Citrus Sinensis ID: 005584

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------69
MEANIEEALRAKEIAEKRFVEKDFAGAKNYALKAKMLCPGLEGIAQMVATFEVYFASEIKCNGEIDYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKNKCVGADGAFKLVSEAWTLLSDSGKRSSYDLKRSKQVAPGVVQTNLSSVYASGVAGFGNCPNSPIPHTRIDTFWTVCTSCKVQYEYLRKYVNKRLSCKNCRGTFIAVETGAAPVNGSFPYSPWSYMSTNGYGSHGYDGVTYVTTNPAIITGNGIAGFHSGHGYEYVSNVSFQYSSLSGTSTGIVSPNGSSTTTADAIYHINGNINGGGPKVKSGSKGKHSSSGSSEPILTKSGRPDKRRKVVVEANFRNGSEERGVKSGTEVNFANASTNNEHDPKLSRPIELPNRRCSVAPTFDARKLLIEKARTEIRKKLEEIRLAAEAVVENVKLETDSGQSGEASKRADLVVNGNKPKPKTGPITVPDPDFHDFDKDRSEECFKPKQIWAIYDEDDGMPRLYCLIRQIISIKPFKILITYLSSKTDSEFGSVNWVDSGFTKSCGHFRAYNSDVVDQVNIFSHLLRGEKAGRGGCVRIFPKSGEIWAVYRNWSTDWNRLTPDDVRHRYEMVEVLDDYSEDLGVCVTPLIKLAGFKTVYQADTDKSAIRWIPRREMLRFSHQVPSRLLKGEASNLPEKCWDLDPAATPDELLHAAPEAKA
ccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccEEEccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccHHEEEEEEEEccccEEEcccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccEEEEEEEEccccEEEEEEEcccccccccccccccccccccccEEEEEcEEEEEEccccEEEEEEEEEEccccEEEEEcccccEEEEEccccccccccccccccccEEEEEEcccccccccEEEEEccEEcccEEEEEEccccccEEEEcccccccccccccccccccccccccccccccccccccHHHHHHcccccc
ccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHEEEccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEccHHHHHHHHHHHHHHcccEEcccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccHHccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccHHHcccccEEEEEccccccccEEEEEEEEEcccccEEEEEEEccccccccccccccccccccccEEEEEccEEEEccccEEEEEEEEEEcccccEEEEEcccccEEEEEEccccccccccccccccEEEEEEEEccccHcccEEEEEEEEEccEEEEEEcccccccEEEEcHHHHHEEccccccEEEcccccccccccEEcccHcccHHHHHHcccccc
MEANIEEALRAKEIAEKRFVEKDFAGAKNYALKAKMLCPGLEGIAQMVATFEVYFASEikcngeidyysvlglkpsankEAVKKQYRKMAVLLhpdknkcvgadGAFKLVSEAWTLLsdsgkrssydlkrskqvapgvvQTNLSSVYAsgvagfgncpnspiphtridtfwtvCTSCKVQYEYLRKYVNKRlsckncrgtfiavetgaapvngsfpyspwsymstngygshgydgvtyvttnpaiitgngiagfhsghgyeYVSNVSFqysslsgtstgivspngsstttADAIYHIngningggpkvksgskgkhsssgssepiltksgrpdkrrKVVVEAnfrngseergvksgtevnfanastnnehdpklsrpielpnrrcsvaptFDARKLLIEKARTEIRKKLEEIRLAAEAVVENVKletdsgqsgeaskradlvvngnkpkpktgpitvpdpdfhdfdkdrseecfkpkqiwaiydeddgmprLYCLIRQIISIKPFKILITYLSsktdsefgsvnwvdsgftkscghfraynsdvvDQVNIFSHLlrgekagrggcvrifpkSGEIWAVYRNwstdwnrltpddvrHRYEMVEVLDDYsedlgvcvtpliklagfktvyqadtdksairwiprremlrfshqvpsrllkgeasnlpekcwdldpaatpdellhaapeaka
MEANIEEALRAkeiaekrfvekdFAGAKNYALKAKMLCPGLEGIAQMVATFEVYFASEIKCNGEIDYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKNKCVGADGAFKLVSEAWTLLsdsgkrssydlkRSKQVAPGVVQTNLSSVYASGVAGFGNCPNSPIPHTRIDTFWTVCTSCKVQYEYLRKYVNKRLSCKNCRGTFIAVETGAAPVNGSFPYSPWSYMSTNGYGSHGYDGVTYVTTNPAIITGNGIAGFHSGHGYEYVSNVSFQYSSLSGTSTGIVSPNGSSTTTADAIYHINGNINGGGPKVKSGSkgkhsssgssepiltksgrpdkrrkvvveanfrngseergvksgteVNFAnastnnehdpklsrpielpnrrcsvaptfdarKLLIEKARTEIRKKLEEIRLAAEAVVENvkletdsgqsgeaskradlvvngnkpkpktgpitvpdpdFHDFDKDRSEECFKPKQIWAIYDEDDGMPRLYCLIRQIISIKPFKILITYLSSKTDSEFGSVNWVDSGFTKSCGHFRAYNSDVVDQVNIFSHllrgekagrggcVRIFPKSGEIWAVYRnwstdwnrltpdDVRHRYEMVEVLDDYSEDLGVCVTPLIKlagfktvyqadtdksairwiprremlrfshqvpsRLLKGEASNLPEKCWDLDPAATPDELLHAAPEAKA
MEANIEEALRAKEIAEKRFVEKDFAGAKNYALKAKMLCPGLEGIAQMVATFEVYFASEIKCNGEIDYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKNKCVGADGAFKLVSEAWTLLSDSGKRSSYDLKRSKQVAPGVVQTNLSSVYASGVAGFGNCPNSPIPHTRIDTFWTVCTSCKVQYEYLRKYVNKRLSCKNCRGTFIAVETGAAPVNGSFPYSPWSYMSTNGYGSHGYDGVTYVTTNPAIITGNGIAGFHSGHGYEYVSNVSFQYSSLSGTSTGIVSPNGSSTTTADAIYHingningggpkvksgskgkhsssgssEPILTKSGRPDKRRKVVVEANFRNGSEERGVKSGTEVNFANASTNNEHDPKLSRPIELPNRRCSVAPTFDARKLLIEKARTEIRKKLEEIRLAAEAVVENVKLETDSGQSGEASKRADLVVNGNKPKPKTGPITVPDPDFHDFDKDRSEECFKPKQIWAIYDEDDGMPRLYCLIRQIISIKPFKILITYLSSKTDSEFGSVNWVDSGFTKSCGHFRAYNSDVVDQVNIFSHLLRGEKAGRGGCVRIFPKSGEIWAVYRNWSTDWNRLTPDDVRHRYEMVEVLDDYSEDLGVCVTPLIKLAGFKTVYQADTDKSAIRWIPRREMLRFSHQVPSRLLKGEASNLPEKCWDLDPAATPDELLHAAPEAKA
***************EKRFVEKDFAGAKNYALKAKMLCPGLEGIAQMVATFEVYFASEIKCNGEIDYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKNKCVGADGAFKLVSEAWTLLS****************APGVVQTNLSSVYASGVAGFGNCPNSPIPHTRIDTFWTVCTSCKVQYEYLRKYVNKRLSCKNCRGTFIAVETGAAPVNGSFPYSPWSYMSTNGYGSHGYDGVTYVTTNPAIITGNGIAGFHSGHGYEYVSNVSFQYSSLS****************ADAIYHINGN************************************************************************************CSVAPTFDARKLLIEKARTEIRKKLEEIRLAAEAVVE***************************************************CFKPKQIWAIYDEDDGMPRLYCLIRQIISIKPFKILITYLSSKTDSEFGSVNWVDSGFTKSCGHFRAYNSDVVDQVNIFSHLLRGEKAGRGGCVRIFPKSGEIWAVYRNWSTDWNRLTPDDVRHRYEMVEVLDDYSEDLGVCVTPLIKLAGFKTVYQADTDKSAIRWIPRREMLRFSHQV***************CW********************
***NIEEALRAKEIAEKRFVEKDFAGAKNYALKAKMLCPG*EGIAQMVATFEVYFASEIKCNGEIDYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKNKCVGADGAFKLVSEAWTLLSDSGKRSSYDL***************************************DTFWTVCTSCKVQYEYLRKYVNKRLSCKNCRGTFIAVETGAAPVNG**************************************************************************************************************************************************************************************************************************************************TVPDPDFHDFDKDRSEECFKPKQIWAIYDEDDGMPRLYCLIRQIISIKPFKILITYLSSKTDSEFGSVNWVDSGFTKSCGHFRAYNSDVVDQVNIFSHLLRGEKAGRGGCVRIFPKSGEIWAVYRNWSTDWNRLTPDDVRHRYEMVEVLDDYSEDLGVCVTPLIKLAGFKTVYQADTDKSAIRWIPRREMLRFSHQVPSRLLKGEASNLPEKCWDLDPAATPDELLHAAPE***
MEANIEEALRAKEIAEKRFVEKDFAGAKNYALKAKMLCPGLEGIAQMVATFEVYFASEIKCNGEIDYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKNKCVGADGAFKLVSEAWTLLSDSGKRSSYDLKRSKQVAPGVVQTNLSSVYASGVAGFGNCPNSPIPHTRIDTFWTVCTSCKVQYEYLRKYVNKRLSCKNCRGTFIAVETGAAPVNGSFPYSPWSYMSTNGYGSHGYDGVTYVTTNPAIITGNGIAGFHSGHGYEYVSNVSFQYSSLSGTSTGIVSPNGSSTTTADAIYHINGNINGGGP***************************KRRKVVVEANFRNGSEERGVKSGTEVNFANAS********LSRPIELPNRRCSVAPTFDARKLLIEKARTEIRKKLEEIRLAAEAVVENVKL**********SKRADLVVNGNKPKPKTGPITVPDPDFHDFDKDRSEECFKPKQIWAIYDEDDGMPRLYCLIRQIISIKPFKILITYLSSKTDSEFGSVNWVDSGFTKSCGHFRAYNSDVVDQVNIFSHLLRGEKAGRGGCVRIFPKSGEIWAVYRNWSTDWNRLTPDDVRHRYEMVEVLDDYSEDLGVCVTPLIKLAGFKTVYQADTDKSAIRWIPRREMLRFSHQVPSRLLKGEASNLPEKCWDLDPAATPDELLHAAPEAKA
*EA**EEALRAKEIAEKRFVEKDFAGAKNYALKAKMLCPGLEGIAQMVATFEVYFASEIKCNGEIDYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKNKCVGADGAFKLVSEAWTLLSDSGKRSSYDLKRS**********************************RIDTFWTVCTSCKVQYEYLRKYVNKRLSCKNCRGTFIAVETGAAPVNGSFPYSPW*Y*************************************************************************************************************************************************************************************************************************************TGPITVPDPDFHDFDKDRSEECFKPKQIWAIYDEDDGMPRLYCLIRQIISIKPFKILITYLSSKTDSEFGSVNWVDSGFTKSCGHFRAYNSDVVDQVNIFSHLLRGEKAGRGGCVRIFPKSGEIWAVYRNWSTDWNRLTPDDVRHRYEMVEVLDDYSEDLGVCVTPLIKLAGFKTVYQADTDKSAIRWIPRREMLRFSHQVPSRLLKGEASNLPEKCWDLDPAATPDELLHAAP****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEANIEEALRAKEIAEKRFVEKDFAGAKNYALKAKMLCPGLEGIAQMVATFEVYFASEIKCNGEIDYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKNKCVGADGAFKLVSEAWTLLSDSGKRSSYDLKRSKQVAPGVVQTNLSSVYASGVAGFGNCPNSPIPHTRIDTFWTVCTSCKVQYEYLRKYVNKRLSCKNCRGTFIAVETGAAPVNGSFPYSPWSYMSTNGYGSHGYDGVTYVTTNPAIITGNGIAGFHSGHGYEYVSNVSFQYSSLSGTSTGIVSPNGSSTTTADAIYHINGNINGGGPKVKSGSKGKHSSSGSSEPILTKSGRPDKRRKVVVEANFRNGSEERGVKSGTEVNFANASTNNEHDPKLSRPIELPNRRCSVAPTFDARKLLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTDSGQSGEASKRADLVVNGNKPKPKTGPITVPDPDFHDFDKDRSEECFKPKQIWAIYDEDDGMPRLYCLIRQIISIKPFKILITYLSSKTDSEFGSVNWVDSGFTKSCGHFRAYNSDVVDQVNIFSHLLRGEKAGRGGCVRIFPKSGEIWAVYRNWSTDWNRLTPDDVRHRYEMVEVLDDYSEDLGVCVTPLIKLAGFKTVYQADTDKSAIRWIPRREMLRFSHQVPSRLLKGEASNLPEKCWDLDPAATPDELLHAAPEAKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query689 2.2.26 [Sep-21-2011]
Q8TQR1382 Chaperone protein DnaJ OS yes no 0.089 0.162 0.532 8e-12
Q49Y21378 Chaperone protein DnaJ OS yes no 0.089 0.164 0.548 8e-12
Q8CP18373 Chaperone protein DnaJ OS yes no 0.089 0.166 0.548 1e-11
A0AIS3376 Chaperone protein DnaJ OS yes no 0.089 0.164 0.548 1e-11
P63972379 Chaperone protein DnaJ OS yes no 0.089 0.163 0.548 1e-11
A8Z4B8379 Chaperone protein DnaJ OS yes no 0.089 0.163 0.548 1e-11
Q6G8Y8379 Chaperone protein DnaJ OS yes no 0.089 0.163 0.548 1e-11
P63971379 Chaperone protein DnaJ OS yes no 0.089 0.163 0.548 1e-11
P63970379 Chaperone protein DnaJ OS yes no 0.089 0.163 0.548 1e-11
A6QHC2379 Chaperone protein DnaJ OS yes no 0.089 0.163 0.548 1e-11
>sp|Q8TQR1|DNAJ_METAC Chaperone protein DnaJ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaJ PE=3 SV=1 Back     alignment and function desciption
 Score = 72.8 bits (177), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (72%)

Query: 66  DYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKNKCVGADGAFKLVSEAWTLLSDSGKRSS 125
           DYY +LGL   A+ E +KK YRK+A+  HPD+NK  GA+  FK +SEA+ +LSD+ KR+ 
Sbjct: 6   DYYEILGLPKDASVEDIKKTYRKLALQYHPDRNKDPGAEDKFKEISEAYAVLSDTEKRAQ 65

Query: 126 YD 127
           YD
Sbjct: 66  YD 67
Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins.
Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) (taxid: 188937)
>sp|Q49Y21|DNAJ_STAS1 Chaperone protein DnaJ OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q8CP18|DNAJ_STAES Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A0AIS3|DNAJ_LISW6 Chaperone protein DnaJ OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P63972|DNAJ_STAAW Chaperone protein DnaJ OS=Staphylococcus aureus (strain MW2) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A8Z4B8|DNAJ_STAAT Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q6G8Y8|DNAJ_STAAS Chaperone protein DnaJ OS=Staphylococcus aureus (strain MSSA476) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P63971|DNAJ_STAAN Chaperone protein DnaJ OS=Staphylococcus aureus (strain N315) GN=dnaJ PE=1 SV=1 Back     alignment and function description
>sp|P63970|DNAJ_STAAM Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaJ PE=1 SV=1 Back     alignment and function description
>sp|A6QHC2|DNAJ_STAAE Chaperone protein DnaJ OS=Staphylococcus aureus (strain Newman) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query689
224131834700 predicted protein [Populus trichocarpa] 0.994 0.978 0.720 0.0
356552234690 PREDICTED: uncharacterized protein LOC10 0.969 0.968 0.683 0.0
224064844641 predicted protein [Populus trichocarpa] 0.925 0.995 0.692 0.0
147772268723 hypothetical protein VITISV_018091 [Viti 0.992 0.946 0.675 0.0
449453602708 PREDICTED: uncharacterized protein LOC10 0.982 0.956 0.636 0.0
449517665708 PREDICTED: uncharacterized LOC101213444 0.982 0.956 0.636 0.0
357495299692 Curved DNA-binding protein [Medicago tru 0.970 0.966 0.639 0.0
357462517682 Curved DNA-binding protein [Medicago tru 0.956 0.966 0.648 0.0
356501695645 PREDICTED: uncharacterized protein LOC10 0.904 0.965 0.590 0.0
18396002706 DNAJ heat shock N-terminal domain-contai 0.965 0.941 0.553 0.0
>gi|224131834|ref|XP_002321190.1| predicted protein [Populus trichocarpa] gi|222861963|gb|EEE99505.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1051 bits (2718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/704 (72%), Positives = 585/704 (83%), Gaps = 19/704 (2%)

Query: 1   MEANIEEALRAKEIAEKRFVEKDFAGAKNYALKAKMLCPGLEGIAQMVATFEVYFASEIK 60
           ME N EEA+ AKEIAEKRF E+DF GAKNYALKAK LCPGLEGI+QMVATFEVY AS+ K
Sbjct: 1   MEPNTEEAVMAKEIAEKRFAERDFTGAKNYALKAKTLCPGLEGISQMVATFEVYIASQAK 60

Query: 61  CNGEIDYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKNKCVGADGAFKLVSEAWTLLSDS 120
           CNGEIDY+SVLGLKPSA+K+AVK+QYRKMAVLLHPDKNK VGADGAFKLVSEAWT+LSDS
Sbjct: 61  CNGEIDYFSVLGLKPSADKDAVKRQYRKMAVLLHPDKNKTVGADGAFKLVSEAWTMLSDS 120

Query: 121 GKRSSYDLKRSKQVAPGVVQTNLSSVYASGVAGFGNCPNSPIPHTRIDTFWTVCTSCKVQ 180
            K++SYD+KR+K++A  VVQTNLSSV+A+GV G+ +C NSP  H  +DTFWTVCTSCKVQ
Sbjct: 121 LKKNSYDVKRNKKMASCVVQTNLSSVHAAGVTGYSHCSNSPTAHG-LDTFWTVCTSCKVQ 179

Query: 181 YEYLRKYVNKRLSCKNCRGTFIAVETGAAPVNGSFPYSPWSYMSTNGYGSHGYDGVTYVT 240
           YEYLRKYVNKRLSCKNCRGTFIAVETGAAPV+GSFPY PWSY+  NG+ SHGYDGV YV 
Sbjct: 180 YEYLRKYVNKRLSCKNCRGTFIAVETGAAPVSGSFPYCPWSYVPGNGHRSHGYDGVAYVP 239

Query: 241 TNPAIITGNGIAGFHSGHGYEYVSNVSFQYSSLSGTSTGIVSPNGSSTTTADAIYHINGN 300
           T   + +GNG++G H+GHGYEYVSN+SFQ+SS SGT   +V PNGS   +AD +Y  NG+
Sbjct: 240 TTSTLYSGNGVSGLHTGHGYEYVSNLSFQWSSFSGTPGSVVGPNGSCALSADTVYQANGS 299

Query: 301 INGGGPKVKSGSKGKHS------------SSGSSEPILTKSGRPDKRRKVVVEANFRNGS 348
            +    KVK  + G+ S            S+  +E   +K+GRPDK+RKV V + FRNG 
Sbjct: 300 ASAA--KVKPAANGRRSMKTATAKINSDVSASCNESSGSKTGRPDKKRKVAVGSGFRNGC 357

Query: 349 EERGVKSGTEVNFANASTNNEHDPKLSRPIELPNRRCSVAPTFDARKLLIEKARTEIRKK 408
           EE+  KSG+EV  AN   N EHD KLS PIE+P R  S+AP FDARKLLI+KART+IRKK
Sbjct: 358 EEKEPKSGSEVGLANGYKNVEHDAKLSSPIEVPTRHSSIAPAFDARKLLIDKARTDIRKK 417

Query: 409 LEEIRLAAEAVVENVKLETDSGQSGEASKRADLVVNGNKPKP-KTGPI--TVPDPDFHDF 465
           LEE+RLA+ A V+   +E  S ++GEA K+A+  V G++ K  K GPI  TVPDPDFHDF
Sbjct: 418 LEEMRLASAAAVKE-NMEDQSTEAGEAPKQANSDVAGHQTKSNKIGPISITVPDPDFHDF 476

Query: 466 DKDRSEECFKPKQIWAIYDEDDGMPRLYCLIRQIISIKPFKILITYLSSKTDSEFGSVNW 525
           DKDR+EECFKPKQIWA+YDEDDGMPRLYCLIRQ++S+KPFKILITYL+SKTD EFG+VNW
Sbjct: 477 DKDRAEECFKPKQIWALYDEDDGMPRLYCLIRQVVSVKPFKILITYLNSKTDGEFGAVNW 536

Query: 526 VDSGFTKSCGHFRAYNSDVVDQVNIFSHLLRGEKAGRGGCVRIFPKSGEIWAVYRNWSTD 585
           +DSGFTKSCGHFRA NSDVVDQVNIFSH+L+GEKAGRGGCVRI+PKSG++WAVYRNWS D
Sbjct: 537 IDSGFTKSCGHFRAQNSDVVDQVNIFSHVLKGEKAGRGGCVRIYPKSGDVWAVYRNWSPD 596

Query: 586 WNRLTPDDVRHRYEMVEVLDDYSEDLGVCVTPLIKLAGFKTVYQADTDKSAIRWIPRREM 645
           WN  TPDDVRH+YEMVEVLD YSE+LGVCV PL KLAGFKTVYQ +  K A+RWIPRREM
Sbjct: 597 WNISTPDDVRHQYEMVEVLDKYSEELGVCVAPLNKLAGFKTVYQRNAGKDAMRWIPRREM 656

Query: 646 LRFSHQVPSRLLKGEASNLPEKCWDLDPAATPDELLHAAPEAKA 689
           +RFSHQVPS  L+GEASNLP KCWDLDPAATPDELLHAA EAKA
Sbjct: 657 VRFSHQVPSWSLEGEASNLPGKCWDLDPAATPDELLHAATEAKA 700

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356552234|ref|XP_003544474.1| PREDICTED: uncharacterized protein LOC100788692 [Glycine max] Back     alignment and taxonomy information
>gi|224064844|ref|XP_002301579.1| predicted protein [Populus trichocarpa] gi|222843305|gb|EEE80852.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147772268|emb|CAN67351.1| hypothetical protein VITISV_018091 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449453602|ref|XP_004144545.1| PREDICTED: uncharacterized protein LOC101213444 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449517665|ref|XP_004165865.1| PREDICTED: uncharacterized LOC101213444 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357495299|ref|XP_003617938.1| Curved DNA-binding protein [Medicago truncatula] gi|355519273|gb|AET00897.1| Curved DNA-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357462517|ref|XP_003601540.1| Curved DNA-binding protein [Medicago truncatula] gi|357469925|ref|XP_003605247.1| Curved DNA-binding protein [Medicago truncatula] gi|355490588|gb|AES71791.1| Curved DNA-binding protein [Medicago truncatula] gi|355506302|gb|AES87444.1| Curved DNA-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356501695|ref|XP_003519659.1| PREDICTED: uncharacterized protein LOC100792639 [Glycine max] Back     alignment and taxonomy information
>gi|18396002|ref|NP_565321.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|18396006|ref|NP_565322.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|4755194|gb|AAD29061.1| hypothetical protein [Arabidopsis thaliana] gi|4755195|gb|AAD29062.1| expressed protein [Arabidopsis thaliana] gi|15983799|gb|AAL10496.1| At2g05250/F5G3.15 [Arabidopsis thaliana] gi|24111445|gb|AAN46891.1| At2g05250/F5G3.15 [Arabidopsis thaliana] gi|110738764|dbj|BAF01306.1| hypothetical protein [Arabidopsis thaliana] gi|330250815|gb|AEC05909.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|330250816|gb|AEC05910.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0012031801
hypothetical protein (700 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query689
pfam11926218 pfam11926, DUF3444, Domain of unknown function (DU 1e-108
pfam0022663 pfam00226, DnaJ, DnaJ domain 1e-20
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-17
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 1e-16
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 2e-16
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-15
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 7e-15
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-14
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 2e-14
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 7e-14
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 1e-12
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 1e-12
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 1e-12
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 4e-12
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 4e-12
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 6e-12
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 1e-11
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 2e-11
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-11
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 3e-11
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 4e-11
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 4e-11
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 5e-11
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 5e-11
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 1e-10
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 1e-10
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 3e-10
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 3e-10
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 6e-10
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 7e-10
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 8e-10
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 9e-10
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 3e-09
PTZ00037421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 2e-08
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 6e-08
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 8e-08
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 1e-06
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 3e-06
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 7e-04
>gnl|CDD|221319 pfam11926, DUF3444, Domain of unknown function (DUF3444) Back     alignment and domain information 
 Score =  326 bits (838), Expect = e-108
 Identities = 111/218 (50%), Positives = 143/218 (65%), Gaps = 2/218 (0%)

Query: 447 KPKPKTGPITVPDPDFHDFDKDRSEECFKPKQIWAIYDEDDGMPRLYCLIRQIISIKPFK 506
                   I VPDPDFHDFDKDRSE  F   QIWA+YD+DDGMPR Y  I++++S+ PFK
Sbjct: 2   NSSDSPNEIDVPDPDFHDFDKDRSESSFAVGQIWALYDDDDGMPRYYARIKKVLSVPPFK 61

Query: 507 ILITYLSSKTDSEFGSVNWVDSGFTKSCGHFRAYNSDVVDQVNIFSHLLRGEKAGRGGCV 566
           + IT+L  K DSE     WVD G   SCG F+   ++ ++ VN+FSH +  EK GR G  
Sbjct: 62  LRITWLEPKPDSEEEID-WVDEGLPVSCGKFKLGKTEEIESVNMFSHQVVPEKKGRRGEY 120

Query: 567 RIFPKSGEIWAVYRNWSTDWNRLTPDDVRHRYEMVEVLDDYSEDLGVCVTPLIKLAGFKT 626
            I+P+ GEIWA+Y+NWS DWN  TPD   + YE+VEVL DY+++ G+ V PL+K+ GF +
Sbjct: 121 EIYPRKGEIWALYKNWSPDWNADTPDKKTYEYEIVEVLSDYTDEAGISVAPLVKVEGFVS 180

Query: 627 VYQADTDK-SAIRWIPRREMLRFSHQVPSRLLKGEASN 663
           V++ D     A   IP+ EMLRFSHQVPS  L GE   
Sbjct: 181 VFKRDLQGGIATITIPKEEMLRFSHQVPSFRLTGEEGE 218

This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 210 amino acids in length. This domain is found associated with pfam00226. This domain has two conserved sequence motifs: FSH and FSH. Length = 218
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 689
PF11926217 DUF3444: Domain of unknown function (DUF3444); Int 100.0
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.89
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.77
PRK14296372 chaperone protein DnaJ; Provisional 99.77
PRK14288369 chaperone protein DnaJ; Provisional 99.77
PTZ00037421 DnaJ_C chaperone protein; Provisional 99.73
PRK14287371 chaperone protein DnaJ; Provisional 99.73
PRK14276380 chaperone protein DnaJ; Provisional 99.72
PRK14279392 chaperone protein DnaJ; Provisional 99.72
PRK14298377 chaperone protein DnaJ; Provisional 99.71
PRK14286372 chaperone protein DnaJ; Provisional 99.71
PRK14283378 chaperone protein DnaJ; Provisional 99.71
PRK14280376 chaperone protein DnaJ; Provisional 99.7
PRK14278378 chaperone protein DnaJ; Provisional 99.7
PRK14285365 chaperone protein DnaJ; Provisional 99.7
PRK14282369 chaperone protein DnaJ; Provisional 99.69
PRK14291382 chaperone protein DnaJ; Provisional 99.69
PRK14301373 chaperone protein DnaJ; Provisional 99.68
PRK14294366 chaperone protein DnaJ; Provisional 99.68
PRK14277386 chaperone protein DnaJ; Provisional 99.68
PRK14284391 chaperone protein DnaJ; Provisional 99.67
PRK14295389 chaperone protein DnaJ; Provisional 99.67
PRK14297380 chaperone protein DnaJ; Provisional 99.67
PRK10767371 chaperone protein DnaJ; Provisional 99.66
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.66
PRK14281397 chaperone protein DnaJ; Provisional 99.65
PRK14292371 chaperone protein DnaJ; Provisional 99.63
PRK14300372 chaperone protein DnaJ; Provisional 99.63
PRK14293374 chaperone protein DnaJ; Provisional 99.62
PRK14299291 chaperone protein DnaJ; Provisional 99.62
PRK14290365 chaperone protein DnaJ; Provisional 99.62
PRK14289386 chaperone protein DnaJ; Provisional 99.6
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.6
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.6
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.59
KOG0717508 consensus Molecular chaperone (DnaJ superfamily) [ 99.58
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.56
KOG0718546 consensus Molecular chaperone (DnaJ superfamily) [ 99.53
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.53
PTZ003411136 Ring-infected erythrocyte surface antigen; Provisi 99.53
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.53
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.47
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.47
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.44
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.37
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.37
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.35
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.35
PHA03102153 Small T antigen; Reviewed 99.34
PRK05014171 hscB co-chaperone HscB; Provisional 99.2
PRK01356166 hscB co-chaperone HscB; Provisional 99.15
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.13
PRK00294173 hscB co-chaperone HscB; Provisional 99.12
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.1
PRK03578176 hscB co-chaperone HscB; Provisional 99.07
PTZ00100116 DnaJ chaperone protein; Provisional 99.02
PHA02624647 large T antigen; Provisional 98.91
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 98.89
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.85
PRK01773173 hscB co-chaperone HscB; Provisional 98.65
COG5407610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.63
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.55
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.45
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 97.72
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 97.72
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.23
KOG0431453 consensus Auxilin-like protein and related protein 96.47
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.08
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 95.46
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 92.61
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 91.17
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 89.14
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 88.48
PF11926217 DUF3444: Domain of unknown function (DUF3444); Int 88.19
PF1371937 zinc_ribbon_5: zinc-ribbon domain 87.74
PF1342844 TPR_14: Tetratricopeptide repeat 85.78
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 85.34
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 84.02
PF1371736 zinc_ribbon_4: zinc-ribbon domain 82.09
>PF11926 DUF3444: Domain of unknown function (DUF3444); InterPro: IPR024593 This entry represents an uncharacterised domain Back     alignment and domain information 
Probab=100.00  E-value=5.3e-84  Score=650.26  Aligned_cols=210  Identities=48%  Similarity=0.905  Sum_probs=202.9

Q ss_pred             CCCCeecCCCCCCCCCCccCccCCCCCCEEEeecCCCCCCcceeEEEEEeecCCcEEEEEecccCCCCccCccccccCCc
Q 005584          451 KTGPITVPDPDFHDFDKDRSEECFKPKQIWAIYDEDDGMPRLYCLIRQIISIKPFKILITYLSSKTDSEFGSVNWVDSGF  530 (689)
Q Consensus       451 ~~~~~~~pd~df~dFd~~R~~~~F~~gQiWA~Yd~~D~mPr~Ya~I~kv~~~~~f~l~i~wLe~~~~~e~~~~~W~~~~~  530 (689)
                      .+..|+||||||||||++|++++|++||||||||+.|||||+||||+||++.+||+|||+|||+++++++ +++|++++|
T Consensus         5 ~~~~~~~pd~dF~dF~~~R~~~~F~~gQIWAlYd~~D~mPR~Ya~I~kV~~~~~Fkl~i~wLe~~~~~e~-~~~w~~~~~   83 (217)
T PF11926_consen    5 SPSSIDVPDPDFYDFDKDRSEEKFQVGQIWALYDDDDGMPRYYARIKKVDSSNPFKLHITWLEPCPDSEE-EIRWEDEGL   83 (217)
T ss_pred             CCCcccCCCcccccccCCchHHhCCCCCEEEEeeCCCCCeeeEEEEEEEecCCCeEEEEEEccccCCccc-ceeeeecCC
Confidence            4567999999999999999999999999999999999999999999999987799999999999999885 899999999


Q ss_pred             eeeeeeEEecceeeeecccceEEEeeeeEecCCceEEEeCCcCcEEEEecCCCCCCCCCCCCCCcceeeEEEEecCCCCC
Q 005584          531 TKSCGHFRAYNSDVVDQVNIFSHLLRGEKAGRGGCVRIFPKSGEIWAVYRNWSTDWNRLTPDDVRHRYEMVEVLDDYSED  610 (689)
Q Consensus       531 p~~CG~F~~~~~~~~~~~~~FSH~v~~~~~~~~~~~~IyPrkGevWAlyk~W~~~w~~~~~~~~~~~y~~VEvl~d~~~~  610 (689)
                      ||+||+|+++++.+++++++|||+|.+++.+.++.|+|||||||||||||||+++|+.+++++..|+|||||||+||+++
T Consensus        84 pvsCG~Fk~~~~~~~~~~~~FSH~v~~~~~~~~~~y~IyPrkGEvWAlYknW~~~w~~~~~~~~~~~YdiVEVl~d~~~~  163 (217)
T PF11926_consen   84 PVSCGTFKVGKTEEIDDPNMFSHQVVPWTSGKRNEYEIYPRKGEVWALYKNWSPDWSSSTDDERKYEYDIVEVLSDYSEE  163 (217)
T ss_pred             ceEEEEEEeCCEEEeccCCcEEEEEEEeecCCCceEEEeCCcccEeEEecCCCCCCCcCcCcCcccceEEEEEeecCCcc
Confidence            99999999999999999999999998799999999999999999999999999999999899999999999999999999


Q ss_pred             CceEEEEeeeecCceeeeeecCCCC-ceEEecCCCccceeccccCccccccc
Q 005584          611 LGVCVTPLIKLAGFKTVYQADTDKS-AIRWIPRREMLRFSHQVPSRLLKGEA  661 (689)
Q Consensus       611 ~gv~v~~L~kv~Gf~svF~~~~~~~-~~~~Ip~~e~~rFSHqiP~~~ltg~e  661 (689)
                      .||.|+||+||+||+|||+|....+ .++.||++||+|||||||||||||+|
T Consensus       164 ~gi~V~~L~Kv~Gf~svF~~~~~~~~~~~~Ip~~E~~RFSHqIPa~rltgee  215 (217)
T PF11926_consen  164 AGIKVAPLVKVKGFKSVFKRAEEGGEAVFTIPKSELLRFSHQIPAFRLTGEE  215 (217)
T ss_pred             CcEEEEEEEEecCcEeeeeecCCCCcceEEEChHHcCeeeccCCCEEccCcc
Confidence            9999999999999999999998877 67999999999999999999999998

This domain is found in DnaJ, cytosine-specific methyltransferases, and members from the zinc finger, C3HC4 type family.
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF11926 DUF3444: Domain of unknown function (DUF3444); InterPro: IPR024593 This entry represents an uncharacterised domain Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query689
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 3e-11
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 2e-10
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 2e-10
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 3e-10
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 3e-10
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 4e-10
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 1e-09
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 1e-09
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 1e-09
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-08
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 2e-08
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 3e-08
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 3e-08
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 5e-08
2ys8_A90 Solution Structure Of The Dnaj-Like Domain From Hum 1e-07
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 2e-07
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 7e-07
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 1e-06
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 3e-06
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 9e-06
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 3e-05
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 3e-05
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (70%), Gaps = 2/68 (2%)
Query: 62  NGEIDYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKN--KCVGADGAFKLVSEAWTLLSD 119
           +G  +YY VLG++ SA+ E +KK YRK+A+  HPDKN      A+  FKLVSEA+ +LSD
Sbjct: 6   SGMANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSD 65
Query: 120 SGKRSSYD 127
           S KRS YD
Sbjct: 66  SKKRSLYD 73
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query689
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 5e-22
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 3e-20
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-19
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 3e-19
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 3e-19
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 5e-19
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-18
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 3e-18
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 3e-18
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 1e-17
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-17
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 2e-17
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 4e-17
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 5e-17
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 5e-17
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 5e-17
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 7e-17
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 2e-16
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 3e-16
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 4e-16
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 9e-16
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-13
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 3e-13
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 5e-12
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 1e-11
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-11
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 2e-11
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 5e-11
2guz_A71 Mitochondrial import inner membrane translocase su 2e-09
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 4e-09
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 6e-09
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 3e-08
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 9e-08
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
 Score = 89.8 bits (223), Expect = 5e-22
 Identities = 28/62 (45%), Positives = 38/62 (61%)

Query: 66  DYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKNKCVGADGAFKLVSEAWTLLSDSGKRSS 125
           D + +LG+KP A+++ V K YRK+AVLLHPDK    G++ AFK V  A T L  + K   
Sbjct: 28  DSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIKSGP 87

Query: 126 YD 127
             
Sbjct: 88  SS 89
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 689
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-13
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 9e-13
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-11
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 2e-11
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 1e-10
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 7e-10
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 4e-09
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 6e-07
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 64.3 bits (156), Expect = 2e-13
 Identities = 27/73 (36%), Positives = 41/73 (56%), Gaps = 7/73 (9%)

Query: 66  DYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKNKCVGADGA-------FKLVSEAWTLLS 118
           D+YS+LG  PSAN   +K++Y+K+ +L HPDK       G        F  + +AW +L 
Sbjct: 17  DWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILG 76

Query: 119 DSGKRSSYDLKRS 131
           +   +  YDL+RS
Sbjct: 77  NEETKKKYDLQRS 89
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query689
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.52
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.45
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.41
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.16
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.14
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.12
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 98.98
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.52  E-value=1.3e-14  Score=123.25  Aligned_cols=71  Identities=35%  Similarity=0.685  Sum_probs=65.2

Q ss_pred             CCCCHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCC-CCHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCCC
Q ss_conf             7683001267889999999999999999809999999-8857999999999999417840112010004356
Q 005584           64 EIDYYSVLGLKPSANKEAVKKQYRKMAVLLHPDKNKC-VGADGAFKLVSEAWTLLSDSGKRSSYDLKRSKQV  134 (689)
Q Consensus        64 ~~D~Y~ILgv~~~a~~~eIKkaYrkLal~~HPDKn~~-~~a~~af~~I~eAy~vLsD~~kR~~YD~~~~~~~  134 (689)
                      ..|||+||||+++|+..+||++||+|++++|||++.. +.++..|..|++||+||+||.+|..||.+|..+.
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~   73 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAF   73 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSC
T ss_pred             CCCHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCC
T ss_conf             887799809899969999999999998650230068971799999999888970288999999987681425
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure