Citrus Sinensis ID: 005561

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-
MPSSVSTRHSARFGLGGIFLYFTTLPLANPKTLDTTSSSLHVFALSTYPSSLSARGVFSTLEYSSLILSSMATAMATLPLFMRLPTPRRRALTKHTLPLTSPLRRSLAFPPLLRAKFNSEGTITCAYVSGPASDPIVSEPDPRINDSVSPSEKVHSPPNLITWGLLWSLFLKHKLRLGLSVLTLIGCTTCTLSMPIFSGRFFEVLIGARPEPLWKLLSKVGLLYALEPIFTVIFVMNMNTVWEKVMSIVKAQIFRRVLIQKAEFFDRYKVGELSGLLTSDLGSLKALVSENISRDRGFRALSEVIGTICILFNIAPQLAPILGVLVLTVSVLVAVYKRSTVPVFKAHGLAQASIADCVTETFSAIRTVRSFGGEKRQMLMFGRQVLAYQQSGIKLGTFKSLNESLTRIAIYISLLALYCLGGSKVKAGELSVGIVASFIGYTFTLTFAVQGLVNTFGDLRGTFAAVERINSILSTTEIDDALANGLERDIQQKHVEDENIKLFLFDGSNGKHQHLNMHYMSHLKSANSVCSFAWSGDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGSSGAGKSTIVQLLARFYEPTGGRITVGGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYGLPDENVSKDDIIKAAKAANAHDFIISLPQVWLSKSHFVLLQPLLILMSYKLCLV
ccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccHHHHHcccccHHHHHHHHcccccccccccccccccccccccccccccccccEEEEcEEEEcccccccccccccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEcccccccccHHHHHHHccEEccccccccccHHHHHccccccccccHHHHHHHHHHHcHHHHHHHcccccccccccccHHHHHHHHHHHHHcc
ccccccccccccccccEEEEEEEEcccccccHccccccEEEEEccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccccccHHHHcHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEcccccccEEEEEEEccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccEEEEEEccEEHHHEcHHHHHHHEEEEcccccccccEHHHHHHccccccccHHHHHHHHHHHHcHHHHHHHcccccHHHHHHHHccccHEHHHHHHHcc
mpssvstrhsarfglGGIFLYFttlplanpktldttsssLHVFALstypsslsargvfSTLEYSSLILSSMATAMATlplfmrlptprrraltkhtlpltsplrrslafppllrakfnsegtitcayvsgpasdpivsepdprindsvspsekvhsppnliTWGLLWSLFLKHKLRLGLSVLTLIgcttctlsmpifsgRFFEVLIGARPEPLWKLLSKVGLLYALEPIFTVIFVMNMNTVWEKVMSIVKAQIFRRVLIQKAeffdrykvgelsglltsdLGSLKALVSENISRDRGFRALSEVIGTICILFNIAPQLAPILGVLVLTVSVLVAVYKRstvpvfkahglaqaSIADCVTETFSAIRTVRSFGGEKRQMLMFGRQVLAYQQSGIKLGTFKSLNESLTRIAIYISLLALYCLggskvkageLSVGIVASFIGYTFTLTFAVQGLVNTFGDLRGTFAAVERINSILSTTEIDDALANGLERDIQQKHVEDENIKlflfdgsngkhqhLNMHYMSHLKsansvcsfawsgdicledvyfsyplrpdvvilNGLNLTLKSGSVtalvgssgagkSTIVQLLARFyeptggritvggedlrtfdksEWARVVSIVNQEPVLFSVSVgeniayglpdenvskDDIIKAAKAANAHDFIISLpqvwlskshfvlLQPLLILMSYKLCLV
mpssvstrhsaRFGLGGIFLYFTTLPLANPKTLDTTSSSLHVFALSTypsslsarGVFSTLEYSSLILSSMATAMATLPLFMRLPTPRRRALtkhtlpltsplrrslafppLLRAKFNSEGTITCAYVSGPASDPIVSEPDPRINDSvspsekvhsppnLITWGLLWSLFLKHKLRLGLSVLTLIGCTTCTLSMPIFSGRFFEVLIGARPEPLWKLLSKVGLLYALEPIFTVIFVMNMNTVWEKVMSIVKAQIFRRVLIQKAEFFDRYKVGELSGLLTSDLGSLKALVSENISRDRGFRALSEVIGTICILFNIAPQLAPILGVLVLTVSVLVAVYKRSTVPVFKAHGLAQASIADCVTETFSAIRTVRSFGGEKRQMLMFGRQVLAYQQSGIKLGTFKSLNESLTRIAIYISLLALYCLGGSKVKAGELSVGIVASFIGYTFTLTFAVQGLVNTFGDLRGTFAAVERINSILSTTEIDDALANGLERDIQQKHVEDENIKLFLFDGSNGKHQHLNMHYMSHLKSANSVCSFAWSGDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGSSGAGKSTIVQLLARFyeptggritvggedlRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYGLPDENVSKDDIIKAAKAANAHDFIISLPQVWLSKSHFVLLQPLLILMSYKLCLV
MPSSVSTRHSARFGLGGIFLYFTTLPLANPKTLDTTSSSLHVFALSTYPSSLSARGVFSTLEYSSLILSSMATAMATLPLFMRLPTPRRRALTKHTLPLTSPLRRSLAFPPLLRAKFNSEGTITCAYVSGPASDPIVSEPDPRINDSVSPSEKVHSPPNLITWGLLWSLFLKHKLRLGLSVLTLIGCTTCTLSMPIFSGRFFEVLIGARPEPLWKLLSKVGLLYALEPIFTVIFVMNMNTVWEKVMSIVKAQIFRRVLIQKAEFFDRYKVgelsglltsdlgslKALVSENISRDRGFRALSEVIGTICILFNIAPQLAPIlgvlvltvsvlvavYKRSTVPVFKAHGLAQASIADCVTETFSAIRTVRSFGGEKRQMLMFGRQVLAYQQSGIKLGTFKSLNESLTRIAIYISLLALYCLGGSKVKAGELSVGIVASFIGYTFTLTFAVQGLVNTFGDLRGTFAAVERINSILSTTEIDDALANGLERDIQQKHVEDENIKLFLFDGSNGKHQHLNMHYMSHLKSANSVCSFAWSGDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGSSGAGKSTIVQLLARFYEPTGGRITVGGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYGLPDENVSkddiikaakaanahdfiiSLPQVWLSKSHFVLLQPLLILMSYKLCLV
***********RFGLGGIFLYFTTLPLANPKTLDTTSSSLHVFALSTYPSSLSARGVFSTLEYSSLILSSMATAMATLPLFMRLPTPRRRALTKHTLPLTSPLRRSLAFPPLLRAKFNSEGTITCAYVS*****************************NLITWGLLWSLFLKHKLRLGLSVLTLIGCTTCTLSMPIFSGRFFEVLIGARPEPLWKLLSKVGLLYALEPIFTVIFVMNMNTVWEKVMSIVKAQIFRRVLIQKAEFFDRYKVGELSGLLTSDLGSLKALVSENISRDRGFRALSEVIGTICILFNIAPQLAPILGVLVLTVSVLVAVYKRSTVPVFKAHGLAQASIADCVTETFSAIRTVRSFGGEKRQMLMFGRQVLAYQQSGIKLGTFKSLNESLTRIAIYISLLALYCLGGSKVKAGELSVGIVASFIGYTFTLTFAVQGLVNTFGDLRGTFAAVERINSILSTTEIDDALANGLERDIQQKHVEDENIKLFLFDGSNGKHQHLNMHYMSHLKSANSVCSFAWSGDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGSSGAGKSTIVQLLARFYEPTGGRITVGGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYGLPDENVSKDDIIKAAKAANAHDFIISLPQVWLSKSHFVLLQPLLILMSYKLCL*
************FGLGGIFLYFTTLPLANPKTLDTTSSSLHVFA****************L*******************************************************************************************************LLWSLFLKHKLRLGLSVLTLIGCTTCTLSMPIFSGRFFEVLIGARPEPLWKLLSKVGLLYALEPIFTVIFVMNMNTVWEKVMSIVKAQIFRRVLIQKAEFFDRYKVGELSGLLTSDLGSLKALVSENISRDRGFRALSEVIGTICILFNIAPQLAPILGVLVLTVSVLVAVYKRSTVPVFKA*GLAQASIADCVTETFSAIRTVRSFGGEKRQMLMFGRQVLAYQQSGIKLGTFKSLNESLTRIAIYISLLALYCLGGSKVKAGELSVGIVASFIGYTFTLTFAVQGLVNTFGDLRGTFAAVERINSILSTTEIDDALANGLERDIQQKHVEDENIKLFLFDGSNGKHQHLNMHY**********CSFAWSGDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGSSGAGKSTIVQLLARFYEPTGGRITVGGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYGLPDENVSKDDIIKAAKAANAHDFIISLPQVWLSKSHFVLLQPLLILMSYKLCLV
*********SARFGLGGIFLYFTTLPLANPKTLDTTSSSLHVFALSTYPSSLSARGVFSTLEYSSLILSSMATAMATLPLFMRLPTPRRRALTKHTLPLTSPLRRSLAFPPLLRAKFNSEGTITCAYVSGPASDPIVSEPD**************SPPNLITWGLLWSLFLKHKLRLGLSVLTLIGCTTCTLSMPIFSGRFFEVLIGARPEPLWKLLSKVGLLYALEPIFTVIFVMNMNTVWEKVMSIVKAQIFRRVLIQKAEFFDRYKVGELSGLLTSDLGSLKALVSENISRDRGFRALSEVIGTICILFNIAPQLAPILGVLVLTVSVLVAVYKRSTVPVFKAHGLAQASIADCVTETFSAIRTVRSFGGEKRQMLMFGRQVLAYQQSGIKLGTFKSLNESLTRIAIYISLLALYCLGGSKVKAGELSVGIVASFIGYTFTLTFAVQGLVNTFGDLRGTFAAVERINSILSTTEIDDALANGLERDIQQKHVEDENIKLFLFDGSNGKHQHLNMHYMSHLKSANSVCSFAWSGDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGSSGAGKSTIVQLLARFYEPTGGRITVGGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYGLPDENVSKDDIIKAAKAANAHDFIISLPQVWLSKSHFVLLQPLLILMSYKLCLV
************FGLGGIFLYFTTLPLANPKTLDTTSSSLHVFALSTYPSSLSARGVFSTLEYSSLILSSMATAMATLPLFMRLPTPR********************************************************************PPNLITWGLLWSLFLKHKLRLGLSVLTLIGCTTCTLSMPIFSGRFFEVLIGARPEPLWKLLSKVGLLYALEPIFTVIFVMNMNTVWEKVMSIVKAQIFRRVLIQKAEFFDRYKVGELSGLLTSDLGSLKALVSENISRDRGFRALSEVIGTICILFNIAPQLAPILGVLVLTVSVLVAVYKRSTVPVFKAHGLAQASIADCVTETFSAIRTVRSFGGEKRQMLMFGRQVLAYQQSGIKLGTFKSLNESLTRIAIYISLLALYCLGGSKVKAGELSVGIVASFIGYTFTLTFAVQGLVNTFGDLRGTFAAVERINSILSTTEIDDALANGLERDIQQKHVEDENIKLFLFDGSNGKHQHLNMHYMSHLKSANSVCSFAWSGDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGSSGAGKSTIVQLLARFYEPTGGRITVGGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYGLPDENVSKDDIIKAAKAANAHDFIISLPQVWLSKSHFVLLQPLLILMSYKLC**
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSSVSTRHSARFGLGGIFLYFTTLPLANPKTLDTTSSSLHVFALSTYPSSLSARGVFSTLEYSSLILSSMATAMATLPLFMRLPTPRRRALTKHTLPLTSPLRRSLAFPPLLRAKFNSEGTITCAYVSGPASDPIVSEPDPRINDSVSPSEKVHSPPNLITWGLLWSLFLKHKLRLGLSVLTLIGCTTCTLSMPIFSGRFFEVLIGARPEPLWKLLSKVGLLYALEPIFTVIFVMNMNTVWEKVMSIVKAQIFRRVLIQKAEFFDRYKVGELSGLLTSDLGSLKALVSENISRDRGFRALSEVIGTICILFNIAPQLAPILGVLVLTVSVLVAVYKRSTVPVFKAHGLAQASIADCVTETFSAIRTVRSFGGEKRQMLMFGRQVLAYQQSGIKLGTFKSLNESLTRIAIYISLLALYCLGGSKVKAGELSVGIVASFIGYTFTLTFAVQGLVNTFGDLRGTFAAVERINSILSTTEIDDALANGLERDIQQKHVEDENIKLFLFDGSNGKHQHLNMHYMSHLKSANSVCSFAWSGDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGSSGAGKSTIVQLLARFYEPTGGRITVGGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYGLPDENVSKDDIIKAAKAANAHDFIISLPQVWLSKSHFVLLQPLLILMSYKLCLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query691 2.2.26 [Sep-21-2011]
Q8LPQ6714 ABC transporter B family yes no 0.798 0.773 0.733 0.0
Q5RKI8 714 ATP-binding cassette sub- yes no 0.698 0.676 0.278 4e-49
Q9CXJ4 717 ATP-binding cassette sub- yes no 0.667 0.642 0.275 8e-49
Q9JI39 715 ATP-binding cassette sub- no no 0.651 0.629 0.289 1e-45
P21448 1276 Multidrug resistance prot no no 0.523 0.283 0.310 4e-45
Q9NRK6738 ATP-binding cassette sub- yes no 0.652 0.611 0.285 6e-45
Q5RFQ9 718 ATP-binding cassette sub- no no 0.701 0.675 0.263 3e-44
Q9NUT2 735 ATP-binding cassette sub- no no 0.700 0.658 0.268 9e-44
P08183 1280 Multidrug resistance prot no no 0.534 0.288 0.301 2e-43
Q56A55714 ATP-binding cassette sub- yes no 0.696 0.673 0.272 2e-43
>sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 Back     alignment and function desciption
 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/567 (73%), Positives = 496/567 (87%), Gaps = 15/567 (2%)

Query: 100 TSPLRRSLAFPPLLRAKFNSEGTITCAYVSGPASDPIVSEPDPRINDSVSPSEKVHSPPN 159
           T+P R SL      RAK  S+G +  AYV+G  + PIV EPDP+I +S S +E      +
Sbjct: 47  TAPFRDSL------RAK--SDG-LARAYVTG--APPIVEEPDPKIEESKSEAES----KD 91

Query: 160 LITWGLLWSLFLKHKLRLGLSVLTLIGCTTCTLSMPIFSGRFFEVLIGARPEPLWKLLSK 219
           LI+WGLLWSL  KHKLRL + +LTL+GC+TCTLSMP+FSGRFFEVLIG RPEPLW+LLSK
Sbjct: 92  LISWGLLWSLMSKHKLRLSVCLLTLLGCSTCTLSMPVFSGRFFEVLIGVRPEPLWRLLSK 151

Query: 220 VGLLYALEPIFTVIFVMNMNTVWEKVMSIVKAQIFRRVLIQKAEFFDRYKVGELSGLLTS 279
           + +LY+LEPIFT+ FV NM  +WE VM+I++AQIFRRVLIQKAEFFD+YKVGEL+GLLTS
Sbjct: 152 IAVLYSLEPIFTIAFVTNMTAIWENVMAILRAQIFRRVLIQKAEFFDKYKVGELTGLLTS 211

Query: 280 DLGSLKALVSENISRDRGFRALSEVIGTICILFNIAPQLAPILGVLVLTVSVLVAVYKRS 339
           DLG+L ++V++NISRDRGFRA +EV GTICILF ++PQLAP+LG+L+L VSVLVAVYKRS
Sbjct: 212 DLGALNSIVNDNISRDRGFRAFTEVFGTICILFTLSPQLAPVLGLLMLAVSVLVAVYKRS 271

Query: 340 TVPVFKAHGLAQASIADCVTETFSAIRTVRSFGGEKRQMLMFGRQVLAYQQSGIKLGTFK 399
           TVPV+K+HGLAQA+++DCV+ETFSAIRTVRSF GEKRQM +FG Q+LAY+ SG+KLGTFK
Sbjct: 272 TVPVYKSHGLAQATMSDCVSETFSAIRTVRSFSGEKRQMSIFGSQILAYKLSGLKLGTFK 331

Query: 400 SLNESLTRIAIYISLLALYCLGGSKVKAGELSVGIVASFIGYTFTLTFAVQGLVNTFGDL 459
           S+NES+TR+A+YISLLALYCLGGSKVK GEL+VG V SFIGYTFTLTFAVQGLVNTFGDL
Sbjct: 332 SINESITRVAVYISLLALYCLGGSKVKTGELAVGTVVSFIGYTFTLTFAVQGLVNTFGDL 391

Query: 460 RGTFAAVERINSILSTTEIDDALANGLERDIQQKHVEDENIKLFLFDGSNGKHQHLNMHY 519
           RGTFAA++RINSIL+  +ID+ALA GLERDI  K V+DEN+KLFL  G N   +HL+ +Y
Sbjct: 392 RGTFAAIDRINSILNAVDIDEALAYGLERDIHTKKVQDENLKLFLSAGPNVNIRHLDKYY 451

Query: 520 MSHLKSANSVCSFAWSGDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGSSGAGK 579
           MS+LKS N++ +  W+GD+CL+DV+F+YPLRPDV +L+GL+LTL SG+VTALVGSSGAGK
Sbjct: 452 MSNLKSTNNLRTLTWAGDVCLDDVHFAYPLRPDVKVLDGLSLTLNSGTVTALVGSSGAGK 511

Query: 580 STIVQLLARFYEPTGGRITVGGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYGLP 639
           STIVQLLARFYEPT GRITVGGED+R FDKSEWA+VVSIVNQEPVLFS+SV ENIAYGLP
Sbjct: 512 STIVQLLARFYEPTQGRITVGGEDVRMFDKSEWAKVVSIVNQEPVLFSLSVAENIAYGLP 571

Query: 640 DENVSKDDIIKAAKAANAHDFIISLPQ 666
           +E+VSKDDIIKAAKAANAHDFIISLPQ
Sbjct: 572 NEHVSKDDIIKAAKAANAHDFIISLPQ 598

Arabidopsis thaliana (taxid: 3702)
>sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 Back     alignment and function description
>sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=2 SV=1 Back     alignment and function description
>sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=2 SV=1 Back     alignment and function description
>sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 Back     alignment and function description
>sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 Back     alignment and function description
>sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 Back     alignment and function description
>sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 Back     alignment and function description
>sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 Back     alignment and function description
>sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query691
359490406717 PREDICTED: ABC transporter B family memb 0.846 0.815 0.735 0.0
358345135728 ABC transporter B family member [Medicag 0.823 0.781 0.716 0.0
255539569712 ATNAP8, putative [Ricinus communis] gi|2 0.856 0.831 0.731 0.0
356530907710 PREDICTED: ABC transporter B family memb 0.768 0.747 0.767 0.0
30686893714 ABC transporter B family member 28 [Arab 0.798 0.773 0.733 0.0
51970298714 unnamed protein product [Arabidopsis tha 0.798 0.773 0.731 0.0
79325257618 ABC transporter B family member 28 [Arab 0.798 0.893 0.733 0.0
51968552614 unnamed protein product [Arabidopsis tha 0.798 0.899 0.731 0.0
297799448751 hypothetical protein ARALYDRAFT_492281 [ 0.798 0.735 0.679 0.0
147785289725 hypothetical protein VITISV_036650 [Viti 0.810 0.772 0.663 0.0
>gi|359490406|ref|XP_002280266.2| PREDICTED: ABC transporter B family member 28-like [Vitis vinifera] gi|297741119|emb|CBI31850.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/598 (73%), Positives = 505/598 (84%), Gaps = 13/598 (2%)

Query: 84  LPTPRRRALTKHTLPLTSPLR-----------RSLAFPPLLRAKFNSEGTIT--CAYVSG 130
           LP P R  LT+   P++   R            S  FPP    +  S+G +    AYVSG
Sbjct: 6   LPLPLRSHLTRLKPPISHAPRALACHVKLSHSHSNPFPPFSLLRSRSKGVVRPPSAYVSG 65

Query: 131 PASDPIVSEPDPRINDSVSPSEKVHSPPNLITWGLLWSLFLKHKLRLGLSVLTLIGCTTC 190
           PASDPI++EPDP++  S    ++   PP+ I+  LLWSL +++KLRL +S +TLIGC+ C
Sbjct: 66  PASDPIITEPDPKVESSNDAHDETVEPPSAISSSLLWSLLMRYKLRLAVSAVTLIGCSAC 125

Query: 191 TLSMPIFSGRFFEVLIGARPEPLWKLLSKVGLLYALEPIFTVIFVMNMNTVWEKVMSIVK 250
           TLSMP+FSGRFFEVLIG RPEPLW+LLS VG+LY LEP+ T+I+V+NMNT+WEKVMS ++
Sbjct: 126 TLSMPLFSGRFFEVLIGTRPEPLWRLLSTVGVLYTLEPVLTIIYVVNMNTIWEKVMSTLR 185

Query: 251 AQIFRRVLIQKAEFFDRYKVGELSGLLTSDLGSLKALVSENISRDRGFRALSEVIGTICI 310
           AQIFRR+LIQK EFFDRYKVGEL+ LLTSDLGSLK +VSENISRDRGFRALSEVIGTICI
Sbjct: 186 AQIFRRLLIQKVEFFDRYKVGELTALLTSDLGSLKDIVSENISRDRGFRALSEVIGTICI 245

Query: 311 LFNIAPQLAPILGVLVLTVSVLVAVYKRSTVPVFKAHGLAQASIADCVTETFSAIRTVRS 370
           LF +APQLAPILG+L+LTVSVLVAVYKRSTVPVFKAHGLAQASI+DC TETFSAIRTVRS
Sbjct: 246 LFTLAPQLAPILGILMLTVSVLVAVYKRSTVPVFKAHGLAQASISDCATETFSAIRTVRS 305

Query: 371 FGGEKRQMLMFGRQVLAYQQSGIKLGTFKSLNESLTRIAIYISLLALYCLGGSKVKAGEL 430
           F GEKRQM MFG QV+A+Q SGIKLGTFKSLNESLTR+A+YISL++LYCLGGSKVKAGEL
Sbjct: 306 FSGEKRQMSMFGSQVMAFQSSGIKLGTFKSLNESLTRVAVYISLMSLYCLGGSKVKAGEL 365

Query: 431 SVGIVASFIGYTFTLTFAVQGLVNTFGDLRGTFAAVERINSILSTTEIDDALANGLERDI 490
           SVG +ASFIGYTFTLTFAVQGLVNTFGDLRG+ AAVERINS+ S  +ID+ALA GLERDI
Sbjct: 366 SVGTIASFIGYTFTLTFAVQGLVNTFGDLRGSLAAVERINSVFSGGQIDEALAYGLERDI 425

Query: 491 QQKHVEDENIKLFLFDGSNGKHQHLNMHYMSHLKSANSVCSFAWSGDICLEDVYFSYPLR 550
           ++K V+DE + LF  +G   K+   N+HYMS L+SA++V S AWSGD+CLEDV+FSYPLR
Sbjct: 426 RRKEVDDEKLGLFFVNGFEEKNIFPNIHYMSALRSASNVHSLAWSGDVCLEDVHFSYPLR 485

Query: 551 PDVVILNGLNLTLKSGSVTALVGSSGAGKSTIVQLLARFYEPTGGRITVGGEDLRTFDKS 610
           PDV ILNGLNL LK G+VTALVGSSGAGKSTIVQLLARFYEP+ G ITV GED+RTFDKS
Sbjct: 486 PDVEILNGLNLRLKCGTVTALVGSSGAGKSTIVQLLARFYEPSRGCITVSGEDVRTFDKS 545

Query: 611 EWARVVSIVNQEPVLFSVSVGENIAYGLPDENVSKDDIIKAAKAANAHDFIISLPQVW 668
           EWARVVSIVNQEPVLFSVSVGENIAYGLPD NVSKDD+IKAAKAANAHDFIISLPQ +
Sbjct: 546 EWARVVSIVNQEPVLFSVSVGENIAYGLPDNNVSKDDVIKAAKAANAHDFIISLPQGY 603

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|358345135|ref|XP_003636638.1| ABC transporter B family member [Medicago truncatula] gi|355502573|gb|AES83776.1| ABC transporter B family member [Medicago truncatula] Back     alignment and taxonomy information
>gi|255539569|ref|XP_002510849.1| ATNAP8, putative [Ricinus communis] gi|223549964|gb|EEF51451.1| ATNAP8, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356530907|ref|XP_003534020.1| PREDICTED: ABC transporter B family member 28-like [Glycine max] Back     alignment and taxonomy information
>gi|30686893|ref|NP_194275.2| ABC transporter B family member 28 [Arabidopsis thaliana] gi|75330301|sp|Q8LPQ6.1|AB28B_ARATH RecName: Full=ABC transporter B family member 28; Short=ABC transporter ABCB.28; Short=AtABCB28; AltName: Full=Non-intrinsic ABC protein 8; AltName: Full=TAP-related protein 1 gi|20453197|gb|AAM19838.1| At4g25450/M7J2_180 [Arabidopsis thaliana] gi|51969114|dbj|BAD43249.1| unnamed protein product [Arabidopsis thaliana] gi|332659661|gb|AEE85061.1| ABC transporter B family member 28 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|51970298|dbj|BAD43841.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|79325257|ref|NP_001031714.1| ABC transporter B family member 28 [Arabidopsis thaliana] gi|332659662|gb|AEE85062.1| ABC transporter B family member 28 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|51968552|dbj|BAD42968.1| unnamed protein product [Arabidopsis thaliana] gi|51968974|dbj|BAD43179.1| unnamed protein product [Arabidopsis thaliana] gi|51971421|dbj|BAD44375.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297799448|ref|XP_002867608.1| hypothetical protein ARALYDRAFT_492281 [Arabidopsis lyrata subsp. lyrata] gi|297313444|gb|EFH43867.1| hypothetical protein ARALYDRAFT_492281 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|147785289|emb|CAN61922.1| hypothetical protein VITISV_036650 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query691
TAIR|locus:2131809714 ABCB28 "ATP-binding cassette B 0.804 0.778 0.659 6.1e-197
UNIPROTKB|Q69RG8690 P0473C09.107 "Putative ATP-bin 0.794 0.795 0.566 5e-163
RGD|1307655 714 Abcb8 "ATP-binding cassette, s 0.183 0.177 0.423 1.1e-35
UNIPROTKB|G3MYQ9 713 ABCB8 "Uncharacterized protein 0.150 0.145 0.495 3.4e-35
MGI|MGI:1351667 717 Abcb8 "ATP-binding cassette, s 0.150 0.145 0.476 5.4e-35
UNIPROTKB|I3LMV8 718 ABCB8 "Uncharacterized protein 0.150 0.144 0.504 5.7e-35
UNIPROTKB|E1BL88652 ABCB10 "Uncharacterized protei 0.150 0.159 0.490 1.3e-34
UNIPROTKB|E2RHJ0 713 ABCB8 "Uncharacterized protein 0.146 0.141 0.5 6.7e-34
UNIPROTKB|A5D8W3693 ABCB8 "ATP-binding cassette su 0.146 0.145 0.490 8.2e-34
UNIPROTKB|Q9NUT2 735 ABCB8 "ATP-binding cassette su 0.146 0.137 0.490 1e-33
TAIR|locus:2131809 ABCB28 "ATP-binding cassette B28" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1907 (676.4 bits), Expect = 6.1e-197, P = 6.1e-197
 Identities = 377/572 (65%), Positives = 454/572 (79%)

Query:    96 TLP-LTSPLRRSLAFPPLLRAKFNSEGTITCAYVSGPASDPIVSEPDPRINDSVSPSEKV 154
             +LP  T+P R SL      RAK  S+G +  AYV+G  + PIV EPDP+I +S S +E  
Sbjct:    42 SLPNSTAPFRDSL------RAK--SDG-LARAYVTG--APPIVEEPDPKIEESKSEAES- 89

Query:   155 HSPPNLITWGLLWSLFLKHKLRLGLSVLTLIGCTTCTLSMPIFSGRFFEVLIGARPEPLW 214
                 +LI+WGLLWSL  KHKLRL + +LTL+GC+TCTLSMP+FSGRFFEVLIG RPEPLW
Sbjct:    90 ---KDLISWGLLWSLMSKHKLRLSVCLLTLLGCSTCTLSMPVFSGRFFEVLIGVRPEPLW 146

Query:   215 KLLSKVGLLYALEPIFTVIFVMNMNTVWEKVMSIVKAQIFRRVLIQKAEFFDRYKVXXXX 274
             +LLSK+ +LY+LEPIFT+ FV NM  +WE VM+I++AQIFRRVLIQKAEFFD+YKV    
Sbjct:   147 RLLSKIAVLYSLEPIFTIAFVTNMTAIWENVMAILRAQIFRRVLIQKAEFFDKYKVGELT 206

Query:   275 XXXXXXXXXXKALVSENISRDRGFRALSEVIGTICILFNIAPQLAPIXXXXXXXXXXXXX 334
                        ++V++NISRDRGFRA +EV GTICILF ++PQLAP+             
Sbjct:   207 GLLTSDLGALNSIVNDNISRDRGFRAFTEVFGTICILFTLSPQLAPVLGLLMLAVSVLVA 266

Query:   335 XYKRSTVPVFKAHGLAQASIADCVTETFSAIRTVRSFGGEKRQMLMFGRQVLAYQQSGIK 394
              YKRSTVPV+K+HGLAQA+++DCV+ETFSAIRTVRSF GEKRQM +FG Q+LAY+ SG+K
Sbjct:   267 VYKRSTVPVYKSHGLAQATMSDCVSETFSAIRTVRSFSGEKRQMSIFGSQILAYKLSGLK 326

Query:   395 LGTFKSLNESLTRIAIYISLLALYCLGGSKVKAGELSVGIVASFIGYTFTLTFAVQGLVN 454
             LGTFKS+NES+TR+A+YISLLALYCLGGSKVK GEL+VG V SFIGYTFTLTFAVQGLVN
Sbjct:   327 LGTFKSINESITRVAVYISLLALYCLGGSKVKTGELAVGTVVSFIGYTFTLTFAVQGLVN 386

Query:   455 TFGDLRGTFAAVERINSILSTTEIDDALANGLERDIQQKHVEDENIKLFLFDGSNGKHQH 514
             TFGDLRGTFAA++RINSIL+  +ID+ALA GLERDI  K V+DEN+KLFL  G N   +H
Sbjct:   387 TFGDLRGTFAAIDRINSILNAVDIDEALAYGLERDIHTKKVQDENLKLFLSAGPNVNIRH 446

Query:   515 LNMHYMSHLKSANSVCSFAWSGDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGS 574
             L+ +YMS+LKS N++ +  W+GD+CL+DV+F+YPLRPDV +L+GL+LTL SG+VTALVGS
Sbjct:   447 LDKYYMSNLKSTNNLRTLTWAGDVCLDDVHFAYPLRPDVKVLDGLSLTLNSGTVTALVGS 506

Query:   575 SGAGKSTIVQLLARFYEPTGGRITVGGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENI 634
             SGAGKSTIVQLLARFYEPT GRITVGGED+R FDKSEWA+VVSIVNQEPVLFS+SV ENI
Sbjct:   507 SGAGKSTIVQLLARFYEPTQGRITVGGEDVRMFDKSEWAKVVSIVNQEPVLFSLSVAENI 566

Query:   635 AYGLPDENVSXXXXXXXXXXXXXXXXXXSLPQ 666
             AYGLP+E+VS                  SLPQ
Sbjct:   567 AYGLPNEHVSKDDIIKAAKAANAHDFIISLPQ 598
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005215 "transporter activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IBA
GO:0006200 "ATP catabolic process" evidence=IBA
GO:0006810 "transport" evidence=IEA
GO:0015421 "oligopeptide-transporting ATPase activity" evidence=IBA
GO:0016021 "integral to membrane" evidence=IEA;IBA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0035672 "oligopeptide transmembrane transport" evidence=IBA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=IEA;ISS
GO:0055085 "transmembrane transport" evidence=IEA;IBA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
UNIPROTKB|Q69RG8 P0473C09.107 "Putative ATP-binding cassette, sub-family B, member 10" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
RGD|1307655 Abcb8 "ATP-binding cassette, subfamily B (MDR/TAP), member 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3MYQ9 ABCB8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1351667 Abcb8 "ATP-binding cassette, sub-family B (MDR/TAP), member 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3LMV8 ABCB8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BL88 ABCB10 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHJ0 ABCB8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A5D8W3 ABCB8 "ATP-binding cassette sub-family B member 8, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NUT2 ABCB8 "ATP-binding cassette sub-family B member 8, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LPQ6AB28B_ARATHNo assigned EC number0.73360.79880.7731yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query691
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 6e-82
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 6e-61
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 1e-57
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 2e-52
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 3e-50
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 7e-41
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 7e-41
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 1e-40
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 4e-38
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 9e-38
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 1e-35
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 8e-34
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 1e-30
COG5265497 COG5265, ATM1, ABC-type transport system involved 3e-29
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 8e-29
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 4e-28
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 4e-28
PRK13657 588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 1e-27
COG4987573 COG4987, CydC, ABC-type transport system involved 1e-27
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 1e-26
COG4988559 COG4988, CydD, ABC-type transport system involved 4e-26
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 7e-26
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 3e-25
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 1e-24
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 2e-24
PRK10789 569 PRK10789, PRK10789, putative multidrug transporter 1e-23
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 9e-23
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 7e-22
TIGR01192 585 TIGR01192, chvA, glucan exporter ATP-binding prote 1e-21
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 2e-21
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 4e-20
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 6e-20
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 9e-20
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 2e-19
COG3839 338 COG3839, MalK, ABC-type sugar transport systems, A 4e-19
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 4e-19
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine tran 9e-19
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 2e-18
COG1120 258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 5e-18
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 6e-18
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 6e-18
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 2e-17
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-17
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 3e-17
COG1135 339 COG1135, AbcC, ABC-type metal ion transport system 3e-17
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 4e-17
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 6e-17
COG1131 293 COG1131, CcmA, ABC-type multidrug transport system 1e-16
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 1e-16
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 5e-16
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 9e-16
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 1e-15
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 1e-15
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 1e-15
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 1e-15
PRK11432 351 PRK11432, fbpC, ferric transporter ATP-binding sub 3e-15
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 4e-15
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 6e-15
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 6e-15
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 2e-14
COG1118 345 COG1118, CysA, ABC-type sulfate/molybdate transpor 2e-14
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 3e-14
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 5e-14
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 5e-14
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 5e-14
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 6e-14
COG1125 309 COG1125, OpuBA, ABC-type proline/glycine betaine t 7e-14
PRK13636 283 PRK13636, cbiO, cobalt transporter ATP-binding sub 1e-13
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 1e-13
PRK10790 592 PRK10790, PRK10790, putative multidrug transporter 1e-13
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 2e-13
PRK11153 343 PRK11153, metN, DL-methionine transporter ATP-bind 3e-13
PRK13639 275 PRK13639, cbiO, cobalt transporter ATP-binding sub 3e-13
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 4e-13
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 4e-13
PRK11231 255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 5e-13
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 8e-13
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 8e-13
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 9e-13
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transpor 1e-12
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 1e-12
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 1e-12
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine tr 1e-12
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter 2e-12
PRK13548 258 PRK13548, hmuV, hemin importer ATP-binding subunit 2e-12
COG1117253 COG1117, PstB, ABC-type phosphate transport system 3e-12
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 3e-12
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 4e-12
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 4e-12
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 4e-12
PRK13634 290 PRK13634, cbiO, cobalt transporter ATP-binding sub 4e-12
COG4608 268 COG4608, AppF, ABC-type oligopeptide transport sys 5e-12
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 6e-12
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 6e-12
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 7e-12
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding 8e-12
PRK13632 271 PRK13632, cbiO, cobalt transporter ATP-binding sub 8e-12
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 8e-12
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 9e-12
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 9e-12
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 9e-12
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 1e-11
PRK13649 280 PRK13649, cbiO, cobalt transporter ATP-binding sub 1e-11
COG4559 259 COG4559, COG4559, ABC-type hemin transport system, 1e-11
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 1e-11
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 2e-11
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 2e-11
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 3e-11
COG4525 259 COG4525, TauB, ABC-type taurine transport system, 3e-11
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 8e-11
PRK10575 265 PRK10575, PRK10575, iron-hydroxamate transporter A 8e-11
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 9e-11
PRK13647 274 PRK13647, cbiO, cobalt transporter ATP-binding sub 1e-10
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 1e-10
PRK13637 287 PRK13637, cbiO, cobalt transporter ATP-binding sub 1e-10
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 1e-10
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 2e-10
PRK13642 277 PRK13642, cbiO, cobalt transporter ATP-binding sub 2e-10
TIGR03873 256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 2e-10
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 2e-10
COG1123539 COG1123, COG1123, ATPase components of various ABC 3e-10
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 3e-10
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 3e-10
PRK13640 282 PRK13640, cbiO, cobalt transporter ATP-binding sub 3e-10
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 4e-10
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 4e-10
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 5e-10
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 6e-10
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 7e-10
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 7e-10
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 7e-10
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 7e-10
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 7e-10
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 8e-10
pfam00005119 pfam00005, ABC_tran, ABC transporter 9e-10
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 1e-09
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 1e-09
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 1e-09
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 2e-09
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 2e-09
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 2e-09
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 2e-09
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 2e-09
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-bindi 2e-09
PRK10419 268 PRK10419, nikE, nickel transporter ATP-binding pro 2e-09
COG0444 316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 2e-09
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 3e-09
COG1101 263 COG1101, PhnK, ABC-type uncharacterized transport 3e-09
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transpo 3e-09
COG1123 539 COG1123, COG1123, ATPase components of various ABC 4e-09
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 4e-09
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 4e-09
PRK13635 279 PRK13635, cbiO, cobalt transporter ATP-binding sub 4e-09
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 4e-09
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 4e-09
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 5e-09
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 6e-09
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 7e-09
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase compon 7e-09
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 7e-09
PRK11308 327 PRK11308, dppF, dipeptide transporter ATP-binding 8e-09
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 9e-09
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 1e-08
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 1e-08
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 1e-08
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 2e-08
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 2e-08
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 2e-08
TIGR02314 343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 2e-08
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 2e-08
TIGR01187 325 TIGR01187, potA, spermidine/putrescine ABC transpo 2e-08
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 2e-08
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding 2e-08
TIGR02142 354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 2e-08
PRK13652 277 PRK13652, cbiO, cobalt transporter ATP-binding sub 2e-08
PRK14264 305 PRK14264, PRK14264, phosphate ABC transporter ATP- 3e-08
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 3e-08
PRK11650 356 PRK11650, ugpC, glycerol-3-phosphate transporter A 3e-08
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-bind 4e-08
PRK11248 255 PRK11248, tauB, taurine transporter ATP-binding su 5e-08
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 6e-08
PRK11000 369 PRK11000, PRK11000, maltose/maltodextrin transport 6e-08
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 6e-08
cd03234226 cd03234, ABCG_White, White pigment protein homolog 6e-08
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; 7e-08
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 7e-08
PRK10851 353 PRK10851, PRK10851, sulfate/thiosulfate transporte 7e-08
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 7e-08
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 8e-08
PRK11831 269 PRK11831, PRK11831, putative ABC transporter ATP-b 9e-08
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 1e-07
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 1e-07
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 1e-07
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 1e-07
PRK13644 274 PRK13644, cbiO, cobalt transporter ATP-binding sub 1e-07
TIGR01188 302 TIGR01188, drrA, daunorubicin resistance ABC trans 2e-07
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 2e-07
COG4598256 COG4598, HisP, ABC-type histidine transport system 2e-07
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 2e-07
PRK13645 289 PRK13645, cbiO, cobalt transporter ATP-binding sub 2e-07
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 2e-07
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 3e-07
COG4167 267 COG4167, SapF, ABC-type antimicrobial peptide tran 3e-07
COG4152 300 COG4152, COG4152, ABC-type uncharacterized transpo 3e-07
PRK13643 288 PRK13643, cbiO, cobalt transporter ATP-binding sub 4e-07
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside t 4e-07
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 4e-07
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 5e-07
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 5e-07
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 5e-07
PRK13641 287 PRK13641, cbiO, cobalt transporter ATP-binding sub 6e-07
PRK13547 272 PRK13547, hmuV, hemin importer ATP-binding subunit 7e-07
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 7e-07
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 8e-07
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 9e-07
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 1e-06
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 1e-06
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 1e-06
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 2e-06
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP bindi 2e-06
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 2e-06
PRK13638 271 PRK13638, cbiO, cobalt transporter ATP-binding sub 2e-06
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 2e-06
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 2e-06
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 3e-06
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter AT 3e-06
PRK13650 279 PRK13650, cbiO, cobalt transporter ATP-binding sub 3e-06
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 4e-06
PRK10253 265 PRK10253, PRK10253, iron-enterobactin transporter 5e-06
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 5e-06
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 5e-06
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 5e-06
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 5e-06
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 6e-06
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 7e-06
COG4148 352 COG4148, ModC, ABC-type molybdate transport system 7e-06
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 8e-06
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 8e-06
PRK15079 331 PRK15079, PRK15079, oligopeptide ABC transporter A 8e-06
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 9e-06
COG0488530 COG0488, Uup, ATPase components of ABC transporter 1e-05
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 1e-05
COG4133209 COG4133, CcmA, ABC-type transport system involved 1e-05
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 2e-05
PRK13646 286 PRK13646, cbiO, cobalt transporter ATP-binding sub 2e-05
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 2e-05
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 3e-05
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 3e-05
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 3e-05
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 3e-05
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 3e-05
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 3e-05
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 4e-05
PRK10619 257 PRK10619, PRK10619, histidine/lysine/arginine/orni 4e-05
TIGR01288 303 TIGR01288, nodI, ATP-binding ABC transporter famil 4e-05
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 4e-05
PRK13648 269 PRK13648, cbiO, cobalt transporter ATP-binding sub 4e-05
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 5e-05
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 6e-05
PRK13536 340 PRK13536, PRK13536, nodulation factor exporter sub 6e-05
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-bi 7e-05
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 7e-05
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 8e-05
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 9e-05
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 1e-04
PRK11144 352 PRK11144, modC, molybdate transporter ATP-binding 1e-04
COG4586 325 COG4586, COG4586, ABC-type uncharacterized transpo 1e-04
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 1e-04
PRK10636 638 PRK10636, PRK10636, putative ABC transporter ATP-b 1e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-04
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 1e-04
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 2e-04
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 2e-04
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding pro 2e-04
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 2e-04
PRK03695 248 PRK03695, PRK03695, vitamin B12-transporter ATPase 2e-04
PRK15112 267 PRK15112, PRK15112, antimicrobial peptide ABC syst 3e-04
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 3e-04
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 3e-04
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 4e-04
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 4e-04
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 6e-04
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase compone 7e-04
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Prov 8e-04
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 8e-04
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 8e-04
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 9e-04
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 0.001
TIGR03005 252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 0.001
TIGR03415 382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 0.001
TIGR03522 301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 0.001
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding pr 0.001
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 0.001
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 0.002
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 0.002
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 0.002
cd03289 275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 0.002
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 0.002
cd03291 282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 0.002
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 0.003
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 0.003
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 0.003
cd01854211 cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y 0.003
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 0.004
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 0.004
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information 
 Score =  270 bits (691), Expect = 6e-82
 Identities = 136/507 (26%), Positives = 245/507 (48%), Gaps = 54/507 (10%)

Query: 160 LITWGLLWSLFLKHKLRLGLSVLTLIGCTTCTLSMPIFSGRFFEVLIGARPEPLWKLLSK 219
           L     L   +LK+KL L   +L L+     +L +P+  GR  + L+      L +LL  
Sbjct: 1   LSLLRRLLK-YLKYKLLLLAILLLLLS-ALLSLLLPLLIGRIIDALLADL-GELLELLLL 57

Query: 220 VGLLYALEPIFTVIFVMNMNTVWEKVMSIVKAQIFRRVLIQKAEFFDRYKVGELSGLLTS 279
           + LL  L  +   +     + + +K+++ ++  +F ++L     FFD+ K G+L   LT+
Sbjct: 58  LLLLALLGGVLRALQSYLGSRLGQKIVADLRRDLFEKLLRLPLSFFDKAKSGDLISRLTN 117

Query: 280 DLGSLKALVSENISRDRGFRALSEVIGTICILFNIAPQLAPILGVLVLTVSVLVAVYKRS 339
           D+ ++  LVS  +     F ++  +IG++ +LF+++ +LA IL +++  +++++++  R 
Sbjct: 118 DVEAVSNLVSTVL--VLVFTSILLLIGSLVLLFSLSWRLALILLLILPLLALVLSLLARK 175

Query: 340 TVPVFKAHGLAQASIADCVTETFSAIRTVRSFGGEKRQMLMFGRQVLAYQQSGIKLGTFK 399
           +  + +    A   +   + E+ S IR +++FG E R++  F       +++ ++    +
Sbjct: 176 SRKLSRRVREALGELNARLLESLSGIRVIKAFGAEDRELKRFEEANEELRRANLRASRLE 235

Query: 400 SLNESLTRIAIYISLLALYCLGGSKVKAGELSVGIVASFIGYTFTLTFAVQGLVNTFGDL 459
           +L   L  +   +  + +  LGG  V +G L+VG +A+FI Y   L   +  L      L
Sbjct: 236 ALLAPLMLLLSSLGTVLVLALGGFLVLSGSLTVGALAAFILYLLRLLTPILQLGEVVSLL 295

Query: 460 RGTFAAVERINSILSTTEIDDALANGLERDIQQKHVEDENIKLFLFDGSNGKHQHLNMHY 519
           +   AA ER+  +L                     VED    L                 
Sbjct: 296 QRASAAAERLFELLDEEPE----------------VEDPPDPLKDTI------------- 326

Query: 520 MSHLKSANSVCSFAWSGDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGSSGAGK 579
                           G I  E+V FSYP      +L  ++ +++ G   A+VG SG+GK
Sbjct: 327 ----------------GSIEFENVSFSYP--GKKPVLKDISFSIEPGEKVAIVGPSGSGK 368

Query: 580 STIVQLLARFYEPTGGRITVGGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYGLP 639
           ST+++LL R Y+PT G I + G D+R        + + IV+Q+P+LFS ++ ENIA G P
Sbjct: 369 STLIKLLLRLYDPTSGEILIDGIDIRDISLDSLRKRIGIVSQDPLLFSGTIRENIALGRP 428

Query: 640 DENVSKDDIIKAAKAANAHDFIISLPQ 666
           D   + ++I +A K ANAH+FI +LP 
Sbjct: 429 D--ATDEEIEEALKLANAHEFIANLPD 453

Length = 567
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 691
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PRK10790 592 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
TIGR01192 585 chvA glucan exporter ATP-binding protein. This mod 100.0
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
PRK10789 569 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
KOG0056 790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PTZ00243 1560 ABC transporter; Provisional 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 100.0
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PTZ00243 1560 ABC transporter; Provisional 100.0
KOG0054 1381 consensus Multidrug resistance-associated protein/ 100.0
COG4615546 PvdE ABC-type siderophore export system, fused ATP 100.0
COG4178604 ABC-type uncharacterized transport system, permeas 99.97
PF00664275 ABC_membrane: ABC transporter transmembrane region 99.94
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.94
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.92
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 99.92
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.91
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 99.91
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.91
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.91
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.91
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.91
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.9
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.9
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.9
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.9
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.9
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.9
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.89
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.89
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.89
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.89
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.89
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.89
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.88
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.88
PRK13647 274 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.88
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.88
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.88
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.88
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 99.88
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.87
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.87
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.87
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
COG1127263 Ttg2A ABC-type transport system involved in resist 99.87
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.87
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.87
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.87
PRK13642 277 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.87
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.87
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.87
PRK13640 282 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK10908222 cell division protein FtsE; Provisional 99.87
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.87
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.87
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.87
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.86
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.86
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 99.86
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.86
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.86
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.86
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 99.86
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.86
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.86
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.86
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.86
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.86
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 99.86
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.86
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.86
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.86
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 99.86
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 99.86
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 99.86
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.86
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.86
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.86
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.86
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.86
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provi 99.86
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.86
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.86
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.85
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.85
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.85
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.85
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.85
PRK13633 280 cobalt transporter ATP-binding subunit; Provisiona 99.85
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.85
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.85
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 99.85
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.85
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.85
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.85
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.85
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.85
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 99.85
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.85
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.85
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.85
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.85
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 99.85
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.85
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.85
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 99.85
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.85
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.85
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.85
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.85
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.85
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 99.85
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.85
cd03246173 ABCC_Protease_Secretion This family represents the 99.85
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 99.85
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 99.85
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.84
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.84
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.84
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.84
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.84
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provi 99.84
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.84
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.84
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.84
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.84
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; 99.84
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.84
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.84
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.84
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 99.84
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 99.84
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.84
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.84
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.84
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.84
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.84
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.84
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 99.84
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.84
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.84
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 99.84
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.84
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.83
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.83
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.83
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.83
COG4619223 ABC-type uncharacterized transport system, ATPase 99.83
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.83
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.83
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.83
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK13547 272 hmuV hemin importer ATP-binding subunit; Provision 99.83
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.83
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.83
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.83
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.83
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.83
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.83
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.83
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.83
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 99.83
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.83
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.83
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 99.83
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK13537 306 nodulation ABC transporter NodI; Provisional 99.83
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.83
cd03291 282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.83
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 99.83
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.82
cd03234226 ABCG_White The White subfamily represents ABC tran 99.82
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 99.82
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.82
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.82
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 99.82
PRK09984262 phosphonate/organophosphate ester transporter subu 99.82
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.82
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.82
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.82
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.82
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.82
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.81
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.81
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.81
PRK13536 340 nodulation factor exporter subunit NodI; Provision 99.81
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 99.81
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.81
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.81
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.81
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.81
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.8
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.8
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.8
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.8
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 99.8
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.8
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.8
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 99.79
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Pr 99.79
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.79
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.79
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.79
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 99.79
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.78
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.78
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.78
PRK09544 251 znuC high-affinity zinc transporter ATPase; Review 99.78
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.78
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 99.78
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 99.78
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.78
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.77
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.77
COG4559259 ABC-type hemin transport system, ATPase component 99.77
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.77
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.77
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.77
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.77
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.77
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.77
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.76
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 99.76
PRK09473 330 oppD oligopeptide transporter ATP-binding componen 99.76
COG0410237 LivF ABC-type branched-chain amino acid transport 99.76
KOG0064 728 consensus Peroxisomal long-chain acyl-CoA transpor 99.76
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.76
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.75
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.75
PRK10938 490 putative molybdenum transport ATP-binding protein 99.74
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.74
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.74
COG0411250 LivG ABC-type branched-chain amino acid transport 99.74
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.74
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.74
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.74
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.74
COG4136213 ABC-type uncharacterized transport system, ATPase 99.74
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.74
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 99.73
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.73
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.73
COG4181228 Predicted ABC-type transport system involved in ly 99.73
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.72
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 99.72
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.72
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.71
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.71
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.71
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.71
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.7
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.7
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.7
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.7
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.7
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.68
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.68
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.68
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.68
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.68
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.68
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.67
PLN03211 659 ABC transporter G-25; Provisional 99.67
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.67
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.66
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.66
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.66
PRK10938490 putative molybdenum transport ATP-binding protein 99.65
cd03237 246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.65
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.65
COG4133209 CcmA ABC-type transport system involved in cytochr 99.64
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.64
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.64
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.64
COG1123539 ATPase components of various ABC-type transport sy 99.64
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.63
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.62
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 99.62
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.61
COG0444 316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.61
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.61
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.61
COG4148 352 ModC ABC-type molybdate transport system, ATPase c 99.61
PRK11147 635 ABC transporter ATPase component; Reviewed 99.61
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.61
PLN03140 1470 ABC transporter G family member; Provisional 99.58
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.58
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.57
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.57
COG1123 539 ATPase components of various ABC-type transport sy 99.56
COG1101 263 PhnK ABC-type uncharacterized transport system, AT 99.56
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.55
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.55
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.54
PLN03073718 ABC transporter F family; Provisional 99.54
PRK13409 590 putative ATPase RIL; Provisional 99.53
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.52
COG4152 300 ABC-type uncharacterized transport system, ATPase 99.52
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.52
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.51
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 99.5
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.5
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.48
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.48
COG4172534 ABC-type uncharacterized transport system, duplica 99.48
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.48
PRK13409 590 putative ATPase RIL; Provisional 99.47
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 99.45
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.44
PRK11147 635 ABC transporter ATPase component; Reviewed 99.44
COG0488 530 Uup ATPase components of ABC transporters with dup 99.43
PLN03140 1470 ABC transporter G family member; Provisional 99.41
COG0488530 Uup ATPase components of ABC transporters with dup 99.33
PLN03073 718 ABC transporter F family; Provisional 99.31
COG4172 534 ABC-type uncharacterized transport system, duplica 99.29
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.27
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.26
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.22
KOG0059 885 consensus Lipid exporter ABCA1 and related protein 99.18
COG4586 325 ABC-type uncharacterized transport system, ATPase 99.16
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 99.1
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 99.1
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.08
PRK11098409 microcin B17 transporter; Reviewed 99.03
PRK12369326 putative transporter; Reviewed 99.01
PF06472281 ABC_membrane_2: ABC transporter transmembrane regi 99.0
TIGR00767 415 rho transcription termination factor Rho. Members 98.94
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 98.92
PRK00300205 gmk guanylate kinase; Provisional 98.91
KOG2355 291 consensus Predicted ABC-type transport, ATPase com 98.91
KOG0927614 consensus Predicted transporter (ABC superfamily) 98.88
PF13748237 ABC_membrane_3: ABC transporter transmembrane regi 98.85
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.82
COG3845501 ABC-type uncharacterized transport systems, ATPase 98.8
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 98.79
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 98.75
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 98.73
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 98.69
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 98.68
PRK01889356 GTPase RsgA; Reviewed 98.67
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 98.63
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 98.59
PRK07196 434 fliI flagellum-specific ATP synthase; Validated 98.59
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 98.59
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 98.55
PRK07721 438 fliI flagellum-specific ATP synthase; Validated 98.54
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 98.51
COG4170 330 SapD ABC-type antimicrobial peptide transport syst 98.51
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 98.5
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 98.49
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 98.49
PRK08149 428 ATP synthase SpaL; Validated 98.47
COG1129500 MglA ABC-type sugar transport system, ATPase compo 98.42
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 98.37
PRK09825176 idnK D-gluconate kinase; Provisional 98.35
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 98.35
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.33
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 98.32
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 98.31
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.29
PLN02796 347 D-glycerate 3-kinase 98.24
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.22
PRK15494 339 era GTPase Era; Provisional 98.2
PRK06315 442 type III secretion system ATPase; Provisional 98.18
PRK05480209 uridine/cytidine kinase; Provisional 98.15
TIGR03497 413 FliI_clade2 flagellar protein export ATPase FliI. 98.13
TIGR00235207 udk uridine kinase. Model contains a number of lon 98.11
PRK03846198 adenylylsulfate kinase; Provisional 98.11
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 98.03
KOG0927 614 consensus Predicted transporter (ABC superfamily) 98.02
KOG0062 582 consensus ATPase component of ABC transporters wit 97.95
cd01136 326 ATPase_flagellum-secretory_path_III Flagellum-spec 97.94
KOG0062582 consensus ATPase component of ABC transporters wit 97.94
TIGR02546 422 III_secr_ATP type III secretion apparatus H+-trans 97.93
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 97.93
PRK07594 433 type III secretion system ATPase SsaN; Validated 97.91
PRK09862 506 putative ATP-dependent protease; Provisional 97.9
PRK10416318 signal recognition particle-docking protein FtsY; 97.89
PRK09270229 nucleoside triphosphate hydrolase domain-containin 97.87
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 97.87
PRK07960 455 fliI flagellum-specific ATP synthase; Validated 97.85
PF05992315 SbmA_BacA: SbmA/BacA-like family; InterPro: IPR009 97.84
PRK05688 451 fliI flagellum-specific ATP synthase; Validated 97.84
PLN02318 656 phosphoribulokinase/uridine kinase 97.82
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 97.81
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 97.81
PRK07261171 topology modulation protein; Provisional 97.8
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 97.79
PRK00023225 cmk cytidylate kinase; Provisional 97.77
PRK05922 434 type III secretion system ATPase; Validated 97.77
PF1355562 AAA_29: P-loop containing region of AAA domain 97.77
PRK09099 441 type III secretion system ATPase; Provisional 97.77
cd02026 273 PRK Phosphoribulokinase (PRK) is an enzyme involve 97.77
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 97.74
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 97.72
TIGR00101199 ureG urease accessory protein UreG. This model rep 97.72
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. 97.71
PRK08472 434 fliI flagellum-specific ATP synthase; Validated 97.71
TIGR01026 440 fliI_yscN ATPase FliI/YscN family. This family of 97.71
PRK00635 1809 excinuclease ABC subunit A; Provisional 97.7
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 97.69
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 97.69
PLN03046 460 D-glycerate 3-kinase; Provisional 97.65
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 97.64
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.64
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 97.6
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 97.59
TIGR03496 411 FliI_clade1 flagellar protein export ATPase FliI. 97.59
PRK14530 215 adenylate kinase; Provisional 97.55
PRK00098298 GTPase RsgA; Reviewed 97.55
PTZ00035337 Rad51 protein; Provisional 97.54
PRK13851344 type IV secretion system protein VirB11; Provision 97.53
PRK00635 1809 excinuclease ABC subunit A; Provisional 97.52
PRK14738206 gmk guanylate kinase; Provisional 97.5
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 97.49
PRK11545163 gntK gluconate kinase 1; Provisional 97.48
PRK05541176 adenylylsulfate kinase; Provisional 97.46
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 97.45
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 97.45
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 97.44
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.42
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.42
PRK08972 444 fliI flagellum-specific ATP synthase; Validated 97.41
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 97.39
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 97.39
PRK00889175 adenylylsulfate kinase; Provisional 97.38
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 97.38
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.38
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.37
PRK06820 440 type III secretion system ATPase; Validated 97.36
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.35
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 97.33
PRK06936 439 type III secretion system ATPase; Provisional 97.3
PRK07429 327 phosphoribulokinase; Provisional 97.28
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 97.24
PLN02165 334 adenylate isopentenyltransferase 97.24
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 97.23
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.22
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 97.21
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.15
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 97.14
PRK09183259 transposase/IS protein; Provisional 97.13
PRK14737186 gmk guanylate kinase; Provisional 97.12
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 97.11
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 97.1
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 97.09
PRK09087226 hypothetical protein; Validated 97.08
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=9.7e-81  Score=688.00  Aligned_cols=465  Identities=30%  Similarity=0.450  Sum_probs=423.0

Q ss_pred             hhHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc-CCC-chHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 005561          161 ITWGLLWSLFLKHKLRLGLSVLTLIGCTTCTLSMPIFSGRFFEVLIG-ARP-EPLWKLLSKVGLLYALEPIFTVIFVMNM  238 (691)
Q Consensus       161 ~~~~~l~~~~~~~~~~~~~~ll~~l~~~~~~l~~P~~~~~iiD~l~~-~~~-~~l~~~l~~~~~~~~~~~~~~~~~~~~~  238 (691)
                      ..+++++.+.+++++++..+.+++++..+..++.|.++++++|.+.. .+. ..+......+.+++++.+++..++..++
T Consensus       133 ~~~~rl~~l~~~~~~~l~~a~~~l~vss~~~~~iP~~~G~~id~~~~~~~~~~~~~~~~~~l~~l~~~~a~~~~~r~~~~  212 (716)
T KOG0058|consen  133 TLLKRLLGLLKPEWKWLVAAFVLLLVSSLINMFIPYYLGKLIDTISEGDDSADALKRACTILLGLFLIGALANAIRGGLL  212 (716)
T ss_pred             hHHHHHHHHhchhHHHHHHHHHHHHHHHhhcchhhHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35778899999999999999999999999999999999999999875 222 2344555666777788888889999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHcCChhhhcccChhHHHHHHHhhHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHhHHH
Q 005561          239 NTVWEKVMSIVKAQIFRRVLIQKAEFFDRYKVGELSGLLTSDLGSLKALVSENISRDRGFRALSEVIGTICILFNIAPQL  318 (691)
Q Consensus       239 ~~~~~~~~~~LR~~lf~~ll~lp~~~f~~~~~G~l~srlt~Dv~~i~~~~~~~i~~~~~~~~i~~~i~~li~l~~is~~L  318 (691)
                      ...++++..++|.++|+++++++++|||++++||++||+++|+..+.+.+...+.  .++++.+..++.+++|+++||+|
T Consensus       213 ~~a~~rv~~rlR~~lF~sil~QdiaFFD~nktGeL~SRLtsD~~~vs~svs~nls--~~lR~~~~~~g~~~~M~~~S~~L  290 (716)
T KOG0058|consen  213 QYAGERVVARLRTDLFRSLLRQDIAFFDENKTGELISRLTSDTQIVSNSVSQNLS--DGLRNLVQGFGGLGFMFSLSWRL  290 (716)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhhhhccCCccHHHhhhhhhHHHHHHHHHHHHH--HHHHHHHHHHHhHHHHhhhhHHH
Confidence            9999999999999999999999999999999999999999999999999998886  47899999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHchHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHHHH
Q 005561          319 APILGVLVLTVSVLVAVYKRSTVPVFKAHGLAQASIADCVTETFSAIRTVRSFGGEKRQMLMFGRQVLAYQQSGIKLGTF  398 (691)
Q Consensus       319 ~lil~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~l~gi~tIKa~~~E~~~~~~~~~~~~~~~~~~~k~~~~  398 (691)
                      +++.++.++++.++..+|.+..++..++.+++.++.++...|.+++++|||+|+.|+.+.+||.+..++..+...|....
T Consensus       291 tlv~~i~~P~v~~~~~~yG~~~rklS~~~Q~a~A~a~~vaeE~ls~~rTVRsfa~E~~E~~ry~~~l~~~~~i~~k~a~a  370 (716)
T KOG0058|consen  291 TLVTLIVVPIVALVAKIYGKYLRKLSKQTQDALARANQVAEEVLSAMRTVRSFAAEEQEVKRYNKKLREVLKLSKKEAVA  370 (716)
T ss_pred             HHHHHHHhcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99988888888888889999888888999999999999999999999999999999999999999999999988888777


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccc
Q 005561          399 KSLNESLTRIAIYISLLALYCLGGSKVKAGELSVGIVASFIGYTFTLTFAVQGLVNTFGDLRGTFAAVERINSILSTTEI  478 (691)
Q Consensus       399 ~~~~~~l~~~~~~~~~~~il~~G~~lv~~g~ltvG~lva~~~~~~~l~~pl~~l~~~~~~l~~~~~s~~Ri~~il~~~~~  478 (691)
                      ..+......+..++..+.++++|++++..|+||.|.+++|+.|...+..++.+++..++++.++..|.+|+++++|.+|.
T Consensus       371 ~~~f~~~~~~~~~~~~~siL~~Gg~Lv~~g~mt~g~L~sFllY~~~~g~sl~~ls~~ys~lmkgvGAs~rvFel~dr~P~  450 (716)
T KOG0058|consen  371 YGIFFGSTNLLGNLAVLSILFYGGHLVLTGSLTSGALSSFLLYQVQLGSSLSGLSSFYSELMKGVGASERVFELMDRKPR  450 (716)
T ss_pred             hhHhHhHHHHHHhHHHHHHHHhccchhhcCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcchHHHHHHHhccCCC
Confidence            77777777788888899999999999999999999999999999999999999999999999999999999999987541


Q ss_pred             chhhhcccchhhhcccchhhhhhhhhcCCCCCcccccchhhhhccccccccCCCCCcCcEEEEeeEEECCCCCCcccccc
Q 005561          479 DDALANGLERDIQQKHVEDENIKLFLFDGSNGKHQHLNMHYMSHLKSANSVCSFAWSGDICLEDVYFSYPLRPDVVILNG  558 (691)
Q Consensus       479 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~I~f~nVsF~Y~~~~~~~vL~~  558 (691)
                      -+.              .          |                    ...+....|.|+|+||+|+||.|++.+||+|
T Consensus       451 i~~--------------~----------G--------------------~~~p~~~~G~IeF~~VsFaYP~Rp~~~Vlk~  486 (716)
T KOG0058|consen  451 IPL--------------T----------G--------------------TLAPDHLQGVIEFEDVSFAYPTRPDVPVLKN  486 (716)
T ss_pred             CCC--------------C----------C--------------------ccccccccceEEEEEeeeecCCCCCchhhcC
Confidence            100              0          0                    0011135799999999999999999999999


Q ss_pred             eeEEEeCCCEEEEECCCCCcHHHHHHHHHhcCCCCCCeEEECCccCCCCChHHhhhceEEEeccCCcccccHHHHHhcCC
Q 005561          559 LNLTLKSGSVTALVGSSGAGKSTIVQLLARFYEPTGGRITVGGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYGL  638 (691)
Q Consensus       559 IsL~I~~Ge~vAIVG~SGSGKSTLl~LL~gly~p~~G~I~IdG~di~~i~~~~lR~~Ia~V~Qd~~LF~gTIreNI~lG~  638 (691)
                      +||+|+|||+||+||||||||||+++||.|||+|++|+|++||+||++++..+||++||+|.|||.||++||+|||.||.
T Consensus       487 lsfti~pGe~vALVGPSGsGKSTiasLL~rfY~PtsG~IllDG~~i~~~~~~~lr~~Ig~V~QEPvLFs~sI~eNI~YG~  566 (716)
T KOG0058|consen  487 LSFTIRPGEVVALVGPSGSGKSTIASLLLRFYDPTSGRILLDGVPISDINHKYLRRKIGLVGQEPVLFSGSIRENIAYGL  566 (716)
T ss_pred             ceeeeCCCCEEEEECCCCCCHHHHHHHHHHhcCCCCCeEEECCeehhhcCHHHHHHHeeeeeccceeecccHHHHHhcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCCCCCHHHHHHHHHHcCcHHHHhcCCcccccchh
Q 005561          639 PDENVSKDDIIKAAKAANAHDFIISLPQVWLSKSH  673 (691)
Q Consensus       639 p~~~~sdeeI~~Al~~A~l~dfI~~LP~GydT~~~  673 (691)
                      +  ++++|||.+||++|++||||.++|+||||.+.
T Consensus       567 ~--~~t~e~i~~AAk~ANah~FI~~~p~gY~T~VG  599 (716)
T KOG0058|consen  567 D--NATDEEIEAAAKMANAHEFITNFPDGYNTVVG  599 (716)
T ss_pred             C--CCCHHHHHHHHHHhChHHHHHhCccccccccC
Confidence            6  58999999999999999999999999999874

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PF00664 ABC_membrane: ABC transporter transmembrane region; InterPro: IPR001140 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK11098 microcin B17 transporter; Reviewed Back     alignment and domain information
>PRK12369 putative transporter; Reviewed Back     alignment and domain information
>PF06472 ABC_membrane_2: ABC transporter transmembrane region 2; InterPro: IPR010509 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PF13748 ABC_membrane_3: ABC transporter transmembrane region Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PF05992 SbmA_BacA: SbmA/BacA-like family; InterPro: IPR009248 The Rhizobium meliloti (Sinorhizobium meliloti) bacA gene encodes a function that is essential for bacterial differentiation into bacteroids within plant cells in the symbiosis between R Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query691
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 1e-34
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 2e-34
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 6e-30
3g60_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 4e-23
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 7e-30
3g5u_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 4e-23
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 8e-26
4f4c_A1321 The Crystal Structure Of The Multi-Drug Transporter 3e-22
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 2e-23
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 1e-22
2ixf_A 271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-22
2ixg_A 271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-22
2ixe_A 271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-22
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 1e-17
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 2e-16
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 4e-16
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 8e-16
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 4e-15
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 7e-15
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 7e-15
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 8e-15
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 8e-15
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 8e-15
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 8e-15
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 1e-14
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 6e-13
3nh6_A 306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 7e-13
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 2e-11
4g1u_C 266 X-Ray Structure Of The Bacterial Heme Transporter H 2e-07
1vci_A 373 Crystal Structure Of The Atp-binding Cassette Of Mu 4e-07
3fvq_A 359 Crystal Structure Of The Nucleotide Binding Domain 4e-07
1v43_A 372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 4e-07
1z47_A 355 Structure Of The Atpase Subunit Cysa Of The Putativ 6e-07
3gfo_A 275 Structure Of Cbio1 From Clostridium Perfringens: Pa 1e-06
2it1_A 362 Structure Of Ph0203 Protein From Pyrococcus Horikos 1e-06
4fwi_B 334 Crystal Structure Of The Nucleotide-binding Domain 9e-06
3tui_C 366 Inward Facing Conformations Of The Metni Methionine 1e-05
3dhw_C 343 Crystal Structure Of Methionine Importer Metni Leng 1e-05
3tuj_C 366 Inward Facing Conformations Of The Metni Methionine 2e-05
2yyz_A 359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 2e-05
3d31_A 348 Modbc From Methanosarcina Acetivorans Length = 348 3e-05
2r6g_A 381 The Crystal Structure Of The E. Coli Maltose Transp 3e-05
1q12_A 381 Crystal Structure Of The Atp-bound E. Coli Malk Len 3e-05
1q1b_A 381 Crystal Structure Of E. Coli Malk In The Nucleotide 3e-05
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 1e-04
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 3e-04
2d3w_A248 Crystal Structure Of Escherichia Coli Sufc, An Atpa 3e-04
2zu0_C267 Crystal Structure Of Sufc-Sufd Complex Involved In 3e-04
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 5e-04
2yz2_A 266 Crystal Structure Of The Abc Transporter In The Cob 5e-04
4hlu_A 268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 6e-04
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 7e-04
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure 
Iteration: 1

 Score =  145 bits (365), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 127/485 (26%), Positives = 219/485 (45%), Gaps = 60/485 (12%)
Query: 166 LWSLFLKHKLRLGLSVLTLIGCTTCTLSMPIFSGRFFEVLIGARP-----EPLWKLLSKV 220
           L  L    + RL  +V  L   +  ++S P F G+  +V I   P     + L +L   +
Sbjct: 41  LLGLAYPERRRLAAAVGFLTMSSVISMSAPFFLGKIIDV-IYTNPTVDYSDNLTRLCLGL 99
Query: 221 GLLYALEPIFTVIFVMNMNTVWEKVMSIVKAQIFRRVLIQKAEFFDRYKVXXXXXXXXXX 280
             ++        I V  M T  +++++ ++  +F  +L Q+  FFD+ +           
Sbjct: 100 SAVFLCGAAANAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD 159
Query: 281 XXXXKALVSENISRDRGFRALSEVIGTICILFNIAPQLAPIXXXXXXXXXXXXXXYKRST 340
                  V+EN+S   G RA ++    I ++F ++P LA                Y R  
Sbjct: 160 TALLGRSVTENLSD--GLRAGAQASVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYL 217
Query: 341 VPVFKAHGLAQASIADCVTETFSAIRTVRSFGGEKRQMLMFGRQV-----LAYQQSGIKL 395
             + K    + A       E    +RTVR+FG E  ++  +  +V     LA +++  + 
Sbjct: 218 RKLTKVTQDSLAQATQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARA 277
Query: 396 GTFKSLNESLTRIAIYISLLALYCLGGSKVKAGELSVGIVASFIGYTFTLTFAVQGLVNT 455
           G F +     T ++  + +L++   GG  + +  ++VG ++SF+ Y F +  ++ GL + 
Sbjct: 278 GFFGA-----TGLSGNLIVLSVLYKGGLLMGSAHMTVGELSSFLMYAFWVGISIGGLSSF 332
Query: 456 FGDLRGTFAAVERINSILSTTEIDDALANGLERDIQQKHVEDENIKLFLFDGSNGKHQHL 515
           + +L     A  R+  +L             ER  + K   +E + L      N K    
Sbjct: 333 YSELMKGLGAGGRLWELL-------------ER--EPKLPFNEGVIL------NEK---- 367
Query: 516 NMHYMSHLKSANSVCSFAWSGDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGSS 575
                            ++ G +  ++V+F+YP RP+V I    +L++ SGSVTALVG S
Sbjct: 368 -----------------SFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPS 410
Query: 576 GAGKSTIVQLLARFYEPTGGRITVGGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIA 635
           G+GKST++ LL R Y+P  G I++ G D+R  +       +  V+QEP+LFS S+ ENIA
Sbjct: 411 GSGKSTVLSLLLRLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIA 470
Query: 636 YGLPD 640
           YG  D
Sbjct: 471 YGADD 475
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|2D3W|A Chain A, Crystal Structure Of Escherichia Coli Sufc, An Atpase Compenent Of The Suf Iron-Sulfur Cluster Assembly Machinery Length = 248 Back     alignment and structure
>pdb|2ZU0|C Chain C, Crystal Structure Of Sufc-Sufd Complex Involved In The Iron- Sulfur Cluster Biosynthesis Length = 267 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query691
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 1e-109
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 8e-93
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-89
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 8e-89
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 4e-86
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 1e-82
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 2e-78
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 6e-65
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 5e-57
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 7e-54
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 6e-53
2ghi_A260 Transport protein; multidrug resistance protein, M 1e-50
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 4e-45
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 4e-22
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 1e-19
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 5e-18
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 9e-18
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 2e-16
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 1e-15
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 7e-15
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 2e-14
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 7e-14
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 1e-13
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 2e-13
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 8e-13
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 8e-13
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 9e-13
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 5e-12
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 7e-11
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 7e-11
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 9e-11
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 1e-10
1sgw_A214 Putative ABC transporter; structural genomics, P p 2e-10
1g6h_A257 High-affinity branched-chain amino acid transport 5e-10
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 6e-10
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 2e-08
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 7e-10
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 2e-09
1b0u_A 262 Histidine permease; ABC transporter, transport pro 2e-09
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 2e-09
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 2e-09
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 3e-09
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 3e-09
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 8e-06
1ji0_A240 ABC transporter; ATP binding protein, structural g 5e-09
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 1e-08
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 2e-08
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 3e-08
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 9e-06
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 3e-08
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 7e-07
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 7e-07
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 691
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 2e-39
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 3e-39
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 2e-34
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 4e-34
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 9e-31
d1r0wa_ 281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 3e-26
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 1e-23
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 6e-23
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 6e-22
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 6e-20
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 7e-19
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 9e-18
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 2e-17
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 6e-17
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 7e-17
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 2e-16
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 9e-16
d3b60a2319 f.37.1.1 (A:10-328) Multidrug resistance ABC trans 5e-15
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 8e-15
d2hyda2323 f.37.1.1 (A:1-323) Putative multidrug export ATP-b 1e-13
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 1e-12
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 2e-11
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 2e-11
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 2e-05
g1f2t.1 292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 7e-04
d2qy9a2211 c.37.1.10 (A:285-495) GTPase domain of the signal 0.002
d1np6a_170 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 0.003
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Peptide transporter Tap1, C-terminal ABC domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  143 bits (363), Expect = 2e-39
 Identities = 61/133 (45%), Positives = 86/133 (64%), Gaps = 1/133 (0%)

Query: 536 GDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGSSGAGKSTIVQLLARFYEPTGG 595
           G +  +DV F+YP RPDV++L GL  TL+ G VTALVG +G+GKST+  LL   Y+PTGG
Sbjct: 10  GLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGG 69

Query: 596 RITVGGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYGLPDENVSKDDIIKAAKAA 655
           ++ + G+ L  ++     R V+ V QEP +F  S+ ENIAYGL  +  + ++I  AA  +
Sbjct: 70  QLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLT-QKPTMEEITAAAVKS 128

Query: 656 NAHDFIISLPQVW 668
            AH FI  LPQ +
Sbjct: 129 GAHSFISGLPQGY 141
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 319 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 323 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Length = 211 Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query691
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 99.98
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.97
d2hyda2323 Putative multidrug export ATP-binding/permease pro 99.97
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.97
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.97
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.96
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 99.86
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.86
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.85
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.85
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.84
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.84
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.83
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.82
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.8
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.79
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.78
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.78
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.73
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.69
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.65
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.82
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.66
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.2
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.07
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.06
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.98
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.89
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.53
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.22
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.09
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.03
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.94
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.71
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.7
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.44
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.4
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.3
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.13
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.12
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.03
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 94.03
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.98
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.91
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 93.9
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.85
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.73
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.72
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.7
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 93.49
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 93.43
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.39
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 93.23
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.09
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.04
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.0
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.95
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.91
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 92.88
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.83
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 92.7
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 92.68
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 92.66
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 92.62
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 92.51
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 92.47
d1nrjb_209 Signal recognition particle receptor beta-subunit 92.4
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.2
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 92.11
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 92.11
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 92.08
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 92.03
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.93
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 91.91
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.74
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 91.71
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 91.54
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 91.51
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 91.51
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 91.47
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 91.46
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 91.41
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 91.39
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.32
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 91.3
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 91.22
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.98
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.97
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 90.97
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 90.96
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 90.94
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 90.91
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 90.88
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 90.7
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.63
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.54
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.5
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 90.26
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 90.24
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 90.17
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 90.13
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 90.07
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.05
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 89.94
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 89.76
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 89.73
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.7
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 89.69
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 89.59
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 89.32
d2fh5b1207 Signal recognition particle receptor beta-subunit 89.31
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.21
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 89.03
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 88.91
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 88.86
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 88.51
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 88.48
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 88.45
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 88.42
d1okkd2207 GTPase domain of the signal recognition particle r 88.39
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 88.35
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 88.29
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.19
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 88.07
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 88.05
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 88.03
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 88.02
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 87.76
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 87.72
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 87.72
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 87.7
d1xpua3 289 Transcription termination factor Rho, ATPase domai 87.7
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 87.6
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 87.57
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.57
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.51
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 87.34
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 87.22
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.15
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 86.94
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 86.9
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 86.81
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 86.77
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 86.74
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 86.69
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 86.59
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 86.57
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 86.49
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 86.44
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 86.38
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 86.32
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 86.27
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 86.08
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 85.97
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 85.97
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 85.86
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 85.81
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 85.8
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 85.79
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 85.74
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 85.73
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.6
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 85.54
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 85.51
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 85.43
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 85.42
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 85.41
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 85.33
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 85.32
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 85.28
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 85.12
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 85.06
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 84.82
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 84.42
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 84.25
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 84.11
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 84.11
d2qy9a2211 GTPase domain of the signal recognition particle r 84.08
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 83.91
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 83.87
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 83.79
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 83.75
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 83.65
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 83.54
d1vmaa2213 GTPase domain of the signal recognition particle r 83.39
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 83.36
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 83.15
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 83.15
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 83.04
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 82.91
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 82.83
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 82.78
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 82.57
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 82.56
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 82.48
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 82.4
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 82.37
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 82.34
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 82.18
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 82.17
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 81.82
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 81.71
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 81.53
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 81.52
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 81.19
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 80.99
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 80.76
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 80.24
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 80.2
d1j8yf2211 GTPase domain of the signal sequence recognition p 80.13
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]

Probab=100.00  E-value=1.9e-32  Score=277.21  Aligned_cols=137  Identities=38%  Similarity=0.678  Sum_probs=130.3

Q ss_pred             CCCCEEEEEEEEECCCCCCCCCCCCEEEEEECCCEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCHHHHH
Q ss_conf             76768998558988899995432240389727999999879989489999999704789998688999608999957763
Q 005561          534 WSGDICLEDVYFSYPLRPDVVILNGLNLTLKSGSVTALVGSSGAGKSTIVQLLARFYEPTGGRITVGGEDLRTFDKSEWA  613 (691)
Q Consensus       534 ~~G~I~l~nVsF~Y~~~~~~~vL~~IsL~I~~Ge~vAIVG~SGSGKSTLlkLL~gly~p~~G~I~idG~di~~i~~~~lR  613 (691)
                      .+|+|+|+||+|+|++ ...++|+|+||+|++||++||||+||||||||+++|+|+|+|++|+|.+||.|+++++.+++|
T Consensus        13 ~~g~I~~~nvsf~Y~~-~~~~vL~~isl~i~~Ge~vaivG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~~~lr   91 (255)
T d2hyda1          13 KQGRIDIDHVSFQYND-NEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLR   91 (255)
T ss_dssp             CSCCEEEEEEEECSCS-SSCCSEEEEEEEECTTCEEEEECSTTSSHHHHHTTTTTSSCCSEEEEEETTEEGGGSCHHHHH
T ss_pred             CCCEEEEEEEEEEECC-CCCCCEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCEECCCCCHHHHH
T ss_conf             7887999988999599-997606443899839989999889998099999999712786300015399875307888863


Q ss_pred             HCEEEEECCCCCCCCCHHHHHHCCCCCCCCCHHHHHHHHHHCCCHHHHHCCCCCCCCCHH
Q ss_conf             121888046776310289997549999999999999999982918899508853255303
Q 005561          614 RVVSIVNQEPVLFSVSVGENIAYGLPDENVSKDDIIKAAKAANAHDFIISLPQVWLSKSH  673 (691)
Q Consensus       614 ~~Ia~V~Qd~~LF~GTIrdNI~lG~p~~~~tdeeI~~Al~~A~l~dfI~~LP~GldT~~~  673 (691)
                      ++|+||+|++++|++||+|||++|+++  ++++++++|++.++++++|.++|+||||.+.
T Consensus        92 ~~i~~v~Q~~~lf~~Ti~eNi~~g~~~--~~~~~~~~al~~~~l~~~i~~lp~gl~t~i~  149 (255)
T d2hyda1          92 NQIGLVQQDNILFSDTVKENILLGRPT--ATDEEVVEAAKMANAHDFIMNLPQGYDTEVG  149 (255)
T ss_dssp             HTEEEECSSCCCCSSBHHHHHGGGCSS--CCHHHHHHHHHHTTCHHHHHTSTTGGGCBCC
T ss_pred             HEEEEEECCCCCCCCCHHHHHHCCCCC--CCHHHHHHHHHHHCCHHHHHHCCCCCCCHHC
T ss_conf             414565101568998799998515867--9999999999996979999736242010333
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure