNKLSGDFSRAI-STCTELKLL 249
Query: 135 GLSACN-ISEFPDI-LKTQHQLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRN-FLT 191
            +S+   +   P + LK+   L +L L+EN+  G IP ++      TL  LDLS N F  
Sbjct: 250 NISSNQFVGPIPPLPLKS---LQYLSLAENKFTGEIPDFLSG-ACDTLTGLDLSGNHFYG 305
Query: 192 SIDHLPWKNLEFLTLDSNLLQGSLPNLPPHMTYAKGCNLTYLRLSGNHLEGPLPPSLSN- 250
           ++   P+     L     L   +     P  T  K   L  L LS N   G LP SL+N 
Sbjct: 306 AVP--PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL 363
Query: 251 CVNLQVLDVGNNNLSGPI-PE-CLGNSTRLSFLDVRNNNLSGPIPECLGNSTSLSFLDVG 308
             +L  LD+ +NN SGPI P  C      L  L ++NN  +G IP  L N + L  L + 
Sbjct: 364 SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 423
Query: 309 NNSLSGPIPEYLGN-STLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSL 367
            N LSG IP  LG+ S L  L + +N   G +PQ       L +L L+ N L G +P  L
Sbjct: 424 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGL 483
Query: 368 VNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPI----GDTKTRVPFPKL 423
            NC +L  I + NN++    P W+  L  L +L L +N F G I    GD ++ +     
Sbjct: 484 SNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLI----- 538
Query: 424 RIIDLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMK----GN 479
             +DL+ N F G +P        A M +    I  N++    Y Y ++  +  +    GN
Sbjct: 539 -WLDLNTNLFNGTIP--------AAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGN 589
Query: 480 DIQMERI-------LTTFATIDLSSNRFQGEISEVLGKLNSLKSLNISHNNL-------- 524
            ++ + I       L+T    +++S  + G  S       S+  L++S+N L        
Sbjct: 590 LLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEI 649
Query: 525 ----------------TGGIPSSLRNLTELESLDLSSNKLAGRIPTQXXXXXXXXXXXXX 568
                           +G IP  + +L  L  LDLSSNKL GRIP               
Sbjct: 650 GSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLS 709
Query: 569 XXXXEGPIPGGPQFNTFGIDSYSGNVGLCGFPLSK 603
                GPIP   QF TF    +  N GLCG+PL +
Sbjct: 710 NNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPR 744
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query691
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-144
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-103
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-102
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-67
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-50
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-94
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-69
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-57
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-36
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-75
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-69
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-57
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-42
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-36
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-34
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-71
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-59
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-58
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-30
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-69
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-61
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-51
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-45
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-34
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-65
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-57
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-28
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-64
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-46
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-41
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-58
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-47
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-46
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-41
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-50
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-48
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-38
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-36
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-31
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-45
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-40
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-44
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-25
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-43
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-43
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-36
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-31
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-40
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-39
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-36
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-34
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-31
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-30
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-34
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-32
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-32
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-33
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-33
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-25
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-31
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-30
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-24
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-13
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-29
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-28
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-06
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-22
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-22
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-17
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-16
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  437 bits (1126), Expect = e-144
 Identities = 163/609 (26%), Positives = 242/609 (39%), Gaps = 107/609 (17%)

Query: 44  QLRHLDLGNNHFVGKIPA--------SLD---NQLIGSIPSSIFELVNLTFVSLSFNNFS 92
            L  LD+ +N+F   IP          LD   N+L G    +I     L  +++S N F 
Sbjct: 201 NLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFV 260

Query: 93  GSVELYDFAKLKNLKYLILSNISLSVSTKLTVNSSFPNLWALGLSACNISEFPDILKTQH 152
           G +       LK+L+YL L+    +      ++ +   L                     
Sbjct: 261 GPIPP---LPLKSLQYLSLAENKFTGEIPDFLSGACDTLT-------------------- 297

Query: 153 QLDWLDLSENQIRGRIPSWMWDIGVHTLFRLDLSRNFLTSIDHLPWKNLEFLTLDSNLLQ 212
               LDLS N   G +P +                             LE L L SN   
Sbjct: 298 ---GLDLSGNHFYGAVPPFFGSC-----------------------SLLESLALSSNNFS 331

Query: 213 GSLP-----NLPPHMTYAKGCNLTYLRLSGNHLEGPLPPSLSNC-VNLQVLDVGNNNLSG 266
           G LP      +           L  L LS N   G LP SL+N   +L  LD+ +NN SG
Sbjct: 332 GELPMDTLLKMR---------GLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSG 382

Query: 267 PIPECLGNSTR--LSFLDVRNNNLSGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGN-S 323
           PI   L  + +  L  L ++NN  +G IP  L N + L  L +  N LSG IP  LG+ S
Sbjct: 383 PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS 442

Query: 324 TLEVLDMRMNKFSGSLPQTFGKSCVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQI 383
            L  L + +N   G +PQ       L +L L+ N L G +P  L NC +L  I + NN++
Sbjct: 443 KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRL 502

Query: 384 NETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLN 443
               P W+  L  L +L L +N F G I           L  +DL+ N F G +P     
Sbjct: 503 TGEIPKWIGRLENLAILKLSNNSFSGNIPAELGD--CRSLIWLDLNTNLFNGTIPAAMFK 560

Query: 444 GFKAMMR---RDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRF 500
               +          + +         +     L  +G   +    L+T    +++S  +
Sbjct: 561 QSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVY 620

Query: 501 QGEISEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLN 560
            G  S       S+  L++S+N L+G IP  + ++  L  L+L  N ++G IP ++  L 
Sbjct: 621 GGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLR 680

Query: 561 YLSVLNLSNNQL------------------------EGPIPGGPQFNTFGIDSYSGNVGL 596
            L++L+LS+N+L                         GPIP   QF TF    +  N GL
Sbjct: 681 GLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGL 740

Query: 597 CGFPLSKIC 605
           CG+PL +  
Sbjct: 741 CGYPLPRCD 749
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 691
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-24
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-05
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-12
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-12
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-10
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-09
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-09
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-07
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-09
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 9e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-08
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 3e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 8e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score =  103 bits (258), Expect = 2e-24
 Identities = 65/356 (18%), Positives = 125/356 (35%), Gaps = 31/356 (8%)

Query: 229 NLTYLRLSGNHLEGPLPPSLSNCVNLQVLDVGNNNLSGPIPECLGNSTRLSFLDVRNNNL 288
            +T L+     ++      +    NL  ++  NN L+   P  L N T+L  + + NN +
Sbjct: 45  QVTTLQADRLGIKSI--DGVEYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNNNQI 100

Query: 289 SGPIPECLGNSTSLSFLDVGNNSLSGPIPEYLGNSTLEVLDMRMNKFSGSLPQTFGKSCV 348
           +   P     + +   L     +   P+      + LE+    ++  S     T  +   
Sbjct: 101 ADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLS 160

Query: 349 LVSLKLNGNRLEGPLPPSLV--------------NCRHLEVIDVGNNQINETFPHWLDVL 394
             +   +   L        +                 +LE +   NNQI++  P  +   
Sbjct: 161 FGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGIL-- 218

Query: 395 PELQVLTLRSNRFCGPIGDTKTRVPFPKLRIIDLSYNQFTGVLPIWYLNGFKAMMRRDDN 454
             L  L+L  N+         T      L  +DL+ NQ + + P+  L     +    + 
Sbjct: 219 TNLDELSLNGNQLKDI----GTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQ 274

Query: 455 SIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISEVLGKLNSL 514
              ++ +  L       ++      DI     L     + L  N         +  L  L
Sbjct: 275 ISNISPLAGLTALTNLELNENQL-EDISPISNLKNLTYLTLYFNNISDISP--VSSLTKL 331

Query: 515 KSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNN 570
           + L  ++N ++    SSL NLT +  L    N+++   P  LA+L  ++ L L++ 
Sbjct: 332 QRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query691
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.98
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.97
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.97
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.93
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.93
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.92
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.91
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.9
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.9
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.9
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.88
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.86
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.85
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.78
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.76
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.73
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.71
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.65
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.65
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.64
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.59
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 99.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.74
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.4
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=100.00  E-value=5.1e-40  Score=197.63  Aligned_cols=166  Identities=28%  Similarity=0.409  Sum_probs=97.9

Q ss_pred             CCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCHHHCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             87359986698255879935639897429994489887674322129999639990167376768998987799986399
Q 005542          347 CVLVSLKLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINETFPHWLDVLPELQVLTLRSNRFCGPIGDTKTRVPFPKLRII  426 (691)
Q Consensus       347 ~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~~~~~~L~~L  426 (691)
                      ++|+.+++++|.++. + ..+..+++|+.+++++|.+++..+  +..+++|++++++++++.+..+    ...++.++.+
T Consensus       219 ~~L~~L~l~~n~l~~-~-~~l~~l~~L~~L~l~~n~l~~~~~--~~~~~~L~~L~l~~~~l~~~~~----~~~~~~l~~l  290 (384)
T d2omza2         219 TNLDELSLNGNQLKD-I-GTLASLTNLTDLDLANNQISNLAP--LSGLTKLTELKLGANQISNISP----LAGLTALTNL  290 (384)
T ss_dssp             TTCCEEECCSSCCCC-C-GGGGGCTTCSEEECCSSCCCCCGG--GTTCTTCSEEECCSSCCCCCGG----GTTCTTCSEE
T ss_pred             CCCCEEECCCCCCCC-C-CHHHCCCCCCHHCCCCCCCCCCCC--CCCCCCCCEEECCCCCCCCCCC----CCCCCCCCCC
T ss_conf             778788887777789-6-134325653410044674478775--3554668775456744578773----2356522223


Q ss_pred             ECCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCHHHHHHCCCCCEEECCCCCCCCCCCH
Q ss_conf             86787585678967662012232135886310001235665310158873177023432026513899537715422775
Q 005542          427 DLSYNQFTGVLPIWYLNGFKAMMRRDDNSIEVNYMRSLNYSYYESISLTMKGNDIQMERILTTFATIDLSSNRFQGEISE  506 (691)
Q Consensus       427 ~ls~n~l~~~~p~~~~~~~~~l~~l~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~  506 (691)
                      +++.|.+++...   +                                          ..+++++.|++++|.+.+..+ 
T Consensus       291 ~~~~n~l~~~~~---~------------------------------------------~~~~~l~~L~ls~n~l~~l~~-  324 (384)
T d2omza2         291 ELNENQLEDISP---I------------------------------------------SNLKNLTYLTLYFNNISDISP-  324 (384)
T ss_dssp             ECCSSCCSCCGG---G------------------------------------------GGCTTCSEEECCSSCCSCCGG-
T ss_pred             CCCCCCCCCCCC---C------------------------------------------CHHCCCCEEECCCCCCCCCCC-
T ss_conf             323233333221---0------------------------------------------000246767777887789845-


Q ss_pred             HHHCCCCCCCEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCE
Q ss_conf             44414777621022521445766002289999988699985887585023289999999751782
Q 005542          507 VLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVLNLSNNQ  571 (691)
Q Consensus       507 ~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~ls~n~  571 (691)
                       +..+++|+.|++++|.+++ ++ .++++++|+.|++++|++++..|  +.++++|+.|++++|.
T Consensus       325 -l~~l~~L~~L~L~~n~l~~-l~-~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~~Na  384 (384)
T d2omza2         325 -VSSLTKLQRLFFANNKVSD-VS-SLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQA  384 (384)
T ss_dssp             -GGGCTTCCEEECCSSCCCC-CG-GGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEEECCCEE
T ss_pred             -CCCCCCCCEEECCCCCCCC-CH-HHCCCCCCCEEECCCCCCCCCHH--HCCCCCCCEEECCCCC
T ss_conf             -3668988989898998999-74-67089999989897995899800--0039999996397895
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure