Citrus Sinensis ID: 005554

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-
MALISFPRFLSRPLESNHRRSLRSRYKCVCCVSPTAAATSKGRSGSAVIWFKQDLRVDDHLGLVAASKYQAVVPLYVFDHRILSRYSNEMLELVIFALEDLRKSLKEQGSDLMIRFGRVENVIRELVEEVKATSVFAEEEVEYHLRQMMAIVDETLAKVSLVDGKPKICLWQTPFYDIKNLNDLPVSHNEFRKLQRPLTSPILPPTLAGAKLEADWGPLPTFDELKEFVNENPWKLEESWTLINNMSAETILTDKLSKLGKRSKRNLNNQHSPRKRLDKSFFVTDKGNTVGGGTNAVLNALQAYLRYLEGTVRDDWQELQEKLRNAESRDGASFATLFGPALCLGIISRRGVHYEAIKFEKERNAGFLSPFGYSAATIAAAADAVCSMEWYWLMSLRSLRSNEGVYSTRIWRWNGYQIQYTVAGKEGPAILLVHGFGAFLEHYRDNIYDIADGGNRVWAITLLGFGRSEKPNIVYTELMWSELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVLINSAGNVIPEYSFLQFSNERQASGPIRLGAQLLLFYLRLNISNFVKQCYPTRRERADDWLISEMLRASYDPGVLVVLESIFSFKLSLPLNYLLEGFKEKVLIIQGIKDPISDSKSKVAMFKEHCAGIVIRELDAGHCPHDEKPEEVNSIISEWIVTIESKVPAESFL
cccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHccccccccEEEEccccccccccccccccccHHHHHHcccccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccHHHHcccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHcccccccccccccccEEEEEEccEEEEEEEEccccccEEEEccccccHHHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHcccccccHHHHHccccccEEEEccccccccccHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHccccccccccc
ccHHccccccccccccccccccccccccEEEEccccccccccccEEEEEEEcccccccccHHHHHHcccccEEEEEEEcHHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccccccHHccccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHcccccccccccccHccccHHHHHHHHHHHcccccccccccccccccEEccEEEEEcccEEEcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHcHHHHHHHHHHHccccccEcccccccHHHHHHHHHHcccHHHHHHcccccccccccccccEEEEEcEEEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHcHHHHcEEEEEccccccccccccccHHHHHHHccccHHHHHHHHHHcHHHHHHHHHHHHHccHHHccHHHHHHHHcccccccHHHHHHHHHcccccccHHHHHHcccccEEEEEccccccccHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHHccccccHHHHc
malisfprflsrplesnhrrslrsrykcvccvsptaaatskgrsgsaviwfkqdlrvddhLGLVAASKYQAVVPLYVFDHRILSRYSNEMLELVIFALEDLRKSLKEQGSDLMIRFGRVENVIRELVEEVKATSVFAEEEVEYHLRQMMAIVDETLAKVslvdgkpkiclwqtpfydiknlndlpvshnefrklqrpltspilpptlagakleadwgplptfdelkefvnenpwklEESWTLINNMSAETILTDKLSKLgkrskrnlnnqhsprkrldksffvtdkgntvggGTNAVLNALQAYLRYLEGTVRDDWQELQEKLRNaesrdgasfatlFGPALCLGIISRRGVHYEAIKFekernagflspfgysAATIAAAADAVCSMEWYWLMSLRSlrsnegvystrIWRWNGYQIQYtvagkegpaILLVHGFGAFLEHYRdniydiadggNRVWAITLLgfgrsekpnivYTELMWSELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVLINSagnvipeysflqfsnerqasgpirLGAQLLLFYLRLNISNFVKQCYPTRRERADDWLISEMLRASYDPGVLVVLESIFSFKLSLPLNYLLEGFKEKVLIIQGikdpisdsksKVAMFKEHCAGIVIreldaghcphdekpeeVNSIISEWIVTIEskvpaesfl
malisfprflsrplesnhrrslrsrykcVCCVSptaaatskgrsgsAVIWFKQDLRVDDHLGLVAASKYQAVVPLYVFDHRILSRYSNEMLELVIFALEDLRKSLKEQGSDLMIRFGRVENVIRELVEevkatsvfaEEEVEYHLRQMMAIVDETLAKVSLVDGKPKICLWQTPFYDIKNLNDLPVSHNEFRKLQRPLTSPILPPTLAGAKLEADWGPLPTFDELKEFVNENPWKLEESWTLINNMSAETILTDklsklgkrskrnlnnqhsprkrldksffVTDKgntvgggtNAVLNALQAYLRYLEGTVRDDWQELQEKLRNaesrdgasFATLFGPALCLGIISRRGVHYEAIKFEKERNAGFLSPFGYSAATIAAAADAVCSMEWYWLMSLRSLRSNEGVYSTRIWRWNGYQIQYTVAGKEGPAILLVHGFGAFLEHYRDNIYDIADGGNRVWAITLLgfgrsekpNIVYTELMWSELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVLINSAGNVIPEYSFLQFSNERQASGPIRLGAQLLLFYLRLNISNFVKQCYPTRRERADDWLISEMLRASYDPGVLVVLESIFSFKLSLPLNYLLEGFKEKVLIIQGIKDPISDSKSKVAMFKEHCAGIVIRELDAGHCPHDEKPEEVNSIISEWIVTIESKVPAESFL
MALISFPRFLSRPLESNHRRSLRSRYKCVCCVSPTAAATSKGRSGSAVIWFKQDLRVDDHLGLVAASKYQAVVPLYVFDHRILSRYSNEMLELVIFALEDLRKSLKEQGSDLMIRFGRVENVIRELVEEVKATSVFAEEEVEYHLRQMMAIVDETLAKVSLVDGKPKICLWQTPFYDIKNLNDLPVSHNEFRKLQRPLTSPILPPTLAGAKLEADWGPLPTFDELKEFVNENPWKLEESWTLINNMSAETILTDKLSKLGKRSKRNLNNQHSPRKRLDKSFFVTDKGNTVGGGTNAVLNALQAYLRYLEGTVRDDWQELQEKLRNAESRDGASFATLFGPALCLGIISRRGVHYEAIKFEKERNAGFLSPFGYSaatiaaaadaVCSMEWYWLMSLRSLRSNEGVYSTRIWRWNGYQIQYTVAGKEGPAILLVHGFGAFLEHYRDNIYDIADGGNRVWAITLLGFGRSEKPNIVYTELMWSELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVLINSAGNVIPEYSFLQFSNERQASGPIRLGAQLLLFYLRLNISNFVKQCYPTRRERADDWLISEMLRASYDPGVLVVLESIFSFKLSLPLNYLLEGFKEKVLIIQGIKDPISDSKSKVAMFKEHCAGIVIRELDAGHCPHDEKPEEVNSIISEWIVTIESKVPAESFL
**********************RSRYKCVCCVSPTAAATSKGRSGSAVIWFKQDLRVDDHLGLVAASKYQAVVPLYVFDHRILSRYSNEMLELVIFALEDLRKSLKEQGSDLMIRFGRVENVIRELVEEVKATSVFAEEEVEYHLRQMMAIVDETLAKVSLVDGKPKICLWQTPFYDIKNLNDLPVSHNEFRKLQRPLTSPILPPTLAGAKLEADWGPLPTFDELKEFVNENPWKLEESWTLINNMSAETILT***************************FFVTDKGNTVGGGTNAVLNALQAYLRYLEGTVRDDWQELQE*********GASFATLFGPALCLGIISRRGVHYEAIKFEKERNAGFLSPFGYSAATIAAAADAVCSMEWYWLM**********VYSTRIWRWNGYQIQYTVAGKEGPAILLVHGFGAFLEHYRDNIYDIADGGNRVWAITLLGFGRSEKPNIVYTELMWSELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVLINSAGNVIPEYSFLQFSNERQASGPIRLGAQLLLFYLRLNISNFVKQCYPTRRERADDWLISEMLRASYDPGVLVVLESIFSFKLSLPLNYLLEGFKEKVLIIQGIKDPISDSKSKVAMFKEHCAGIVIRELDAGHCPH*****EVNSIISEWIVTIE*********
**LI*******************************************VIWFKQDLRVDDHLGLVAASKYQAVVPLYVFDHRILSRYSNEMLELVIFALEDLRKSLKEQGSDLMIRFGRVENVIRELVEEVKATSVFAEEEVEYHLRQMMAIVDETLAKVSLVDGKPKICLWQTPFYDIKNLNDLPVSHNEFRKLQRPL*****************WGPLPTFDELKEFVNE********************************************RLD*SFFVTDKGNTVGGGTNAVLNALQAYLRYLEGTVRDDWQE*************ASFATLFGPALCLGIISRRGVHYEAIKFEKERNAGFLSPFGYSAATIAAAADAVCSM****************VYSTRIWRWNGYQIQYTVAGKEGPAILLVHGFGAFLEHYRDNIYDIADGGNRVWAITLLGFGRSEKPNIVYTELMWSELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVLINSAGNVIPEYSFLQFSNERQASGPIRLGAQLLLFYLRLNISNFVKQCYPTRRERADDWLISEMLRASYDPGVLVVLESIFSFKLSLPLNYLLEGFKEKVLIIQGIKDPISDSKSKVAMFKEHCAGIVIRELDAGHCPHDEKPEEVNSIISEWI*************
MALISFPRFLSRPL*********SRYKCVCCVSPT**********SAVIWFKQDLRVDDHLGLVAASKYQAVVPLYVFDHRILSRYSNEMLELVIFALEDLRKSLKEQGSDLMIRFGRVENVIRELVEEVKATSVFAEEEVEYHLRQMMAIVDETLAKVSLVDGKPKICLWQTPFYDIKNLNDLPVSHNEFRKLQRPLTSPILPPTLAGAKLEADWGPLPTFDELKEFVNENPWKLEESWTLINNMSAETILTDKLSKLGKRSKRNLNNQHSPRKRLDKSFFVTDKGNTVGGGTNAVLNALQAYLRYLEGTVRDDWQELQEKLRNAESRDGASFATLFGPALCLGIISRRGVHYEAIKFEKERNAGFLSPFGYSAATIAAAADAVCSMEWYWLMSLRSLRSNEGVYSTRIWRWNGYQIQYTVAGKEGPAILLVHGFGAFLEHYRDNIYDIADGGNRVWAITLLGFGRSEKPNIVYTELMWSELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVLINSAGNVIPEYSFLQFSNERQASGPIRLGAQLLLFYLRLNISNFVKQCYPTRRERADDWLISEMLRASYDPGVLVVLESIFSFKLSLPLNYLLEGFKEKVLIIQGIKDPISDSKSKVAMFKEHCAGIVIRELDAGHCPHDEKPEEVNSIISEWIVTIESKVPAESFL
*ALISFPRFLSRPLE*NHRRSLRSRYKCVCCVSPTAAATSKGRSGSAVIWFKQDLRVDDHLGLVAASKYQAVVPLYVFDHRILSRYSNEMLELVIFALEDLRKSLKEQGSDLMIRFGRVENVIRELVEEVKATSVFAEEEVEYHLRQMMAIVDETLAKVSLVDGKPKICLWQTPFYDIKNLNDLPVSHNEFRKLQRPLTSPILPPTLAGAKLEADWGPLPTFDELKEFVNENPWKLEESWTLINNMSAETILTDKLSKLGKRSKRNLNNQHSPRKRLDKSFFVTDKGNTVGGGTNAVLNALQAYLRYLEGTVRDDWQELQEKLRNAESRDGASFATLFGPALCLGIISRRGVHYEAIKFEKERNAGFLSPFGYSAATIAAAADAVCSMEWYWLMSLRSLRSNEGVYSTRIWRWNGYQIQYTVAGKEGPAILLVHGFGAFLEHYRDNIYDIADGGNRVWAITLLGFGRSEKPNIVYTELMWSELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVLINSAGNVIPEYSFLQFSNERQASGPIRLGAQLLLFYLRLNISNFVKQCYPTRRERADDWLISEMLRASYDPGVLVVLESIFSFKLSLPLNYLLEGFKEKVLIIQGIKDPISDSKSKVAMFKEHCAGIVIRELDAGHCPHDEKPEEVNSIISEWIVTIES********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALISFPRFLSRPLESNHRRSLRSRYKCVCCVSPTAAATSKGRSGSAVIWFKQDLRVDDHLGLVAASKYQAVVPLYVFDHRILSRYSNEMLELVIFALEDLRKSLKEQGSDLMIRFGRVENVIRELVEEVKATSVFAEEEVEYHLRQMMAIVDETLAKVSLVDGKPKICLWQTPFYDIKNLNDLPVSHNEFRKLQRPLTSPILPPTLAGAKLEADWGPLPTFDELKEFVNENPWKLEESWTLINNMSAETILTDKLSKLGKRSKRNLNNQHSPRKRLDKSFFVTDKGNTVGGGTNAVLNALQAYLRYLEGTVRDDWQELQEKLRNAESRDGASFATLFGPALCLGIISRRGVHYEAIKFEKERNAGFLSPFGYSAATIAAAADAVCSMEWYWLMSLRSLRSNEGVYSTRIWRWNGYQIQYTVAGKEGPAILLVHGFGAFLEHYRDNIYDIADGGNRVWAITLLGFGRSEKPNIVYTELMWSELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVLINSAGNVIPEYSFLQFSNERQASGPIRLGAQLLLFYLRLNISNFVKQCYPTRRERADDWLISEMLRASYDPGVLVVLESIFSFKLSLPLNYLLEGFKEKVLIIQGIKDPISDSKSKVAMFKEHCAGIVIRELDAGHCPHDEKPEEVNSIISEWIVTIESKVPAESFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query691 2.2.26 [Sep-21-2011]
Q651U1582 Cryptochrome DASH, chloro no no 0.219 0.261 0.306 2e-13
Q84KJ5569 Cryptochrome DASH, chloro no no 0.272 0.330 0.260 3e-12
Q38JU2577 Cryptochrome DASH, chloro N/A no 0.371 0.445 0.236 5e-12
Q3IPX9474 Cryptochrome DASH OS=Natr yes no 0.248 0.362 0.291 4e-11
Q8LB72447 Blue-light photoreceptor no no 0.206 0.319 0.312 4e-11
Q4KML2520 Cryptochrome DASH OS=Dani yes no 0.256 0.340 0.266 8e-09
Q75WS4523 Cryptochrome DASH OS=Xeno N/A no 0.370 0.489 0.241 1e-08
Q7NMD1500 Cryptochrome DASH OS=Gloe no no 0.141 0.196 0.358 5e-08
Q5IFN2546 Cryptochrome DASH, chloro no no 0.387 0.490 0.245 6e-07
P0A573341 Uncharacterized protein M no no 0.189 0.384 0.297 9e-07
>sp|Q651U1|CRYD_ORYSJ Cryptochrome DASH, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=CRYD PE=2 SV=1 Back     alignment and function desciption
 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 92/176 (52%), Gaps = 24/176 (13%)

Query: 42  GRSGSAVIWFKQDLRVDDHLGLVAA-SKYQAVVPLYVFDHRILSRYSNEM---------L 91
           G  G A++WF+ DLRV D+  +V A +   AV+P+Y  D RI +  ++            
Sbjct: 81  GGGGVAIVWFRNDLRVLDNEAVVRAWAASDAVLPVYCVDPRISAGSTHYFGFPKTGALRA 140

Query: 92  ELVIFALEDLRKSLKEQGSDLMIRFGRVENVIRELVEEVKATSVFAEEEVEYHLRQMMAI 151
           + +I  LEDL+++L +QG DL+IR G+ E+++  + + V A +V+A +E       +  +
Sbjct: 141 QFLIECLEDLKRNLTKQGLDLLIRHGKPEDILPSIAKAVTAHTVYAHKETCSEELLVEHL 200

Query: 152 VDETLAKVSLVDG---------KPKICL-WQTPFYDIKNL----NDLPVSHNEFRK 193
           V + L +V +  G          PK+ L W    Y + +L    N+LP  + +FRK
Sbjct: 201 VRKGLEQVVIPQGGASNQKKPRNPKLQLIWGATLYHVDDLPFSVNNLPDVYTQFRK 256
May have a photoreceptor function. Bind ss- and ds-DNA in a sequence non-specific manner, lacks photolyase activity.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q84KJ5|CRYD_ARATH Cryptochrome DASH, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=CRYD PE=1 SV=2 Back     alignment and function description
>sp|Q38JU2|CRYD_SOLLC Cryptochrome DASH, chloroplastic/mitochondrial OS=Solanum lycopersicum GN=CRYD PE=3 SV=2 Back     alignment and function description
>sp|Q3IPX9|CRYD_NATPD Cryptochrome DASH OS=Natronomonas pharaonis (strain DSM 2160 / ATCC 35678) GN=cry PE=3 SV=1 Back     alignment and function description
>sp|Q8LB72|PHR2_ARATH Blue-light photoreceptor PHR2 OS=Arabidopsis thaliana GN=PHR2 PE=2 SV=2 Back     alignment and function description
>sp|Q4KML2|CRYD_DANRE Cryptochrome DASH OS=Danio rerio GN=cry-dash PE=2 SV=2 Back     alignment and function description
>sp|Q75WS4|CRYD_XENLA Cryptochrome DASH OS=Xenopus laevis GN=cry-dash PE=2 SV=1 Back     alignment and function description
>sp|Q7NMD1|CRYD_GLOVI Cryptochrome DASH OS=Gloeobacter violaceus (strain PCC 7421) GN=cry PE=3 SV=1 Back     alignment and function description
>sp|Q5IFN2|CRYD_OSTTA Cryptochrome DASH, chloroplastic/mitochondrial OS=Ostreococcus tauri GN=Ot01g06320 PE=3 SV=1 Back     alignment and function description
>sp|P0A573|Y2734_MYCBO Uncharacterized protein Mb2734 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2734 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query691
255539721691 hydrolase, putative [Ricinus communis] g 0.994 0.994 0.707 0.0
296084158704 unnamed protein product [Vitis vinifera] 0.989 0.971 0.650 0.0
359490262722 PREDICTED: uncharacterized protein LOC10 0.958 0.916 0.650 0.0
356529875654 PREDICTED: uncharacterized protein LOC10 0.926 0.978 0.663 0.0
240256063692 DNA photolyase [Arabidopsis thaliana] gi 0.969 0.968 0.597 0.0
449488669679 PREDICTED: uncharacterized LOC101210685 0.913 0.929 0.624 0.0
449451936679 PREDICTED: uncharacterized protein LOC10 0.913 0.929 0.621 0.0
212275864706 uncharacterized protein LOC100191423 [Ze 0.984 0.963 0.522 0.0
147827517 1716 hypothetical protein VITISV_024326 [Viti 0.797 0.321 0.584 0.0
115480339695 Os09g0532700 [Oryza sativa Japonica Grou 0.908 0.903 0.534 0.0
>gi|255539721|ref|XP_002510925.1| hydrolase, putative [Ricinus communis] gi|223550040|gb|EEF51527.1| hydrolase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/693 (70%), Positives = 565/693 (81%), Gaps = 6/693 (0%)

Query: 1   MALISFPRFLSRPLESNHRRSLRSRYKCVCCVSPTAAATSKGRSGSAVIWFKQDLRVDDH 60
           MAL+ FPRFLS P  S     LR    C  C S +   T++ R+ SA++WFKQDLRVDDH
Sbjct: 1   MALLFFPRFLS-PSPSLRTPPLRFNNPCCFC-SLSPQTTNRRRTSSAILWFKQDLRVDDH 58

Query: 61  LGLVAASKYQ--AVVPLYVFDHRILSRYSNEMLELVIFALEDLRKSLKEQGSDLMIRFGR 118
            GL+ AS +   +++PLYVFDH ILSRYS+EMLE+V+FAL+DLR SLKEQGS+LMIRFG 
Sbjct: 59  FGLLQASNHSPSSLLPLYVFDHIILSRYSDEMLEIVLFALQDLRNSLKEQGSNLMIRFGS 118

Query: 119 VENVIRELVEEVKATSVFAEEEVEYHLRQMMAIVDETLAKVS-LVDGKPKICLWQTPFYD 177
            E VIR+LV+EV+AT VFAEEEVEYHLR  + IV + L K    +D  PKI LWQTPFYD
Sbjct: 119 AEGVIRDLVQEVEATVVFAEEEVEYHLRSTVEIVKQNLTKSQPHLDVNPKIVLWQTPFYD 178

Query: 178 IKNLNDLPVSHNEFRKLQRPLTSPILPPTLAGAKLEADWGPLPTFDELKEFVNENPWKLE 237
           IKNL DLP SH+ F+KLQ P+TSPILPPTL    +E DWG +PT DELK+FVNE+P+KL+
Sbjct: 179 IKNLKDLPASHDHFKKLQLPVTSPILPPTLPATPMELDWGSMPTLDELKKFVNESPFKLK 238

Query: 238 ESWTLINNMSAETILTDKLSKLGKRSKRNLNNQHSPRKRLDKSFFVTDKGNTVGGGTNAV 297
           ESW+LI  M  ETIL +KLSK  + +  NLN   S RKR++ S FVT + N VGGGTN V
Sbjct: 239 ESWSLIKEMPTETILHNKLSKF-RGTDVNLNFNQSQRKRVENSVFVTQRQNFVGGGTNKV 297

Query: 298 LNALQAYLRYLEGTVRDDWQELQEKLRNAESRDGASFATLFGPALCLGIISRRGVHYEAI 357
           LNAL AYLRYLEGT RDDWQE+ E+LRNAESRDGASF TLFGP+LCLGIISRR VHYEAI
Sbjct: 298 LNALAAYLRYLEGTARDDWQEVHERLRNAESRDGASFFTLFGPSLCLGIISRRRVHYEAI 357

Query: 358 KFEKERNAGFLSPFGYSAATIAAAADAVCSMEWYWLMSLRSLRSNEGVYSTRIWRWNGYQ 417
           K+EKERNAGFLSPFGYS  T+AAAADAVCSMEWYWLM+L+   S  G YS RIWRWNGY 
Sbjct: 358 KYEKERNAGFLSPFGYSTTTVAAAADAVCSMEWYWLMALKGQISVGGTYSVRIWRWNGYL 417

Query: 418 IQYTVAGKEGPAILLVHGFGAFLEHYRDNIYDIADGGNRVWAITLLGFGRSEKPNIVYTE 477
           IQYTV G EGPA+LLVHGFGAFLEHYRDNI DI+ GGNRVWAIT+LGFG+SEKPN+VYTE
Sbjct: 418 IQYTVVGHEGPAVLLVHGFGAFLEHYRDNIRDISKGGNRVWAITILGFGKSEKPNVVYTE 477

Query: 478 LMWSELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVLINSAGNVIPEYSF 537
           LMWSELL+DF +EVVGEPVHLIGNSIGGYF +IVAC WPA+VKS+VLINSAG+VIP Y +
Sbjct: 478 LMWSELLKDFIIEVVGEPVHLIGNSIGGYFTSIVACFWPALVKSIVLINSAGDVIPGYGY 537

Query: 538 LQFSNERQASGPIRLGAQLLLFYLRLNISNFVKQCYPTRRERADDWLISEMLRASYDPGV 597
            QF+ ERQ S   RLGA+LLL YLRLNI   +K CYPT+ ERADD LI+EMLRAS+DPGV
Sbjct: 538 PQFTKERQTSVIARLGAELLLLYLRLNIRTIMKNCYPTKTERADDLLINEMLRASFDPGV 597

Query: 598 LVVLESIFSFKLSLPLNYLLEGFKEKVLIIQGIKDPISDSKSKVAMFKEHCAGIVIRELD 657
           +VVLESIFSF LSLPLNYLLE  K+KVLI+QG+KDPISDSK KV+M K+HC+G+VIR+LD
Sbjct: 598 IVVLESIFSFNLSLPLNYLLEDLKDKVLIVQGMKDPISDSKFKVSMLKDHCSGVVIRKLD 657

Query: 658 AGHCPHDEKPEEVNSIISEWIVTIESKVPAESF 690
           AGHCPHDE PEEVN II EW+V  ESK+ A S 
Sbjct: 658 AGHCPHDELPEEVNPIICEWVVAAESKILAGSL 690

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296084158|emb|CBI24546.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490262|ref|XP_002265202.2| PREDICTED: uncharacterized protein LOC100259267 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356529875|ref|XP_003533512.1| PREDICTED: uncharacterized protein LOC100813721 [Glycine max] Back     alignment and taxonomy information
>gi|240256063|ref|NP_194259.4| DNA photolyase [Arabidopsis thaliana] gi|332659635|gb|AEE85035.1| DNA photolyase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449488669|ref|XP_004158137.1| PREDICTED: uncharacterized LOC101210685 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449451936|ref|XP_004143716.1| PREDICTED: uncharacterized protein LOC101210685 [Cucumis sativus] Back     alignment and taxonomy information
>gi|212275864|ref|NP_001130328.1| uncharacterized protein LOC100191423 [Zea mays] gi|195612420|gb|ACG28040.1| deoxyribodipyrimidine photolyase family protein [Zea mays] gi|414886442|tpg|DAA62456.1| TPA: deoxyribodipyrimidine photolyase family protein [Zea mays] Back     alignment and taxonomy information
>gi|147827517|emb|CAN66342.1| hypothetical protein VITISV_024326 [Vitis vinifera] Back     alignment and taxonomy information
>gi|115480339|ref|NP_001063763.1| Os09g0532700 [Oryza sativa Japonica Group] gi|52075945|dbj|BAD46025.1| deoxyribodipyrimidine photolyase family protein-like [Oryza sativa Japonica Group] gi|52077228|dbj|BAD46272.1| deoxyribodipyrimidine photolyase family protein-like [Oryza sativa Japonica Group] gi|113631996|dbj|BAF25677.1| Os09g0532700 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query691
TAIR|locus:2122654692 AT4G25290 [Arabidopsis thalian 0.969 0.968 0.587 6.4e-218
TAIR|locus:2115440378 AT4G36530 [Arabidopsis thalian 0.390 0.714 0.335 1.4e-32
TAIR|locus:2832896359 AT5G19850 [Arabidopsis thalian 0.397 0.766 0.342 7.5e-30
TAIR|locus:2159033484 PPH "AT5G13800" [Arabidopsis t 0.312 0.446 0.286 1.5e-15
TAIR|locus:2159823374 AT5G38520 [Arabidopsis thalian 0.360 0.665 0.283 4.1e-15
TAIR|locus:2061961447 PHR2 "photolyase/blue-light re 0.228 0.353 0.314 4.1e-11
ZFIN|ZDB-GENE-040617-2521 cry-dash "cryptochrome DASH" [ 0.256 0.339 0.272 6.8e-10
UNIPROTKB|O69638327 ephE "POSSIBLE EPOXIDE HYDROLA 0.234 0.495 0.304 2.3e-09
UNIPROTKB|Q81K95270 menH "Hydrolase, alpha/beta fo 0.373 0.955 0.240 4e-08
TIGR_CMR|BA_5110270 BA_5110 "hydrolase, alpha/beta 0.373 0.955 0.240 4e-08
TAIR|locus:2122654 AT4G25290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2105 (746.1 bits), Expect = 6.4e-218, P = 6.4e-218
 Identities = 400/681 (58%), Positives = 509/681 (74%)

Query:     1 MALISFPRFLSRPLESNHRRSLRSRYKCVCCVSPTAAATSKGRSGSAVIWFKQDLRVDDH 60
             MA ++ P FL   L  N R++     +C CC+S   +AT++G   +AV+WFK DLRVDDH
Sbjct:     1 MAFLALPHFLHLRLRRNDRKN-----RCKCCLS---SATNEG--STAVVWFKHDLRVDDH 50

Query:    61 LGLVAASKYQAVVPLYVFDHRILSRYSNEMLELVIFALEDLRKSLKEQGSDLMIRFGRVE 120
              GL+AASK++AV+PLYV D RILSRY+ + LEL I ALEDLRK+LK+QGS+LM+R+G  E
Sbjct:    51 PGLLAASKHRAVIPLYVLDRRILSRYTTDTLELAIIALEDLRKTLKKQGSNLMLRYGNAE 110

Query:   121 NVIRELVEEVKATSVFAEEEVEYHLRQMMAIVDETLAKVSLVDGKPKICLWQTPFYDIKN 180
             NVI +LV+EV+A  VF EEEVEYHL +++  V   L  VSL    P+I  W+TPFY+ +N
Sbjct:   111 NVIEDLVKEVRAPFVFVEEEVEYHLCEVLDAVKNKLEGVSLSGESPRIVAWRTPFYESQN 170

Query:   181 LNDLPVSHNEFRKLQRPLTSPILPPTLAGAKLEADWGPLPTFDELKEFVNENPWKLEESW 240
             L DLP S  EF+KL+ PLT P+     +    E  WG +PT D+LK+++ E+ W++E SW
Sbjct:   171 LTDLPQSWEEFKKLKLPLTLPVPAAKFSSPGSELQWGSVPTLDDLKDYLKESLWEIENSW 230

Query:   241 TLINNMSAETILTDKLSKLGKRSKRNLNNQHSPRKRLDKSFFVTDKGNTVGGGTNAVLNA 300
               +   SAE +L ++L  L + S   + +  S  K++D S FVT K +TVGGG   VLNA
Sbjct:   231 REMAQASAERVLMERLGNLKESSMEPIVDG-SLGKKVDNSVFVTSKRDTVGGGNEVVLNA 289

Query:   301 LQAYLRYLEGTVRDDWQELQEKLRNAESRDGASFATLFGPALCLGIISRRGVHYEAIKFE 360
             L  YLRYLEGT RDDWQE+  +LR+AE+R GASF  LFGP LCLGI+SRR VHYEAI++E
Sbjct:   290 LAGYLRYLEGTSRDDWQEVHARLRDAETRPGASFFKLFGPVLCLGIVSRRSVHYEAIEYE 349

Query:   361 KERNAGFLSPFGYSXXXXXXXXXXVCSMEWYWLMSLRSLRSNEGVYSTRIWRWNGYQIQY 420
             KERNAGF+SPFGYS          VCSMEWY+L++L   R +E  ++ RIWRW GY IQY
Sbjct:   350 KERNAGFISPFGYSAATVSAATDAVCSMEWYYLLALSRERIDEKRHAIRIWRWKGYLIQY 409

Query:   421 TVAGKEGPAILLVHGFGAFLEHYRDNIYDIADGGNRVWAITLLGFGRSEKPNIVYTELMW 480
             TV G EGPA+LLVHGFGAFLEHYRDN+ +I +  NRVW IT+LGFG+SEKPNI+YTEL+W
Sbjct:   410 TVVGNEGPAVLLVHGFGAFLEHYRDNVDNIVNSKNRVWTITVLGFGKSEKPNIIYTELLW 469

Query:   481 SELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVLINSAGNVIPEYSFLQF 540
             +ELLRDF  EVVGEP H +GNSIGGYFVA++A LWPA+VKSVVL+NSAGNV+P YS L  
Sbjct:   470 AELLRDFMAEVVGEPAHCVGNSIGGYFVALMAFLWPALVKSVVLVNSAGNVVPGYSPLPI 529

Query:   541 SNERQASGPIRLGAQLLLFYLRLNISNFVKQCYPTRRERADDWLISEMLRASYDPGVLVV 600
             S ER+     + G++LLLF+L+LN+   +K CYP + ERADD+L++EMLRAS DPGV++V
Sbjct:   530 SRERRVPFGAQFGSRLLLFFLQLNVKKLLKDCYPVKPERADDFLVTEMLRASRDPGVVMV 589

Query:   601 LESIFSFKLSLPLNYLLEGFKEKVLIIQGIKDPISDSKSKVAMFKEHCAGIVIRELDAGH 660
             LESIF F LSLPLNYLL+GF+EK L+IQG++DPISD + KVA+ KE C  +VI+++ AGH
Sbjct:   590 LESIFGFDLSLPLNYLLKGFEEKTLVIQGMEDPISDPQKKVALLKELCPAMVIKKVKAGH 649

Query:   661 CPHDEKPEEVNSIISEWIVTI 681
             CPHDE  EEVN II EWIV +
Sbjct:   650 CPHDEISEEVNPIICEWIVKV 670
GO:0003913 "DNA photolyase activity" evidence=IEA;ISS
GO:0006281 "DNA repair" evidence=IEA;ISS
TAIR|locus:2115440 AT4G36530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2832896 AT5G19850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159033 PPH "AT5G13800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159823 AT5G38520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061961 PHR2 "photolyase/blue-light receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040617-2 cry-dash "cryptochrome DASH" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O69638 ephE "POSSIBLE EPOXIDE HYDROLASE EPHE (EPOXIDE HYDRATASE) (ARENE-OXIDE HYDRATASE)" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q81K95 menH "Hydrolase, alpha/beta fold family" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5110 BA_5110 "hydrolase, alpha/beta fold family" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query691
PLN02578354 PLN02578, PLN02578, hydrolase 2e-44
PLN02824294 PLN02824, PLN02824, hydrolase, alpha/beta fold fam 3e-40
PLN02679360 PLN02679, PLN02679, hydrolase, alpha/beta fold fam 1e-30
COG0596282 COG0596, MhpC, Predicted hydrolases or acyltransfe 6e-24
TIGR02765429 TIGR02765, crypto_DASH, cryptochrome, DASH family 3e-23
pfam00875164 pfam00875, DNA_photolyase, DNA photolyase 2e-20
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 3e-20
COG0415461 COG0415, PhrB, Deoxyribodipyrimidine photolyase [D 7e-16
PRK14875371 PRK14875, PRK14875, acetoin dehydrogenase E2 subun 9e-14
pfam00561226 pfam00561, Abhydrolase_1, alpha/beta hydrolase fol 1e-13
COG2267298 COG2267, PldB, Lysophospholipase [Lipid metabolism 1e-13
pfam12695145 pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam 1e-08
TIGR03556471 TIGR03556, photolyase_8HDF, deoxyribodipyrimidine 5e-07
PRK00870302 PRK00870, PRK00870, haloalkane dehalogenase; Provi 2e-06
TIGR01250289 TIGR01250, pro_imino_pep_2, proline-specific pepti 7e-06
TIGR02766475 TIGR02766, crypt_chrom_pln, cryptochrome, plant fa 3e-05
PLN03087481 PLN03087, PLN03087, BODYGUARD 1 domain containing 1e-04
PLN02894402 PLN02894, PLN02894, hydrolase, alpha/beta fold fam 8e-04
TIGR03343282 TIGR03343, biphenyl_bphD, 2-hydroxy-6-oxo-6-phenyl 0.004
TIGR03056278 TIGR03056, bchO_mg_che_rel, putative magnesium che 0.004
>gnl|CDD|215315 PLN02578, PLN02578, hydrolase Back     alignment and domain information 
 Score =  162 bits (412), Expect = 2e-44
 Identities = 101/295 (34%), Positives = 144/295 (48%), Gaps = 40/295 (13%)

Query: 411 WRWNGYQIQYTVAGKEGPAILLVHGFGAFLEHYRDNIYDIADGGNRVWAITLLGFGRSEK 470
           W W G++I Y V G EG  I+L+HGFGA   H+R NI ++A    +V+A+ LLGFG S+K
Sbjct: 71  WTWRGHKIHYVVQG-EGLPIVLIHGFGASAFHWRYNIPELAKK-YKVYALDLLGFGWSDK 128

Query: 471 PNIVYTELMWSELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVLINSAGN 530
             I Y  ++W + + DF  EVV EP  L+GNS+GG+     A  +P +V  V L+NSAG 
Sbjct: 129 ALIEYDAMVWRDQVADFVKEVVKEPAVLVGNSLGGFTALSTAVGYPELVAGVALLNSAG- 187

Query: 531 VIPEYSFLQFSNE----------------RQASGPIRLGAQ-LLLFYL------RLNISN 567
                   QF +E                R    P++   Q ++L +L         I +
Sbjct: 188 --------QFGSESREKEEAIVVEETVLTRFVVKPLKEWFQRVVLGFLFWQAKQPSRIES 239

Query: 568 FVKQCYPTRRERADDWLISEMLRASYDPG---VLVVLESIFSFKLS-LPLNYLLEGFKEK 623
            +K  Y   +   DD+L+  +   + DP    V   L S F F  S   L+ LL      
Sbjct: 240 VLKSVY-KDKSNVDDYLVESITEPAADPNAGEVYYRLMSRFLFNQSRYTLDSLLSKLSCP 298

Query: 624 VLIIQGIKDPISDSKSKVAMFKEHCAGIVIRELDAGHCPHDEKPEEVNSIISEWI 678
           +L++ G  DP     +K    K       +  L AGHCPHDE PE+VN  + EW+
Sbjct: 299 LLLLWGDLDPWVGP-AKAEKIKAFYPDTTLVNLQAGHCPHDEVPEQVNKALLEWL 352

Length = 354
>gnl|CDD|178419 PLN02824, PLN02824, hydrolase, alpha/beta fold family protein Back     alignment and domain information
>gnl|CDD|178283 PLN02679, PLN02679, hydrolase, alpha/beta fold family protein Back     alignment and domain information
>gnl|CDD|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|234002 TIGR02765, crypto_DASH, cryptochrome, DASH family Back     alignment and domain information
>gnl|CDD|216167 pfam00875, DNA_photolyase, DNA photolyase Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|223492 COG0415, PhrB, Deoxyribodipyrimidine photolyase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|201306 pfam00561, Abhydrolase_1, alpha/beta hydrolase fold Back     alignment and domain information
>gnl|CDD|225176 COG2267, PldB, Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|132595 TIGR03556, photolyase_8HDF, deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>gnl|CDD|179147 PRK00870, PRK00870, haloalkane dehalogenase; Provisional Back     alignment and domain information
>gnl|CDD|188121 TIGR01250, pro_imino_pep_2, proline-specific peptidase, Bacillus coagulans-type subfamily Back     alignment and domain information
>gnl|CDD|131813 TIGR02766, crypt_chrom_pln, cryptochrome, plant family Back     alignment and domain information
>gnl|CDD|215567 PLN03087, PLN03087, BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|215484 PLN02894, PLN02894, hydrolase, alpha/beta fold family protein Back     alignment and domain information
>gnl|CDD|132386 TIGR03343, biphenyl_bphD, 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>gnl|CDD|132100 TIGR03056, bchO_mg_che_rel, putative magnesium chelatase accessory protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 691
TIGR02765429 crypto_DASH cryptochrome, DASH family. Photolyases 100.0
COG0415461 PhrB Deoxyribodipyrimidine photolyase [DNA replica 100.0
TIGR03556471 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 100.0
TIGR02766475 crypt_chrom_pln cryptochrome, plant family. At lea 100.0
PRK10674472 deoxyribodipyrimidine photolyase; Provisional 100.0
TIGR00591454 phr2 photolyase PhrII. All proteins in this family 100.0
PLN02824294 hydrolase, alpha/beta fold family protein 100.0
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 100.0
PRK03592295 haloalkane dehalogenase; Provisional 99.97
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 99.97
PLN02679360 hydrolase, alpha/beta fold family protein 99.97
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.97
PLN02578354 hydrolase 99.97
PRK00870302 haloalkane dehalogenase; Provisional 99.96
KOG0133531 consensus Deoxyribodipyrimidine photolyase/cryptoc 99.96
PRK03204286 haloalkane dehalogenase; Provisional 99.96
PRK10349256 carboxylesterase BioH; Provisional 99.96
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.96
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.95
PLN02965255 Probable pheophorbidase 99.95
PRK06489360 hypothetical protein; Provisional 99.95
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.95
PRK08775343 homoserine O-acetyltransferase; Provisional 99.95
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.95
PRK10673255 acyl-CoA esterase; Provisional 99.94
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.94
PLN02385349 hydrolase; alpha/beta fold family protein 99.94
PHA02857276 monoglyceride lipase; Provisional 99.94
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.94
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.94
PRK07581339 hypothetical protein; Validated 99.94
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 99.94
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.94
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.93
PRK10749330 lysophospholipase L2; Provisional 99.93
PLN02211273 methyl indole-3-acetate methyltransferase 99.93
PLN02894402 hydrolase, alpha/beta fold family protein 99.93
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.93
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 99.93
PLN02298330 hydrolase, alpha/beta fold family protein 99.93
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.93
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.92
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.92
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.91
KOG2984277 consensus Predicted hydrolase [General function pr 99.9
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.9
COG2267298 PldB Lysophospholipase [Lipid metabolism] 99.9
PLN02652395 hydrolase; alpha/beta fold family protein 99.9
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.9
PRK05855 582 short chain dehydrogenase; Validated 99.89
PLN02511388 hydrolase 99.88
KOG1455313 consensus Lysophospholipase [Lipid transport and m 99.88
PRK06765389 homoserine O-acetyltransferase; Provisional 99.87
COG1647243 Esterase/lipase [General function prediction only] 99.86
KOG2382315 consensus Predicted alpha/beta hydrolase [General 99.84
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.84
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.82
PRK10985324 putative hydrolase; Provisional 99.82
PRK13604307 luxD acyl transferase; Provisional 99.81
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 99.8
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.8
PLN02872395 triacylglycerol lipase 99.77
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.76
PRK10566249 esterase; Provisional 99.75
PRK11071190 esterase YqiA; Provisional 99.75
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 99.74
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 99.74
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 99.7
KOG2564343 consensus Predicted acetyltransferases and hydrola 99.7
PRK07868 994 acyl-CoA synthetase; Validated 99.7
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.67
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 99.65
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 99.64
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.63
KOG2931326 consensus Differentiation-related gene 1 protein ( 99.62
KOG1552258 consensus Predicted alpha/beta hydrolase [General 99.62
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 99.6
KOG1838409 consensus Alpha/beta hydrolase [General function p 99.56
PLN00021313 chlorophyllase 99.56
COG3208244 GrsT Predicted thioesterase involved in non-riboso 99.55
PLN02442283 S-formylglutathione hydrolase 99.55
PRK11460232 putative hydrolase; Provisional 99.51
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 99.51
KOG4667269 consensus Predicted esterase [Lipid transport and 99.51
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.51
KOG2565469 consensus Predicted hydrolases or acyltransferases 99.48
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 99.46
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.42
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 99.42
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 99.4
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 99.38
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 99.38
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.36
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 99.35
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 99.35
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 99.34
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 99.32
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 99.31
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 99.3
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.3
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 99.28
COG4757281 Predicted alpha/beta hydrolase [General function p 99.24
PRK10162318 acetyl esterase; Provisional 99.24
COG2945210 Predicted hydrolase of the alpha/beta superfamily 99.23
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 99.21
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 99.18
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 99.14
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 99.13
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.11
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 99.11
COG0400207 Predicted esterase [General function prediction on 99.11
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 99.04
KOG2624403 consensus Triglyceride lipase-cholesterol esterase 99.01
PRK10115686 protease 2; Provisional 99.0
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 98.99
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 98.98
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 98.96
PRK102521296 entF enterobactin synthase subunit F; Provisional 98.95
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 98.95
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 98.94
PF03441277 FAD_binding_7: FAD binding domain of DNA photolyas 98.94
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 98.93
COG3319257 Thioesterase domains of type I polyketide synthase 98.84
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 98.84
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 98.8
KOG3975301 consensus Uncharacterized conserved protein [Funct 98.78
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 98.75
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 98.74
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 98.71
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 98.69
KOG3043242 consensus Predicted hydrolase related to dienelact 98.66
PF10503220 Esterase_phd: Esterase PHB depolymerase 98.64
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 98.63
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 98.6
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 98.59
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 98.57
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 98.53
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 98.5
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 98.46
PRK04940180 hypothetical protein; Provisional 98.44
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 98.43
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 98.41
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 98.4
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 98.4
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 98.39
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 98.39
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 98.39
KOG1553517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 98.35
COG0657312 Aes Esterase/lipase [Lipid metabolism] 98.32
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 98.27
COG4188365 Predicted dienelactone hydrolase [General function 98.25
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 98.19
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 98.17
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 98.17
KOG3847399 consensus Phospholipase A2 (platelet-activating fa 98.15
KOG2112206 consensus Lysophospholipase [Lipid transport and m 98.07
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 98.07
PLN02606306 palmitoyl-protein thioesterase 98.05
COG1075336 LipA Predicted acetyltransferases and hydrolases w 98.01
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 97.99
PF04301213 DUF452: Protein of unknown function (DUF452); Inte 97.92
COG4099387 Predicted peptidase [General function prediction o 97.89
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 97.89
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 97.88
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 97.87
KOG4840299 consensus Predicted hydrolases or acyltransferases 97.85
KOG1551371 consensus Uncharacterized conserved protein [Funct 97.81
COG2936 563 Predicted acyl esterases [General function predict 97.81
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 97.78
PLN02633314 palmitoyl protein thioesterase family protein 97.56
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 97.55
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 97.54
COG4782377 Uncharacterized protein conserved in bacteria [Fun 97.52
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 97.49
COG4814288 Uncharacterized protein with an alpha/beta hydrola 97.47
COG3046505 Uncharacterized protein related to deoxyribodipyri 97.44
KOG3101283 consensus Esterase D [General function prediction 97.42
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 97.4
COG1073299 Hydrolases of the alpha/beta superfamily [General 97.34
PLN02209437 serine carboxypeptidase 97.32
KOG3724 973 consensus Negative regulator of COPII vesicle form 97.31
KOG2541296 consensus Palmitoyl protein thioesterase [Lipid tr 97.21
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 97.13
COG3150191 Predicted esterase [General function prediction on 97.12
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 97.05
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 96.92
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 96.9
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 96.83
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 96.77
COG1770682 PtrB Protease II [Amino acid transport and metabol 96.75
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 96.73
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 96.65
PF06441112 EHN: Epoxide hydrolase N terminus; InterPro: IPR01 96.63
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 96.52
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 96.29
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 96.21
COG1505648 Serine proteases of the peptidase family S9A [Amin 96.09
COG0627316 Predicted esterase [General function prediction on 96.02
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 95.94
KOG2369473 consensus Lecithin:cholesterol acyltransferase (LC 95.93
PF00135 535 COesterase: Carboxylesterase family The prints ent 95.87
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 95.82
KOG3967297 consensus Uncharacterized conserved protein [Funct 95.81
KOG2237712 consensus Predicted serine protease [Posttranslati 95.72
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 95.62
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 95.58
COG4553415 DepA Poly-beta-hydroxyalkanoate depolymerase [Lipi 95.55
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 95.37
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 95.13
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 95.09
PF05576 448 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0 94.63
COG2819264 Predicted hydrolase of the alpha/beta superfamily 94.02
COG4947227 Uncharacterized protein conserved in bacteria [Fun 93.68
KOG12022376 consensus Animal-type fatty acid synthase and rela 93.62
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 93.28
COG2830214 Uncharacterized protein conserved in bacteria [Fun 93.26
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 93.23
KOG2521350 consensus Uncharacterized conserved protein [Funct 93.19
PF04244224 DPRP: Deoxyribodipyrimidine photo-lyase-related pr 92.98
PLN02162475 triacylglycerol lipase 92.61
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 92.44
PLN00413479 triacylglycerol lipase 92.26
PLN02454414 triacylglycerol lipase 91.14
KOG4372405 consensus Predicted alpha/beta hydrolase [General 91.12
PLN02571413 triacylglycerol lipase 90.97
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid trans 90.3
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 90.1
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 89.84
PLN02408365 phospholipase A1 89.52
PLN02934515 triacylglycerol lipase 88.24
PLN02310405 triacylglycerol lipase 87.96
PLN02324415 triacylglycerol lipase 87.68
PRK12652357 putative monovalent cation/H+ antiporter subunit E 87.32
PF07519 474 Tannase: Tannase and feruloyl esterase; InterPro: 87.06
PLN02802509 triacylglycerol lipase 86.53
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 86.39
KOG1516 545 consensus Carboxylesterase and related proteins [G 86.14
PLN02753531 triacylglycerol lipase 85.34
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 85.05
PLN03037525 lipase class 3 family protein; Provisional 84.72
PLN02761527 lipase class 3 family protein 84.41
PLN02719518 triacylglycerol lipase 84.07
TIGR00591454 phr2 photolyase PhrII. All proteins in this family 84.06
COG0415461 PhrB Deoxyribodipyrimidine photolyase [DNA replica 84.04
TIGR00289222 conserved hypothetical protein TIGR00289. Homologo 81.23
PLN02847 633 triacylglycerol lipase 81.0
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information 
Probab=100.00  E-value=6.8e-42  Score=369.97  Aligned_cols=251  Identities=31%  Similarity=0.534  Sum_probs=198.3

Q ss_pred             cEEEEEcCCCCCcCCHHHHHHHhC-CCeEEEEEECCccccc--------CChhHHHHHHHHHHHHHHHHHhcCCcEEEEE
Q 005554           46 SAVIWFKQDLRVDDHLGLVAASKY-QAVVPLYVFDHRILSR--------YSNEMLELVIFALEDLRKSLKEQGSDLMIRF  116 (691)
Q Consensus        46 ~~l~W~r~dlRl~DN~aL~~A~~~-~~~~~~f~~~~~~~~~--------~~~~~~~fl~~~l~~l~~~l~~~g~~l~~~~  116 (691)
                      .+|||||||||++||+||.+|++. .+|+||||+||+++..        .+++|++||++||.+|+++|+++|++|+++.
T Consensus         2 ~~l~WfRrDLRl~DN~aL~~A~~~~~~vl~vfi~dp~~~~~~~~~~~~~~~~~r~~Fl~esL~~L~~~L~~~g~~L~v~~   81 (429)
T TIGR02765         2 VVLYWFRNDLRVHDNPALYKASSSSDTLIPLYCFDPRQFKLTHFFGFPKTGPARGKFLLESLKDLRTSLRKLGSDLLVRS   81 (429)
T ss_pred             eEEEEeCCCCccccHHHHHHHHhcCCeEEEEEEECchHhccccccccCCCCHHHHHHHHHHHHHHHHHHHHcCCCeEEEe
Confidence            479999999999999999999987 6899999999988762        4899999999999999999999999999999


Q ss_pred             CChHHHHHHHHHHhCCcEEEEccccChhHHHHHHHHHHHHhhcCCCCCCceeEeeCcceeccCCC----CCCCcchhhHH
Q 005554          117 GRVENVIRELVEEVKATSVFAEEEVEYHLRQMMAIVDETLAKVSLVDGKPKICLWQTPFYDIKNL----NDLPVSHNEFR  192 (691)
Q Consensus       117 g~~~~~l~~l~~~~~~~~v~~~~~~~~~~~~~~~~v~~~l~~~~i~~~~~~~~~~~~~l~~~~~~----~~~~~~~~~f~  192 (691)
                      |++.++|++|+++++|++||+|.+|++++++||++|++.|.+.+|    .++.+++++|++|+++    +++|++|++|+
T Consensus        82 G~~~~vl~~L~~~~~~~~V~~~~~~~~~~~~rd~~v~~~l~~~~i----~~~~~~~~~l~~p~~v~~~~~~~~~~ft~f~  157 (429)
T TIGR02765        82 GKPEDVLPELIKELGVRTVFLHQEVGSEEKSVERLLQQALARLGI----HVEQHWGSTLYHEDDLPFDLEDLPDVFTQFR  157 (429)
T ss_pred             CCHHHHHHHHHHHhCCCEEEEeccCCHHHHHHHHHHHHHHHhcCc----eEEEecCCEeECHHhcCCCCCCCCCCchHHH
Confidence            999999999999999999999999999999999999999998887    8899999999988864    78899999999


Q ss_pred             hhccc---cCCCCCCCC-ccCCcCCCCCCCCCChhhhhhhhccCcchhchhhhhhcccchhhhhhHHhhhccccccccCC
Q 005554          193 KLQRP---LTSPILPPT-LAGAKLEADWGPLPTFDELKEFVNENPWKLEESWTLINNMSAETILTDKLSKLGKRSKRNLN  268 (691)
Q Consensus       193 ~~~~~---~~~p~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~a~~~~~~~~~~~~~~~~~~~~  268 (691)
                      +++..   ...+++.|. ++..+.......+|.+++++.                                         
T Consensus       158 ~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~l~~~~~-----------------------------------------  196 (429)
T TIGR02765       158 KQVEAKCSIRPPLPAPEKLPPLPSVDDPGWIPTLEDLGE-----------------------------------------  196 (429)
T ss_pred             HHHHhhCCCCCCCCCcccCCCCcccccccCCCChhhcCC-----------------------------------------
Confidence            98643   222333331 111110000001121111110                                         


Q ss_pred             CCCCcccccCCcceeccCCCeeecCchHHHHHHHHHHHhhcCCCCCchHHHHHHhhhhcCCCCCcccccccccccccccc
Q 005554          269 NQHSPRKRLDKSFFVTDKGNTVGGGTNAVLNALQAYLRYLEGTVRDDWQELQEKLRNAESRDGASFATLFGPALCLGIIS  348 (691)
Q Consensus       269 ~~~~~~~~~~~~~~~~~~~~~~~gGe~~a~~~l~~fl~~~~~~~~~~Y~~~r~~~~~~~~~~~~~~tS~LSpyL~~g~~~  348 (691)
                               +..  .......|+|||.+|+++|++|+.   ...+..|++.||.      .++.++||+||||||||+||
T Consensus       197 ---------~~~--~~~~~~~~~gGe~~A~~~L~~Fl~---~~~l~~Y~~~R~~------~~~~~~tS~LSpyL~~G~iS  256 (429)
T TIGR02765       197 ---------ESS--EVDRGLPFVGGETAGLARLKEYFW---SKDLKSYKETRNG------MLGPDYSTKFSPWLALGCVS  256 (429)
T ss_pred             ---------Ccc--cccccCCcCchHHHHHHHHHHHHh---hccHhhhhhccCc------ccCCCCcCccCHHHhCCccc
Confidence                     000  000011479999999999999983   3568899998753      24567899999999999999


Q ss_pred             hhHHHHHHHHHhh
Q 005554          349 RRGVHYEAIKFEK  361 (691)
Q Consensus       349 ~~~~~~~~~~~~~  361 (691)
                      +|+|++++.+++.
T Consensus       257 ~r~v~~~~~~~~~  269 (429)
T TIGR02765       257 PRQIYEELQRYET  269 (429)
T ss_pred             HHHHHHHHHHHHh
Confidence            9999999977653

Photolyases and cryptochromes are related flavoproteins. Photolyases harness the energy of blue light to repair DNA damage by removing pyrimidine dimers. Cryptochromes do not repair DNA and are presumed to act instead in some other (possibly unknown) process such as entraining circadian rhythms. This model describes the cryptochrome DASH subfamily, one of at least five major subfamilies, which is found in plants, animals, marine bacteria, etc. Members of this family bind both folate and FAD. They may show weak photolyase activity in vitro but have not been shown to affect DNA repair in vivo. Rather, DASH family cryptochromes have been shown to bind RNA (Vibrio cholerae VC1814), or DNA, and seem likely to act in light-responsive regulatory processes.
>COG0415 PhrB Deoxyribodipyrimidine photolyase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>TIGR02766 crypt_chrom_pln cryptochrome, plant family Back     alignment and domain information
>PRK10674 deoxyribodipyrimidine photolyase; Provisional Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG0133 consensus Deoxyribodipyrimidine photolyase/cryptochrome [Replication, recombination and repair; Signal transduction mechanisms] Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PF03441 FAD_binding_7: FAD binding domain of DNA photolyase from Prosite Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF04301 DUF452: Protein of unknown function (DUF452); InterPro: IPR007398 This is a family of uncharacterised proteins Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG3046 Uncharacterized protein related to deoxyribodipyrimidine photolyase [General function prediction only] Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF06441 EHN: Epoxide hydrolase N terminus; InterPro: IPR010497 This entry represents the N-terminal region of the eukaryotic epoxide hydrolase protein Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>KOG3967 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4553 DepA Poly-beta-hydroxyalkanoate depolymerase [Lipid metabolism] Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>COG2830 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>KOG2521 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04244 DPRP: Deoxyribodipyrimidine photo-lyase-related protein; InterPro: IPR007357 This family appears to be related to DNA photolyases Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>COG0415 PhrB Deoxyribodipyrimidine photolyase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00289 conserved hypothetical protein TIGR00289 Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query691
2vtb_B525 Structure Of Cryptochrome 3 - Dna Complex Length = 6e-14
2ijg_X526 Crystal Structure Of Cryptochrome 3 From Arabidopsi 6e-14
2j4d_A525 Cryptochrome 3 From Arabidopsis Thaliana Length = 5 7e-14
1j1i_A296 Crystal Structure Of A His-Tagged Serine Hydrolase 1e-07
1np7_A489 Crystal Structure Analysis Of Synechocystis Sp. Pcc 2e-07
1tez_A474 Complex Between Dna And The Dna Photolyase From Ana 6e-06
1owl_A484 Structure Of Apophotolyase From Anacystis Nidulans 7e-06
3ans_A336 Human Soluble Epoxide Hydrolase In Complex With A S 2e-05
3pdc_A344 Crystal Structure Of Hydrolase Domain Of Human Solu 2e-05
1s8o_A555 Human Soluble Epoxide Hydrolase Length = 555 2e-05
3qit_A286 Thioesterase Domain From Curacin Biosynthetic Pathw 7e-05
1cqz_A554 Crystal Structure Of Murine Soluble Epoxide Hydrola 8e-05
2e0i_A440 Crystal Structure Of Archaeal Photolyase From Sulfo 8e-05
1dnp_A471 Structure Of Deoxyribodipyrimidine Photolyase Lengt 2e-04
3fy4_A537 (6-4) Photolyase Crystal Structure Length = 537 2e-04
4f0j_A315 Crystal Structure Of A Probable Hydrolytic Enzyme ( 4e-04
1iun_A282 Meta-Cleavage Product Hydrolase From Pseudomonas Fl 5e-04
2d0d_A282 Crystal Structure Of A Meta-Cleavage Product Hydrol 8e-04
>pdb|2VTB|B Chain B, Structure Of Cryptochrome 3 - Dna Complex Length = 525 Back     alignment and structure 
Iteration: 1

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 82/351 (23%), Positives = 141/351 (40%), Gaps = 83/351 (23%)
Query: 34  PTAAATSKGRSGSAVIWFKQDLRVDDHLGLVAA-SKYQAVVPLYVFDHRILSRYSNEMLE 92
           P++++  +   G  ++WF+ DLRV D+  L  A S    ++P+Y  D R+   ++     
Sbjct: 30  PSSSSVKRKGKGVTILWFRNDLRVLDNDALYKAWSSSDTILPVYCLDPRLF--HTTHFFN 87
Query: 93  L----------VIFALEDLRKSLKEQGSDLMIRFGRVENVIRELVEEVKATSVFAEEEVE 142
                      ++  L DLRK+L ++G +L+IR G+ E ++  L ++  A +VFA +E  
Sbjct: 88  FPKTGALRGGFLMECLVDLRKNLMKRGLNLLIRSGKPEEILPSLAKDFGARTVFAHKETC 147
Query: 143 YHLRQMMAIVDETLAKVSLVDGKPKICLWQTPFYDIKNLN----DLPVSHNEFRKLQRP- 197
                +  +V++ L +V   +      +W +  Y   +L     DLP  + +FRK     
Sbjct: 148 SEEVDVERLVNQGLKRVG--NSTKLELIWGSTMYHKDDLPFDVFDLPDVYTQFRKSVEAK 205
Query: 198 ---LTSPILPPTLAGAKLEADWGPLPTFDELKEFVNENPWKLEESWTLINNMSAETILTD 254
               +S  +P +L       DWG +PT                                 
Sbjct: 206 CSIRSSTRIPLSLGPTPSVDDWGDVPT--------------------------------- 232
Query: 255 KLSKLGKRSKRNLNNQHSPRKRLDKSFFVTDKGNTVGGGTNAVLNALQAYLRYLEGTVRD 314
            L KLG   +                  VT     VGG +  V    + + +        
Sbjct: 233 -LEKLGVEPQE-----------------VTRGMRFVGGESAGVGRVFEYFWK-------K 267
Query: 315 DWQELQEKLRNAESRDGASFATLFGPALCLGIISRRGVHYEAIKFEKERNA 365
           D  ++ ++ RN     G  ++T F P L  G IS R ++ E  ++EKER A
Sbjct: 268 DLLKVYKETRNGML--GPDYSTKFSPWLAFGCISPRFIYEEVQRYEKERVA 316
>pdb|2IJG|X Chain X, Crystal Structure Of Cryptochrome 3 From Arabidopsis Thaliana Length = 526 Back     alignment and structure
>pdb|2J4D|A Chain A, Cryptochrome 3 From Arabidopsis Thaliana Length = 525 Back     alignment and structure
>pdb|1J1I|A Chain A, Crystal Structure Of A His-Tagged Serine Hydrolase Involved In The Carbazole Degradation (Carc Enzyme) Length = 296 Back     alignment and structure
>pdb|1NP7|A Chain A, Crystal Structure Analysis Of Synechocystis Sp. Pcc6803 Cryptochrome Length = 489 Back     alignment and structure
>pdb|1TEZ|A Chain A, Complex Between Dna And The Dna Photolyase From Anacystis Nidulans Length = 474 Back     alignment and structure
>pdb|1OWL|A Chain A, Structure Of Apophotolyase From Anacystis Nidulans Length = 484 Back     alignment and structure
>pdb|3ANS|A Chain A, Human Soluble Epoxide Hydrolase In Complex With A Synthetic Inhibitor Length = 336 Back     alignment and structure
>pdb|3PDC|A Chain A, Crystal Structure Of Hydrolase Domain Of Human Soluble Epoxide Hydrolase Complexed With A Benzoxazole Inhibitor Length = 344 Back     alignment and structure
>pdb|1S8O|A Chain A, Human Soluble Epoxide Hydrolase Length = 555 Back     alignment and structure
>pdb|3QIT|A Chain A, Thioesterase Domain From Curacin Biosynthetic Pathway Length = 286 Back     alignment and structure
>pdb|1CQZ|A Chain A, Crystal Structure Of Murine Soluble Epoxide Hydrolase. Length = 554 Back     alignment and structure
>pdb|2E0I|A Chain A, Crystal Structure Of Archaeal Photolyase From Sulfolobus Tokodaii With Two Fad Molecules: Implication Of A Novel Light-Harvesting Cofactor Length = 440 Back     alignment and structure
>pdb|1DNP|A Chain A, Structure Of Deoxyribodipyrimidine Photolyase Length = 471 Back     alignment and structure
>pdb|3FY4|A Chain A, (6-4) Photolyase Crystal Structure Length = 537 Back     alignment and structure
>pdb|4F0J|A Chain A, Crystal Structure Of A Probable Hydrolytic Enzyme (Pa3053) From Pseudomonas Aeruginosa Pao1 At 1.50 A Resolution Length = 315 Back     alignment and structure
>pdb|1IUN|A Chain A, Meta-Cleavage Product Hydrolase From Pseudomonas Fluorescens Ip01 (Cumd) S103a Mutant Hexagonal Length = 282 Back     alignment and structure
>pdb|2D0D|A Chain A, Crystal Structure Of A Meta-Cleavage Product Hydrolase (Cumd) A129v Mutant Length = 282 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query691
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 4e-45
1iup_A282 META-cleavage product hydrolase; aromatic compound 7e-38
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 2e-33
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 8e-33
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 2e-32
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 8e-32
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 2e-31
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 4e-30
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 1e-26
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 2e-26
2j4d_A525 Cryptochrome 3, cryptochrome DASH; DNA-binding pro 8e-26
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 2e-25
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 1e-24
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 2e-24
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 5e-24
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 6e-24
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 8e-24
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 1e-23
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 2e-23
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 7e-23
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 9e-23
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 2e-22
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 7e-22
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 2e-21
1np7_A489 DNA photolyase; protein with FAD cofactor; HET: DN 5e-21
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 6e-21
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 6e-21
2j07_A420 Deoxyribodipyrimidine photo-lyase; flavoprotein, n 8e-21
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 1e-20
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 1e-20
1r3d_A264 Conserved hypothetical protein VC1974; structural 1e-20
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 2e-20
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 2e-20
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 2e-20
2e0i_A440 432AA long hypothetical deoxyribodipyrimidine PHO; 5e-20
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 6e-20
2wq7_A543 RE11660P; lyase-DNA complex, DNA repair, DNA lesio 8e-20
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 1e-19
1owl_A484 Photolyase, deoxyribodipyrimidine photolyase; DNA 2e-19
3fy4_A537 6-4 photolyase; DNA repair, clock cryptochrome; HE 2e-19
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 3e-19
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 5e-19
3tvs_A538 Cryptochrome-1; circadian clock light entrainment, 6e-19
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 9e-19
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 9e-19
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 2e-18
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 2e-18
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 2e-18
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 3e-18
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 4e-18
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 5e-18
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 5e-18
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 6e-18
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 9e-18
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 1e-17
1u3d_A509 Cryptochrome 1 apoprotein; photolyase, AMPPNP, sig 2e-17
1dnp_A471 DNA photolyase; DNA repair, electron transfer, exc 2e-17
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 5e-17
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 5e-17
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 6e-17
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 1e-16
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 2e-16
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 5e-16
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 1e-15
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 1e-15
2xry_A482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 1e-15
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 2e-15
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 2e-15
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 4e-15
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 1e-14
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 1e-14
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 2e-14
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 6e-14
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 1e-13
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 2e-13
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 4e-13
3umv_A506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 9e-13
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 5e-12
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 9e-12
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 2e-11
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 3e-10
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 3e-09
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 3e-09
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 8e-09
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 1e-08
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 4e-08
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 2e-07
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 7e-07
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 2e-06
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 3e-06
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 4e-06
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 5e-06
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 1e-05
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 1e-05
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 6e-05
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 1e-04
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 4e-04
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 4e-04
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 5e-04
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Length = 296 Back     alignment and structure
 Score =  162 bits (411), Expect = 4e-45
 Identities = 63/295 (21%), Positives = 112/295 (37%), Gaps = 31/295 (10%)

Query: 406 YSTRIWRWNGYQIQYTVAGKEGPAILLVHGFGAFLE---HYRDNIYDIADGGNRVWAITL 462
           Y  R     G + +Y  AG +G  ++L+HG GA  E   ++R+ I  +A    RV A+ +
Sbjct: 16  YVERFVNAGGVETRYLEAG-KGQPVILIHGGGAGAESEGNWRNVIPILARH-YRVIAMDM 73

Query: 463 LGFGRSEKPNIVYTELMWSELLRDFTVEV-VGEPVHLIGNSIGGYFVAIVACLWPAVVKS 521
           LGFG++ KP+I YT+      L DF   +     V ++GNS+GG     V+ L   +V +
Sbjct: 74  LGFGKTAKPDIEYTQDRRIRHLHDFIKAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNA 133

Query: 522 VVLINSAGNVIPEYSFLQFSNERQASGPIRLGAQLLLFYLRLNISNFVKQCYPTRRERAD 581
           +VL+ SAG             E        +        +   +             + D
Sbjct: 134 LVLMGSAG----------LVVEIHEDLRPIINYDFTREGMVHLVKALTN-----DGFKID 178

Query: 582 DWLISEMLRASYDPGVLVVLESIFSFKLSLPLNYL----LEGFKEKVLIIQGIKDPISDS 637
           D +I+     + D        +   +       +     +   +   L++QG  D +   
Sbjct: 179 DAMINSRYTYATDEATRKAYVATMQWIREQGGLFYDPEFIRKVQVPTLVVQGKDDKVVPV 238

Query: 638 KSKVAMFKEHCAG---IVIRELDAGHCPHDEKPEEVNSIISEWIVTIESKVPAES 689
           ++    F +        +I     GH    E PE+  +    ++       PA +
Sbjct: 239 ETA-YKFLDLIDDSWGYIIP--HCGHWAMIEHPEDFANATLSFLSLRVDITPAAA 290
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Length = 282 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Length = 272 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Length = 291 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Length = 286 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Length = 289 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Length = 285 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Length = 315 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Length = 292 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Length = 314 Back     alignment and structure
>2j4d_A Cryptochrome 3, cryptochrome DASH; DNA-binding protein, flavoprotein, FAD, mitochondrion, plastid, chromophore, chloroplast; HET: FAD MHF; 1.9A {Arabidopsis thaliana} PDB: 2vtb_A* 2ijg_X* 2vtb_B* Length = 525 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Length = 306 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Length = 278 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Length = 245 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Length = 269 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Length = 279 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Length = 277 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Length = 254 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Length = 286 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Length = 275 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Length = 273 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Length = 456 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} PDB: 1va4_A 3hi4_A 3hea_A Length = 271 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Length = 309 Back     alignment and structure
>1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Length = 489 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Length = 302 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Length = 274 Back     alignment and structure
>2j07_A Deoxyribodipyrimidine photo-lyase; flavoprotein, nucleotide-binding, DNA repair; HET: FAD HDF; 1.95A {Thermus thermophilus} SCOP: a.99.1.1 c.28.1.1 PDB: 1iqu_A* 1iqr_A* 2j08_A* 2j09_A* Length = 420 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} Length = 281 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Length = 318 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Length = 264 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Length = 310 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Length = 276 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Length = 297 Back     alignment and structure
>2e0i_A 432AA long hypothetical deoxyribodipyrimidine PHO; photolyase, FAD, DNA repair, lyase; HET: FAD; 2.80A {Sulfolobus tokodaii} Length = 440 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Length = 264 Back     alignment and structure
>2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Length = 543 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258 Back     alignment and structure
>1owl_A Photolyase, deoxyribodipyrimidine photolyase; DNA repair, flavin enzyme, photoreactivating enzyme; HET: FAD; 1.80A {Synechococcus elongatus} SCOP: a.99.1.1 c.28.1.1 PDB: 1owm_A* 1own_A* 1owo_A* 1owp_A* 1qnf_A* 1tez_A* Length = 484 Back     alignment and structure
>3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} Length = 537 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Length = 297 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Length = 555 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Length = 210 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Length = 255 Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 1cqw_A 2v9z_A Length = 299 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Length = 293 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Length = 330 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Length = 328 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} Length = 266 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Length = 304 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Length = 398 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Length = 276 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Length = 306 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Length = 298 Back     alignment and structure
>1u3d_A Cryptochrome 1 apoprotein; photolyase, AMPPNP, signaling protein; HET: FAD ANP NDS; 2.45A {Arabidopsis thaliana} SCOP: a.99.1.1 c.28.1.1 PDB: 1u3c_A* Length = 509 Back     alignment and structure
>1dnp_A DNA photolyase; DNA repair, electron transfer, excitation energy transfer, carbon-carbon, lyase (carbon-carbon); HET: DNA FAD MHF; 2.30A {Escherichia coli} SCOP: a.99.1.1 c.28.1.1 Length = 471 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Length = 316 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Length = 266 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Length = 271 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Length = 293 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Length = 330 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Length = 291 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Length = 268 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Length = 301 Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Length = 482 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Length = 207 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Length = 286 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Length = 282 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Length = 316 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Length = 262 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Length = 356 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Length = 285 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Length = 294 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Length = 247 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Length = 251 Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Length = 506 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Length = 286 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Length = 273 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Length = 264 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} Length = 270 Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Length = 320 Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Length = 257 Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Length = 342 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Length = 303 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Length = 270 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Length = 305 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Length = 238 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Length = 267 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} Length = 258 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Length = 354 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Length = 415 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Length = 290 Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Length = 285 Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Length = 131 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Length = 251 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Length = 386 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Length = 258 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Length = 181 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Length = 223 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 691
d1bn7a_291 c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus 2e-21
d1mj5a_298 c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomona 2e-20
d1a8sa_273 c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas flu 5e-20
d1b6ga_310 c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacte 2e-19
d1uk8a_271 c.69.1.10 (A:) Meta-cleavage product hydrolase Cum 1e-18
d1xkla_258 c.69.1.20 (A:) Salicylic acid-binding protein 2 (S 2e-18
d2rhwa1283 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2 4e-18
d1va4a_271 c.69.1.12 (A:) Arylesterase {Pseudomonas fluoresce 6e-18
d1a8qa_274 c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces au 7e-18
d1zd3a2322 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, 1e-17
d1brta_277 c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces au 2e-17
d1q0ra_297 c.69.1.28 (A:) Aclacinomycin methylesterase RdmC { 4e-17
d1mtza_290 c.69.1.7 (A:) Tricorn interacting factor F1 {Archa 5e-17
d1j1ia_268 c.69.1.10 (A:) Meta cleavage compound hydrolase Ca 2e-16
d1m33a_256 c.69.1.26 (A:) Biotin biosynthesis protein BioH {E 2e-16
d1r3da_264 c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio 2e-16
d1hkha_279 c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. 3e-16
d1a88a_275 c.69.1.12 (A:) Chloroperoxidase L {Streptomyces li 4e-16
d3c70a1256 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber t 9e-16
d1pjaa_268 c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {H 1e-15
d1ehya_293 c.69.1.11 (A:) Bacterial epoxide hydrolase {Agroba 1e-13
d1u3da2185 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Ara 2e-13
d1np7a2204 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp. 3e-13
d1owla2202 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus e 4e-13
d1cvla_319 c.69.1.18 (A:) Lipase {Chromobacterium viscosum [T 1e-12
d1c4xa_281 c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-di 2e-12
d1ex9a_285 c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [Tax 3e-12
d1k8qa_377 c.69.1.6 (A:) Gastric lipase {Dog (Canis familiari 4e-12
d2j07a2170 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermop 4e-12
d1azwa_313 c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas 6e-12
d1dnpa2200 c.28.1.1 (A:1-200) DNA photolyase {Escherichia col 5e-11
d1qlwa_318 c.69.1.15 (A:) A novel bacterial esterase {Alcalig 7e-11
d1wm1a_313 c.69.1.7 (A:) Proline aminopeptidase {Serratia mar 2e-10
d2dsta1122 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 6e-08
d1tqha_242 c.69.1.29 (A:) Carboxylesterase Est {Bacillus stea 8e-08
d1ispa_179 c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1e-07
d1tcaa_317 c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Cand 4e-07
d1ufoa_238 c.69.1.27 (A:) Hypothetical protein TT1662 {Thermu 5e-07
d1xkta_286 c.69.1.22 (A:) Fatty acid synthase {Human (Homo sa 8e-07
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 2e-06
d1qo7a_394 c.69.1.11 (A:) Bacterial epoxide hydrolase {Asperg 5e-06
d1imja_208 c.69.1.23 (A:) Ccg1/TafII250-interacting factor B 1e-04
d1imja_208 c.69.1.23 (A:) Ccg1/TafII250-interacting factor B 0.001
d1jmkc_230 c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillu 2e-04
d1l7aa_318 c.69.1.25 (A:) Cephalosporin C deacetylase {Bacill 4e-04
d1mo2a_255 c.69.1.22 (A:) Erythromycin polyketide synthase {S 4e-04
d2r8ba1203 c.69.1.14 (A:44-246) Uncharacterized protein Atu24 0.001
d3b5ea1209 c.69.1.14 (A:7-215) Uncharacterized protein Mll837 0.002
d1jfra_260 c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [Ta 0.002
d2jbwa1360 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine h 0.004
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Length = 291 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Haloalkane dehalogenase
domain: Haloalkane dehalogenase
species: Rhodococcus sp. [TaxId: 1831]

 Score = 93.0 bits (229), Expect = 2e-21
 Identities = 47/283 (16%), Positives = 90/283 (31%), Gaps = 12/283 (4%)

Query: 406 YSTRIWRWNGYQIQYTVAG-KEGPAILLVHGFGAFLEHYRDNIYDIADGGNRVWAITLLG 464
           +        G ++ Y   G ++G  +L +HG       +R+ I  +A    R  A  L+G
Sbjct: 7   FDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSH-RCIAPDLIG 65

Query: 465 FGRSEKPNIVYTELMWSELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVL 524
            G+S+KP++ Y        L  F   +  E V L+ +  G       A   P  VK +  
Sbjct: 66  MGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIAC 125

Query: 525 INSAGNVIPEYSFLQFSNERQASGPIRLGAQLLLFYLRLNISNFVKQCYPTRRERADDWL 584
           +     +     + +F+ E   +       + L+      I   + +C        +   
Sbjct: 126 MEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGVLPKCVVRPLTEVEMDH 185

Query: 585 ISEMLRASYDPGVLVVLESIFSFKLSLPLNYL--------LEGFKEKVLIIQGIKDPISD 636
             E      D   L    +                     L       L+  G    +  
Sbjct: 186 YREPFLKPVDREPLWRFPNEIPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLI- 244

Query: 637 SKSKVAMFKEHCAGIVIREL-DAGHCPHDEKPEEVNSIISEWI 678
             ++ A   E        ++    H   ++ P+ + S I+ W+
Sbjct: 245 PPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWL 287
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Length = 298 Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Length = 273 Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Length = 310 Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Length = 271 Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 258 Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Length = 283 Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Length = 271 Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Length = 274 Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Length = 277 Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Length = 297 Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 290 Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Length = 268 Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Length = 264 Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Length = 279 Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Length = 275 Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 256 Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Length = 293 Back     information, alignment and structure
>d1u3da2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 185 Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Length = 204 Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Length = 202 Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Length = 319 Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Length = 281 Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Length = 285 Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Length = 377 Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Length = 170 Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Length = 313 Back     information, alignment and structure
>d1dnpa2 c.28.1.1 (A:1-200) DNA photolyase {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Length = 318 Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Length = 313 Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Length = 122 Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Length = 179 Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Length = 317 Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Length = 238 Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 286 Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Length = 394 Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Length = 208 Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Length = 208 Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Length = 230 Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Length = 318 Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Length = 255 Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Length = 203 Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Length = 209 Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Length = 260 Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 360 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query691
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 100.0
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 100.0
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 100.0
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 100.0
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 100.0
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 100.0
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 100.0
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 100.0
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 100.0
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 100.0
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 100.0
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 100.0
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 100.0
d1u3da2185 Cryptochrome {Thale cress (Arabidopsis thaliana) [ 100.0
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 100.0
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 100.0
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 100.0
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 100.0
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 100.0
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 100.0
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 100.0
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 100.0
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 100.0
d1dnpa2200 DNA photolyase {Escherichia coli [TaxId: 562]} 100.0
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 100.0
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 100.0
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 100.0
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 100.0
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.98
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.98
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.97
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.96
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.95
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.95
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.95
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 99.92
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 99.91
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 99.91
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.9
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.9
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 99.9
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 99.9
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 99.89
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.89
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.87
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.87
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 99.85
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.84
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 99.82
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.82
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.81
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 99.77
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 99.77
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.77
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 99.76
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.74
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.73
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.71
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 99.7
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.7
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 99.68
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.68
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.68
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.68
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 99.63
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.55
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 99.53
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.51
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.49
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.47
d1np7a1279 Cryptochrome C-terminal domain {Synechocystis sp., 99.46
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.44
d1owla1271 C-terminal domain of DNA photolyase {Synechococcus 99.41
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.41
d1dnpa1269 C-terminal domain of DNA photolyase {Escherichia c 99.39
d1u3da1300 Cryptochrome C-terminal domain {Thale cress (Arabi 99.37
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.34
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 99.31
d2j07a1234 C-terminal domain of DNA photolyase {Thermus therm 99.3
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.26
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 99.25
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 99.24
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 99.23
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 99.22
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 99.17
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 99.12
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 99.05
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 99.03
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 98.96
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 98.88
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 98.82
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 98.8
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 98.8
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 98.72
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 98.63
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 98.62
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 98.27
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 97.97
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 97.63
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 97.51
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 97.46
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 97.44
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 97.44
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 97.43
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 97.36
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 97.08
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 97.04
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 96.9
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 95.59
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 95.53
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 95.53
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 95.47
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 95.32
d1dnpa1269 C-terminal domain of DNA photolyase {Escherichia c 90.57
d1u3da1300 Cryptochrome C-terminal domain {Thale cress (Arabi 90.26
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 88.73
d1owla1271 C-terminal domain of DNA photolyase {Synechococcus 87.44
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 85.81
d2j07a1234 C-terminal domain of DNA photolyase {Thermus therm 85.27
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 85.26
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Aclacinomycin methylesterase RdmC
domain: Aclacinomycin methylesterase RdmC
species: Streptomyces purpurascens [TaxId: 1924]

Probab=100.00  E-value=1e-37  Score=241.44  Aligned_cols=271  Identities=16%  Similarity=0.061  Sum_probs=181.3

Q ss_pred             EEEEEEECCEEEEEEEECCC-CCEEEEECCCCCCHHHHH-HHHHHHHCCCCEEEEECCCCCCCCCCCC---CCCCHHHHH
Q ss_conf             79999886958999980899-995999858899967799-9899985089799996899976999999---577899999
Q 005554          407 STRIWRWNGYQIQYTVAGKE-GPAILLVHGFGAFLEHYR-DNIYDIADGGNRVWAITLLGFGRSEKPN---IVYTELMWS  481 (691)
Q Consensus       407 ~~~~~~~~g~~i~y~~~g~~-~p~VIliHG~~~~~~~~~-~~~~~L~~~G~~Vi~~D~~G~G~S~~~~---~~~s~~~~a  481 (691)
                      +.+++..+|.+|+|.++|++ +|+|||+||++++...|. .++..|.++||+|+++|+||||.|+.+.   ..+++++++
T Consensus         1 ~e~~~~~g~~~i~y~~~G~~~~p~vvl~HG~~~~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~~~~~~~~   80 (297)
T d1q0ra_           1 SERIVPSGDVELWSDDFGDPADPALLLVMGGNLSALGWPDEFARRLADGGLHVIRYDHRDTGRSTTRDFAAHPYGFGELA   80 (297)
T ss_dssp             CEEEEEETTEEEEEEEESCTTSCEEEEECCTTCCGGGSCHHHHHHHHTTTCEEEEECCTTSTTSCCCCTTTSCCCHHHHH
T ss_pred             CCEEEEECCEEEEEEEECCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             98699989999999995379998799989998676688899999998689889998179986555545555556510332


Q ss_pred             HHHHHHHHHHCCCCEEEEEECHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCC------HHHHHHH
Q ss_conf             9999999892796789999693699999999958644136899537998888413332113421288------1456668
Q 005554          482 ELLRDFTVEVVGEPVHLIGNSIGGYFVAIVACLWPAVVKSVVLINSAGNVIPEYSFLQFSNERQASG------PIRLGAQ  555 (691)
Q Consensus       482 ~di~~ll~~l~~~~v~lvGhS~GG~ial~~A~~~p~~V~~lIli~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~  555 (691)
                      +++..++++++.++++++||||||.+++.+|..+|++|+++|++++.....................      .......
T Consensus        81 ~d~~~ll~~l~~~~~~lvGhS~Gg~~a~~~a~~~P~~v~~lvli~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (297)
T d1q0ra_          81 ADAVAVLDGWGVDRAHVVGLSMGATITQVIALDHHDRLSSLTMLLGGGLDIDFDANIERVMRGEPTLDGLPGPQQPFLDA  160 (297)
T ss_dssp             HHHHHHHHHTTCSSEEEEEETHHHHHHHHHHHHCGGGEEEEEEESCCCTTCCHHHHHHHHHHTCCCSSCSCCCCHHHHHH
T ss_pred             HHHCCCCCCCCCCCEEECCCCCCCHHHHHHHCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             32113232233221121032335303555411210203255798146666542035677753102332000256789999


Q ss_pred             HHHHH---------HHHHHHHHHHHHCCCCCCCCCHHH----HHHHHHHCCCCCHHHHHHHHHCCCCCCCHHHHHCCCCC
Q ss_conf             89999---------996599999864689874001999----99999832793169999998501367616765148998
Q 005554          556 LLLFY---------LRLNISNFVKQCYPTRRERADDWL----ISEMLRASYDPGVLVVLESIFSFKLSLPLNYLLEGFKE  622 (691)
Q Consensus       556 ~~~~~---------~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~  622 (691)
                      .....         ..............  ........    ............ ..............+....++++++
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~l~~i~~  237 (297)
T d1q0ra_         161 LALMNQPAEGRAAEVAKRVSKWRILSGT--GVPFDDAEYARWEERAIDHAGGVL-AEPYAHYSLTLPPPSRAAELREVTV  237 (297)
T ss_dssp             HHHHHSCCCSHHHHHHHHHHHHHHHHCS--SSCCCHHHHHHHHHHHHHHTTTCC-SCCCGGGGCCCCCGGGGGGGGGCCS
T ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHCCC--CCCCHHHHHHHHHHHHHHHCCCCC-HHHHHHHHHHHCCCCCHHHHHCCCC
T ss_conf             9872166310257788888777651466--664107888888887653102421-0235665543200000455422378


Q ss_pred             CEEEEEECCCCCCCHHHHHHHHHHHCCCCEEEEE-CCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             5899973899999926799999982798299992-9778988559699999999999830
Q 005554          623 KVLIIQGIKDPISDSKSKVAMFKEHCAGIVIREL-DAGHCPHDEKPEEVNSIISEWIVTI  681 (691)
Q Consensus       623 PvLiI~G~~D~~vp~~~~~~~~~~~~~~~~~~~~-~agH~~~~e~pe~v~~~I~~fL~~~  681 (691)
                      ||++|+|++|.+++++. .+.+.+.+++++++++ ++||+++.|+|+++++.|.+||+..
T Consensus       238 Pvlvi~G~~D~~~~~~~-~~~~~~~~p~~~~~~i~~~gH~~~~e~p~~~~~~i~~~l~~~  296 (297)
T d1q0ra_         238 PTLVIQAEHDPIAPAPH-GKHLAGLIPTARLAEIPGMGHALPSSVHGPLAEVILAHTRSA  296 (297)
T ss_dssp             CEEEEEETTCSSSCTTH-HHHHHHTSTTEEEEEETTCCSSCCGGGHHHHHHHHHHHHHHT
T ss_pred             CEEEEEECCCCCCCHHH-HHHHHHHCCCCEEEEECCCCCCCHHHCHHHHHHHHHHHHHHH
T ss_conf             65999868899889999-999998689988999899997611339999999999999731
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1u3da2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1dnpa2 c.28.1.1 (A:1-200) DNA photolyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1np7a1 a.99.1.1 (A:205-483) Cryptochrome C-terminal domain {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1owla1 a.99.1.1 (A:205-475) C-terminal domain of DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1dnpa1 a.99.1.1 (A:201-469) C-terminal domain of DNA photolyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u3da1 a.99.1.1 (A:198-497) Cryptochrome C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d2j07a1 a.99.1.1 (A:172-405) C-terminal domain of DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1dnpa1 a.99.1.1 (A:201-469) C-terminal domain of DNA photolyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u3da1 a.99.1.1 (A:198-497) Cryptochrome C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1owla1 a.99.1.1 (A:205-475) C-terminal domain of DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d2j07a1 a.99.1.1 (A:172-405) C-terminal domain of DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure