Citrus Sinensis ID: 005604

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------69
MATAKRELELPDGDKPESVVKKAKVDDPVSDSSASGPRSQKQRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEVPADAVNNMLANYVLPVNKDTPGSDELFDQVMFVELDREEAQRHLDEMKGTLGSVSNPNLQANYAPYSHENFVKSLCTPPLNNQEPLSVGGGLSPQVNCTDNWQSTYLPPQQVNYGYQMPNRVNAAYQASGSYSQAYQGYQNSLIPRASAPSGTYLSNERGSVPVGNSRYRESYGPSTGGRINPYQGYGVVEPYSRPVPLTDPRRTGMVEPSPMGSARTSFTHNASAGQFRPARGPQNDLQAPRAPMLPPSPLPSTHGLPYQTPMARPSHENFPTYMQHPGRNATPYPRYH
ccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccEEccccccEEcccccccccEEccEEcccccccccEEEEEEEEEcccccccccccccccEEEEEEccccccccccccccccEEEcccccEEEcccccccccccccccEEEEEEEcccccccEEEEEEcccccccccccccccccccccccHHHHcccccccEEEEEEccEEEEEEEccccccccccccccccccccccccccccccccccHHHHHHHcccccccccHHHHHHHHccccHHHHHcccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccccccccccEEccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccEEEEcccccccEEEEccccccccccccccHHHHHHcccccccccccEEEEEEEEEEEccccccccccccccEEEEEEEcccccccccccccccccccccccEcccccccccccccccccEEEEEEEcccccEEEEEEEEccccccEEEEEccccccccccccccHHHHcccccccEEEEEcEEEEEEcccccccccccccEEEEccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHccccEEEEEccHHHHHHHccccccEccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHcHcccccEEEEEEEccHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccHHHHcEEEEEEccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
matakrelelpdgdkpesvvkkakvddpvsdssasgprsqkqrvvlnpadcdldfdiednglkssglhqegfaycwsgaranvginggkycfgckivstqpvdmedtppdqqhvcrvgtsrgddpvgklgeteqsfgfggtgkfshggnflnfgekfgvgDTIICAIdleskplatigfakngkwlgtakqfdagsnglgvvdsavkerqcesavfphiLLKNVVVVMQFSVeqglipvegYKSWVSAlddgnsvlgptfcnmkdCEVMMMvglpasgkttwAEKWvkdhpekrYILLGTNLILEQmkvpgllrkhnYSERFQCLMGRANAIFDVLLSrasrtprnfiidqTNVFKSARKRKLRLFVNFRKIAVvvfpkpedlkIRSVKRFKEMGKEVPADAVNNMLANyvlpvnkdtpgsdelfdQVMFVELDREEAQRHLDEMKgtlgsvsnpnlqanyapyshenfvkslctpplnnqeplsvggglspqvnctdnwqstylppqqvnygyqmpnrvnaayqasgsysQAYQGYqnsliprasapsgtylsnergsvpvgnsryresygpstggrinpyqgygvvepysrpvpltdprrtgmvepspmgsartsfthnasagqfrpargpqndlqaprapmlppsplpsthglpyqtpmarpshenfptymqhpgrnatpypryh
matakrelelpdgdkpesvvkkakvddpvsdssasgprsqkqrvVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRAsrtprnfiidqtnvfksarKRKLRLFVnfrkiavvvfpkpedlkirSVKRFKEMGKEVPADAVNNMLANYVLPVNKDTPGSDELFDQVMFVELDREEAQRHLDEMKGTLGSVSNPNLQANYAPYSHENFVKSLCTPPLNNQEPLSVGGGLSPQVNCTDNWQSTYLPPQQVNYGYQMPNRVNAAYQASGSYSQAYQGYQNSLIPRASAPSGTYLsnergsvpvgnsryresygpstggrinpyqGYGVVEPYSRPVPLTDPRRTGMVEPSPMGSARTSFTHNASAGQFRPARGPQNDLQAPRAPMLPPSPLPSTHGLPYQTPMARPSHENfptymqhpgrnatpypryh
MATAKRELELPDGDKPESVVKKAKVDDPVSDSSASGPRSQKQRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSfgfggtgkfshggnfLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEVPADAVNNMLANYVLPVNKDTPGSDELFDQVMFVELDREEAQRHLDEMKGTLGSVSNPNLQANYAPYSHENFVKSLCTPPLNNQEPLSVGGGLSPQVNCTDNWQSTYLPPQQVNYGYQMPNRVnaayqasgsysqayqgyqnsLIPRASAPSGTYLSNERGSVPVGNSRYRESYGPSTGGRINPYQGYGVVEPYSRPVPLTDPRRTGMVEPSPMGSARTSFTHNASAGQFRPARGPQNDLQaprapmlppsplpsTHGLPYQTPMARPSHENFPTYMQHPGRNATPYPRYH
********************************************VLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVST************************************FGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEVPADAVNNMLANYVLPVNKDT***DELFDQVMFVEL***************************YAPYSHENFVKSLCT***********GGGLSPQVNCTDNWQSTYLPPQQVNYGYQMPNRVNAAYQASG*Y**AYQ*********************************************PYQGYGVV****************************************************************************************************
****************************************KQRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVS*************************GLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKV*************QCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKP*********************AVNNMLANYVLPVNKDTPGSDELFDQVMFVELDREEAQR********************************************************************************************************************************************************************************************************************************************************
*****************************************QRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEVPADAVNNMLANYVLPVNKDTPGSDELFDQVMFVELDREEAQRHLDEMKGTLGSVSNPNLQANYAPYSHENFVKSLCTPPLNNQEPLSVGGGLSPQVNCTDNWQSTYLPPQQVNYGYQMPNRVNAAYQASGSYSQAYQGYQNSLIPRASAPSGTYLSNERGSVPVGNSRYRESYGPSTGGRINPYQGYGVVEPYSRPVPLTDPRRTGMVEPSPMGSARTSFTHNASAGQFRPARGPQNDLQAPRAPMLPPSPLPSTHGLPYQTPMARPSHENFPTYMQHPGRNATPYPRYH
***************************************QKQRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEVPADAVNNMLANYVLPVNKDTPGSDELFDQVMFVELDREEAQRHLDEMKGTLG********************************PLSVGGGLSPQVNCTDNWQSTYLPPQQVNYGYQMPNRVNAAYQASGSYSQAYQGYQNSLIPRASAPSGTYLSNERGSVPVGNSRYRESYGPSTGGRINPYQGYGVVEPYSRPVPLTDPRRTGMVEPSPMGSARTSFTHNASAGQFRPARGPQNDLQAPRAPMLPPSPLPSTHGLPYQTPMARPSHENFPTYMQHPGRNATPYPRYH
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATAKRELELPDGDKPESVVKKAKVDDPVSDSSASGPRSQKQRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEVPADAVNNMLANYVLPVNKDTPGSDELFDQVMFVELDREEAQRHLDEMKGTLGSVSNPNLQANYAPYSHENFVKSLCTPPLNNQEPLSVGGGLSPQVNCTDNWQSTYLPPQQVNYGYQMPNRVNAAYQASGSYSQAYQGYQNSLIPRASAPSGTYLSNERGSVPVGNSRYRESYGPSTGGRINPYQGYGVVEPYSRPVPLTDPRRTGMVEPSPMGSARTSFTHNASAGQFRPARGPQNDLQAPRAPMLPPSPLPSTHGLPYQTPMARPSHENFPTYMQHPGRNATPYPRYH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query688 2.2.26 [Sep-21-2011]
Q8VDM6859 Heterogeneous nuclear rib yes no 0.543 0.435 0.400 5e-74
Q9BUJ2856 Heterogeneous nuclear rib yes no 0.543 0.436 0.398 7e-74
Q00839825 Heterogeneous nuclear rib no no 0.553 0.461 0.360 4e-60
Q8VEK3800 Heterogeneous nuclear rib no no 0.553 0.476 0.358 8e-60
Q00PI9745 Heterogeneous nuclear rib no no 0.524 0.484 0.349 2e-54
Q1KMD3747 Heterogeneous nuclear rib no no 0.524 0.483 0.347 2e-53
Q55CP6765 Probable ATP-dependent RN yes no 0.231 0.207 0.260 3e-09
Q5XH91740 ATP-dependent RNA helicas no no 0.226 0.210 0.328 2e-06
A2VD92740 ATP-dependent RNA helicas N/A no 0.226 0.210 0.323 2e-05
Q24498 5127 Ryanodine receptor 44F OS no no 0.152 0.020 0.289 6e-05
>sp|Q8VDM6|HNRL1_MOUSE Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Mus musculus GN=Hnrnpul1 PE=1 SV=1 Back     alignment and function desciption
 Score =  279 bits (714), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 161/402 (40%), Positives = 225/402 (55%), Gaps = 28/402 (6%)

Query: 44  VVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVD 103
           V ++  +CDL F +  +      L  EGFAY WSGARA+ G+  G+ CF  KI     V 
Sbjct: 212 VAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVK 271

Query: 104 -MEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDT 162
            +  T PD  HV R+G S  D    +LGE   S+G+GGTGK S    F N+G+KF   D 
Sbjct: 272 HLPSTEPDP-HVVRIGWSL-DSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDV 329

Query: 163 IICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLK 222
           I C  D E      + F KNGKW+G A  F      LG             A++PH+L+K
Sbjct: 330 IGCFADFECGNDVELSFTKNGKWMGIA--FRIQKEALG-----------GQALYPHVLVK 376

Query: 223 NVVVVMQFSVEQ----GLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASG 278
           N  V   F         ++P   +   +   +     +GP   +  +CE++MMVGLPA+G
Sbjct: 377 NCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTIGPK--SKAECEILMMVGLPAAG 434

Query: 279 KTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLS 338
           KTTWA K    +P K+Y +LGTN I+++M+V GL R+ NY+ R+  L+ +A    + L+ 
Sbjct: 435 KTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQ 494

Query: 339 RASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEV 398
            A+R  RN+I+DQTNV+ SA++RK+R F  F++ A+V+ P  EDLK R+VKR  E GK+V
Sbjct: 495 IAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTVKRTDEEGKDV 554

Query: 399 PADAVNNMLANYVLPVNKDTPGSDELFDQVMFVELDREEAQR 440
           P  AV  M AN+ LP   D        D+V+F+EL REEA +
Sbjct: 555 PDHAVLEMKANFTLPDVGD------FLDEVLFIELQREEADK 590
Acts as a basic transcriptional regulator. Represses basic transcription driven by several virus and cellular promoters. When associated with BRD7, activates transcription of glucocorticoid-responsive promoter in the absence of ligand-stimulation. Plays also a role in mRNA processing and transport. Binds avidly to poly(G) and poly(C) RNA homopolymers in vitro.
Mus musculus (taxid: 10090)
>sp|Q9BUJ2|HNRL1_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens GN=HNRNPUL1 PE=1 SV=2 Back     alignment and function description
>sp|Q00839|HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 Back     alignment and function description
>sp|Q8VEK3|HNRPU_MOUSE Heterogeneous nuclear ribonucleoprotein U OS=Mus musculus GN=Hnrnpu PE=1 SV=1 Back     alignment and function description
>sp|Q00PI9|HNRL2_MOUSE Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Mus musculus GN=Hnrnpul2 PE=1 SV=2 Back     alignment and function description
>sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens GN=HNRNPUL2 PE=1 SV=1 Back     alignment and function description
>sp|Q55CP6|DDX1_DICDI Probable ATP-dependent RNA helicase ddx1 OS=Dictyostelium discoideum GN=ddx1 PE=3 SV=1 Back     alignment and function description
>sp|Q5XH91|DDX1_XENTR ATP-dependent RNA helicase DDX1 OS=Xenopus tropicalis GN=ddx1 PE=2 SV=1 Back     alignment and function description
>sp|A2VD92|DDX1_XENLA ATP-dependent RNA helicase DDX1 OS=Xenopus laevis GN=ddx1 PE=2 SV=1 Back     alignment and function description
>sp|Q24498|RY44_DROME Ryanodine receptor 44F OS=Drosophila melanogaster GN=Rya-r44F PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query688
302144182703 unnamed protein product [Vitis vinifera] 0.970 0.950 0.571 0.0
147827160 1021 hypothetical protein VITISV_016567 [Viti 0.956 0.644 0.568 0.0
359495491514 PREDICTED: heterogeneous nuclear ribonuc 0.734 0.982 0.654 0.0
449457692595 PREDICTED: heterogeneous nuclear ribonuc 0.813 0.941 0.536 0.0
449488411595 PREDICTED: heterogeneous nuclear ribonuc 0.857 0.991 0.516 0.0
359495485590 PREDICTED: heterogeneous nuclear ribonuc 0.614 0.716 0.706 0.0
90265186717 H0410G08.12 [Oryza sativa Indica Group] 0.622 0.596 0.669 1e-174
356557660517 PREDICTED: heterogeneous nuclear ribonuc 0.598 0.796 0.699 1e-173
302144178 1459 unnamed protein product [Vitis vinifera] 0.585 0.276 0.693 1e-173
297603419717 Os04g0636000 [Oryza sativa Japonica Grou 0.622 0.596 0.667 1e-172
>gi|302144182|emb|CBI23309.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/723 (57%), Positives = 500/723 (69%), Gaps = 55/723 (7%)

Query: 1   MATAKRELELPDGDKPESVVKKAKVDDPVSDSSASGPRSQKQRVVLNPADCDLDFDIEDN 60
           MA+ KR+L  P+  +PES   KA + D       S     KQRVVLNPADCDLDF+I  +
Sbjct: 1   MASIKRQLSEPE--EPESKKPKAVLSD-------SPEHKTKQRVVLNPADCDLDFNIVGD 51

Query: 61  GLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTS 120
           GL+ S LH  GFAYCWSGAR NVGI GGKYCFGCKI+STQPVDMEDTPPDQQHVCR+G S
Sbjct: 52  GLQGSALHDHGFAYCWSGARGNVGITGGKYCFGCKIISTQPVDMEDTPPDQQHVCRLGIS 111

Query: 121 RGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFA 180
           RGDD VG LGETE SFGFGGTGKFS  G F N+GEKFGVGDTI+CA++LE+KPLA+I F+
Sbjct: 112 RGDDAVGNLGETEHSFGFGGTGKFSVAGKFSNYGEKFGVGDTIVCAVNLETKPLASISFS 171

Query: 181 KNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVE 240
           KNGKWLG AK+FDAG  GLGVVDS +++   ESA+FPH+LLKNV+V +QFS E+GL+P E
Sbjct: 172 KNGKWLGVAKEFDAGVKGLGVVDSPMRQLHWESALFPHVLLKNVMVQVQFSTEEGLVPEE 231

Query: 241 GYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGT 300
           GYK W SAL DGN+++GP+F + +DCEVMMMVGLPASGK+TWAEKWVK+H EKRY+LLGT
Sbjct: 232 GYKPWASALYDGNAIMGPSFSSPRDCEVMMMVGLPASGKSTWAEKWVKEHAEKRYVLLGT 291

Query: 301 NLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARK 360
           NL L+QMKVPGLLRK NY ERF+ LM RA  IF+ LLSRAS+TP N+IIDQTNV+K+ARK
Sbjct: 292 NLALDQMKVPGLLRKQNYGERFERLMDRATGIFNTLLSRASKTPHNYIIDQTNVYKNARK 351

Query: 361 RKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEVPADAVNNMLANYVLPVNKDTPG 420
           RKL+ F NF+KIAVV+FPKPE+LK R+ KRFKEMGKEVPADAVN M+ANYVLP +KD PG
Sbjct: 352 RKLKPFANFQKIAVVLFPKPEELKFRAEKRFKEMGKEVPADAVNEMIANYVLPRSKDMPG 411

Query: 421 SDELFDQVMFVELDREEAQRHLDEMKGTLGSVSNPNLQANYAPYSHENFVKSLCTPPLNN 480
           SDE FDQV+F EL+R EAQ+ L+EMK  LG+ S+ NL++N++PYS E+ ++S  +  L N
Sbjct: 412 SDEDFDQVLFPELNRGEAQKCLEEMKRALGTASHLNLKSNFSPYSQESSLQSYNSSSLQN 471

Query: 481 QEPLSVGGGLSPQVNCTDNWQSTYLPPQQVNYGYQMPNRVNAAYQASG------SYSQAY 534
           Q   SV           D    +Y PP   NY YQ P  +N+ +Q          + +AY
Sbjct: 472 QGAPSV----------PDERSLSYHPPLPQNYYYQRPAHMNSGHQGVALHGRVEPFPRAY 521

Query: 535 QGYQNSLIPRASAPSGTYLSNERG------SVPVGNSRYRESYGPSTGGRINPYQGYGVV 588
           Q  QN  +PR  AP  T L   R       S   G   Y  S G   G  +  YQ +G+V
Sbjct: 522 QDNQNPFMPR-DAPYETSLGYSRNFLSRNDSNSYGTYGYDNSRGSIPGVGMASYQSFGMV 580

Query: 589 EPYSR-------PVPL--TDPRRTGMVEP-------------SPMGSARTS-FTHNASAG 625
           +PY R       P+P+  TDP  +GMVE              +   S RTS F+HN   G
Sbjct: 581 DPYRRTNLESRNPIPMGATDPYVSGMVESHDKYNVEGVNHYETQAESMRTSLFSHNTLGG 640

Query: 626 QFRPARGPQNDLQAPRAPMLPPSPLPSTHGLPYQTPMARPSHENFPTYMQHPGRNATPYP 685
                 G   +   PR P   P+P   ++G PY  P+ RPS+ NFPT MQHPG  A P P
Sbjct: 641 HGSVPGGFGANQLVPRDPRNLPTPSQMSYGSPYGAPLVRPSYGNFPTDMQHPGGYAPPRP 700

Query: 686 RYH 688
           RY+
Sbjct: 701 RYY 703

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147827160|emb|CAN66470.1| hypothetical protein VITISV_016567 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495491|ref|XP_003635003.1| PREDICTED: heterogeneous nuclear ribonucleoprotein U-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449457692|ref|XP_004146582.1| PREDICTED: heterogeneous nuclear ribonucleoprotein U-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449488411|ref|XP_004158025.1| PREDICTED: heterogeneous nuclear ribonucleoprotein U-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359495485|ref|XP_002271342.2| PREDICTED: heterogeneous nuclear ribonucleoprotein U-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|90265186|emb|CAH67657.1| H0410G08.12 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|356557660|ref|XP_003547133.1| PREDICTED: heterogeneous nuclear ribonucleoprotein U-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|302144178|emb|CBI23305.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297603419|ref|NP_001054013.2| Os04g0636000 [Oryza sativa Japonica Group] gi|38344809|emb|CAE03010.2| OSJNBa0043L09.29 [Oryza sativa Japonica Group] gi|255675811|dbj|BAF15927.2| Os04g0636000 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query688
ZFIN|ZDB-GENE-040426-2432784 hnrnpul1 "heterogeneous nuclea 0.542 0.475 0.407 1.6e-67
MGI|MGI:2443517859 Hnrnpul1 "heterogeneous nuclea 0.542 0.434 0.392 9.8e-66
RGD|1307456859 Hnrnpul1 "heterogeneous nuclea 0.542 0.434 0.389 1.6e-65
UNIPROTKB|E2RNY1856 HNRNPUL1 "Uncharacterized prot 0.542 0.435 0.389 1.4e-64
UNIPROTKB|J9JHA9756 HNRNPUL1 "Uncharacterized prot 0.542 0.493 0.389 1.4e-64
UNIPROTKB|B7Z4B8767 HNRNPUL1 "cDNA FLJ56481, highl 0.542 0.486 0.389 1.4e-64
UNIPROTKB|Q9BUJ2856 HNRNPUL1 "Heterogeneous nuclea 0.542 0.435 0.389 1.4e-64
UNIPROTKB|A4FUC2858 HNRNPUL1 "Uncharacterized prot 0.542 0.434 0.389 1.8e-64
UNIPROTKB|Q00839825 HNRNPU "Heterogeneous nuclear 0.553 0.461 0.355 9.6e-59
UNIPROTKB|F1Q3W0783 HNRNPU "Uncharacterized protei 0.552 0.485 0.359 1.8e-56
ZFIN|ZDB-GENE-040426-2432 hnrnpul1 "heterogeneous nuclear ribonucleoprotein U-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 661 (237.7 bits), Expect = 1.6e-67, Sum P(2) = 1.6e-67
 Identities = 163/400 (40%), Positives = 224/400 (56%)

Query:    44 VVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVD 103
             V ++  + DL F +  +      L  EGFAY WSGARA  G+N G+ C+  K+     V 
Sbjct:   201 VAIDTYNSDLHFKVSPDHCSGYPLTIEGFAYLWSGARATYGVNKGRVCYELKVKEYISVK 260

Query:   104 -MEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSXXXXXXXXXXXXXXXLNFGEKFGVGDT 162
              +  + PD  HV RVG S  D    +LGE   S                ++GEKFG GD 
Sbjct:   261 HLPSSEPDP-HVVRVGWSL-DSCSTQLGEEAFSYGYGGTGKKSTNYKFGDYGEKFGEGDI 318

Query:   163 IICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLK 222
             I C ID +S     + F+KNGKWL  A +               KE     A+FPH+L+K
Sbjct:   319 IGCYIDFDSHEQVEMAFSKNGKWLDVAFRVS-------------KEELAGQALFPHVLVK 365

Query:   223 NVVVVMQFSV-EQGLIPV-EGYKSWVSALDDGNSVLGPTFCNMK-DCEVMMMVGLPASGK 279
             N  V   F   E+   P+ +GY S++  +   N V G    + K DC+V+MMVGLPA GK
Sbjct:   366 NCAVEFNFGQREEPYFPLPDGY-SFIGDVSLENRVRGTVGPSSKSDCQVLMMVGLPACGK 424

Query:   280 TTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSR 339
             TTWA K  + +P+KR+ +LGTN I+E+MKV GL R+ NY+ R+  L+ +A    + LL  
Sbjct:   425 TTWAAKHAEMNPDKRFNILGTNAIMEKMKVMGLRRQRNYAGRWDILIQQATQCLNRLLQI 484

Query:   340 ASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEVP 399
             AS   RN+I+DQTNV+ SA++RK+R F  F + AVV+ P+ EDLK R  K+ ++ GK+VP
Sbjct:   485 ASHKKRNYILDQTNVYGSAQRRKMRPFEGFHRKAVVICPRDEDLKERRCKQAED-GKDVP 543

Query:   400 ADAVNNMLANYVLPVNKDTPGSDELFDQVMFVELDREEAQ 439
               AV  M AN+VLP   D        D+VMF+EL R+EA+
Sbjct:   544 DQAVLEMKANFVLPEAGD------FLDEVMFIELQRDEAR 577
GO:0006396 "RNA processing" evidence=IEA
GO:0009615 "response to virus" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0030529 "ribonucleoprotein complex" evidence=IEA
MGI|MGI:2443517 Hnrnpul1 "heterogeneous nuclear ribonucleoprotein U-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307456 Hnrnpul1 "heterogeneous nuclear ribonucleoprotein U-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNY1 HNRNPUL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9JHA9 HNRNPUL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z4B8 HNRNPUL1 "cDNA FLJ56481, highly similar to Heterogeneous nuclear ribonucleoprotein U-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BUJ2 HNRNPUL1 "Heterogeneous nuclear ribonucleoprotein U-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A4FUC2 HNRNPUL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q00839 HNRNPU "Heterogeneous nuclear ribonucleoprotein U" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3W0 HNRNPU "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00009742001
SubName- Full=Chromosome undetermined scaffold_247, whole genome shotgun sequence; (489 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query688
cd12884176 cd12884, SPRY_hnRNP, SPRY domain in heterogeneous 2e-66
cd12873155 cd12873, SPRY_DDX1, SPRY domain associated with DE 4e-33
pfam13671143 pfam13671, AAA_33, AAA domain 1e-26
cd11709118 cd11709, SPRY, SPRY domain 2e-11
pfam00622125 pfam00622, SPRY, SPRY domain 9e-11
cd12872149 cd12872, SPRY_Ash2, SPRY domain in Ash2 2e-10
cd12885132 cd12885, SPRY_RanBP_like, SPRY domain in Ran bindi 2e-08
smart00449122 smart00449, SPRY, Domain in SPla and the RYanodine 3e-08
TIGR03574249 TIGR03574, selen_PSTK, L-seryl-tRNA(Sec) kinase, a 4e-08
cd12876187 cd12876, SPRY_SOCS3, SPRY domain in the suppressor 1e-07
COG4639168 COG4639, COG4639, Predicted kinase [General functi 3e-06
cd12875171 cd12875, SPRY_SOCS_Fbox, SPRY domain in Fbxo45 and 1e-05
cd12886128 cd12886, SPRY_like, SPRY domain-like in bacteria 3e-04
cd12909153 cd12909, SPRY_RanBP9_10, SPRY domain in Ran bindin 5e-04
cd12907175 cd12907, SPRY_Fbox, SPRY domain in the F-box famil 0.001
cd12882128 cd12882, SPRY_RNF123, SPRY domain at N-terminus of 0.001
cd12906174 cd12906, SPRY_SOCS1-2-4, SPRY domain in the suppre 0.001
pfam06414191 pfam06414, Zeta_toxin, Zeta toxin 0.002
cd12878133 cd12878, SPRY2_RyR, SPRY domain 2 (SPRY2) of ryano 0.003
>gnl|CDD|240464 cd12884, SPRY_hnRNP, SPRY domain in heterogeneous nuclear ribonucleoprotein U-like (hnRNP) protein 1 Back     alignment and domain information 
 Score =  215 bits (551), Expect = 2e-66
 Identities = 80/188 (42%), Positives = 100/188 (53%), Gaps = 16/188 (8%)

Query: 44  VVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVD 103
           VVL+  + DL   I  +GL +  L  EGFAY W+GARA  G+  GK CF  K++   PV 
Sbjct: 1   VVLDWYNSDLHLKISKDGLSAEPLTDEGFAYLWAGARATYGVRKGKVCFEVKVLENLPVK 60

Query: 104 MEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTI 163
              T     HV RVG S     + +LGE + S+G+G TGK S  G F ++GE FG GD I
Sbjct: 61  HLPTEETDPHVVRVGWSVDSSSL-QLGEEKLSYGYGSTGKKSTNGKFEDYGEPFGEGDVI 119

Query: 164 ICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKN 223
            C +DLES+P   I F KNGK LG A + D    G               A+FPHIL KN
Sbjct: 120 GCYLDLESEP-VEISFTKNGKDLGVAFRIDKELEG--------------KALFPHILTKN 164

Query: 224 VVVVMQFS 231
             V + F 
Sbjct: 165 CAVEVNFG 172

This domain, consisting of the distinct N-terminal PRY subdomain followed by the SPRY subdomain, is found at the C-terminus of heterogeneous nuclear ribonucleoprotein U-like (hnRNP) protein 1 (also known as HNRPUL1 ) which is a major constituent of nuclear matrix or scaffold and binds directly to DNA sequences through the N-terminal acidic region named serum amyloid P (SAP). Its function is specifically modulated by E1B-55kDa in adenovirus-infected cells. HNRPUL1 also participates in ATR protein kinase signaling pathways during adenovirus infection. Two transcript variants encoding different isoforms have been found for this gene. When associated with bromodomain-containing protein 7 (BRD7), it activates transcription of glucocorticoid-responsive promoter in the absence of ligand-stimulation. Length = 176
>gnl|CDD|240453 cd12873, SPRY_DDX1, SPRY domain associated with DEAD box gene DDX1 Back     alignment and domain information
>gnl|CDD|222307 pfam13671, AAA_33, AAA domain Back     alignment and domain information
>gnl|CDD|240451 cd11709, SPRY, SPRY domain Back     alignment and domain information
>gnl|CDD|216029 pfam00622, SPRY, SPRY domain Back     alignment and domain information
>gnl|CDD|240452 cd12872, SPRY_Ash2, SPRY domain in Ash2 Back     alignment and domain information
>gnl|CDD|240465 cd12885, SPRY_RanBP_like, SPRY domain in Ran binding proteins, SSH4, HECT E3 and SPRYD3 Back     alignment and domain information
>gnl|CDD|214669 smart00449, SPRY, Domain in SPla and the RYanodine Receptor Back     alignment and domain information
>gnl|CDD|132613 TIGR03574, selen_PSTK, L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>gnl|CDD|240456 cd12876, SPRY_SOCS3, SPRY domain in the suppressor of cytokine signaling 3 (SOCS3) family Back     alignment and domain information
>gnl|CDD|226986 COG4639, COG4639, Predicted kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|240455 cd12875, SPRY_SOCS_Fbox, SPRY domain in Fbxo45 and suppressors of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|240466 cd12886, SPRY_like, SPRY domain-like in bacteria Back     alignment and domain information
>gnl|CDD|240489 cd12909, SPRY_RanBP9_10, SPRY domain in Ran binding proteins 9 and 10 Back     alignment and domain information
>gnl|CDD|240487 cd12907, SPRY_Fbox, SPRY domain in the F-box family Fbxo45 Back     alignment and domain information
>gnl|CDD|240462 cd12882, SPRY_RNF123, SPRY domain at N-terminus of ring finger protein 123 Back     alignment and domain information
>gnl|CDD|240486 cd12906, SPRY_SOCS1-2-4, SPRY domain in the suppressor of cytokine signaling 1, 2, 4 families (SOCS1, SOCS2, SOCS4) Back     alignment and domain information
>gnl|CDD|219014 pfam06414, Zeta_toxin, Zeta toxin Back     alignment and domain information
>gnl|CDD|240458 cd12878, SPRY2_RyR, SPRY domain 2 (SPRY2) of ryanodine receptor (RyR) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 688
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 100.0
KOG2626544 consensus Histone H3 (Lys4) methyltransferase comp 99.94
PF00622124 SPRY: SPRY domain; InterPro: IPR003877 The SPRY do 99.83
smart00449122 SPRY Domain in SPla and the RYanodine Receptor. Do 99.82
KOG2242558 consensus Scaffold/matrix specific factor hnRNP-U/ 99.81
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 99.8
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 99.8
COG4088261 Predicted nucleotide kinase [Nucleotide transport 99.76
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 99.75
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 99.71
COG4639168 Predicted kinase [General function prediction only 99.69
KOG3953242 consensus SOCS box protein SSB-1, contains SPRY do 99.64
PHA02530300 pseT polynucleotide kinase; Provisional 99.61
KOG2243 5019 consensus Ca2+ release channel (ryanodine receptor 99.61
COG0645170 Predicted kinase [General function prediction only 99.6
KOG4030197 consensus Uncharacterized conserved protein, conta 99.59
PRK06762166 hypothetical protein; Provisional 99.56
KOG3062281 consensus RNA polymerase II elongator associated p 99.52
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 99.49
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 99.49
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 99.41
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 99.38
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 99.32
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 99.32
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 99.31
PRK12339197 2-phosphoglycerate kinase; Provisional 99.26
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 99.2
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 99.17
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 99.14
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 99.13
PRK11545163 gntK gluconate kinase 1; Provisional 99.1
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 99.09
KOG2243 5019 consensus Ca2+ release channel (ryanodine receptor 99.07
PRK09825176 idnK D-gluconate kinase; Provisional 99.06
PRK14527191 adenylate kinase; Provisional 99.06
KOG4367699 consensus Predicted Zn-finger protein [Function un 99.05
PRK14532188 adenylate kinase; Provisional 98.99
PRK14531183 adenylate kinase; Provisional 98.99
PRK00889175 adenylylsulfate kinase; Provisional 98.97
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 98.96
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 98.96
PRK01184184 hypothetical protein; Provisional 98.95
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 98.94
COG4185187 Uncharacterized protein conserved in bacteria [Fun 98.93
PRK05541176 adenylylsulfate kinase; Provisional 98.93
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 98.91
PLN02200234 adenylate kinase family protein 98.9
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 98.9
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 98.88
PRK14737186 gmk guanylate kinase; Provisional 98.86
PRK03846198 adenylylsulfate kinase; Provisional 98.83
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 98.83
PRK12337475 2-phosphoglycerate kinase; Provisional 98.79
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.77
PRK00279215 adk adenylate kinase; Reviewed 98.75
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 98.69
PRK00131175 aroK shikimate kinase; Reviewed 98.66
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 98.66
PRK14530215 adenylate kinase; Provisional 98.65
KOG4622291 consensus Predicted nucleotide kinase [General fun 98.65
PRK13946184 shikimate kinase; Provisional 98.63
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 98.63
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.62
PRK12338319 hypothetical protein; Provisional 98.62
KOG2134422 consensus Polynucleotide kinase 3' phosphatase [Re 98.62
KOG3079195 consensus Uridylate kinase/adenylate kinase [Nucle 98.59
PRK14738206 gmk guanylate kinase; Provisional 98.58
PRK02496184 adk adenylate kinase; Provisional 98.57
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 98.56
PRK08356195 hypothetical protein; Provisional 98.55
PRK00625173 shikimate kinase; Provisional 98.54
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 98.52
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.51
PLN02772398 guanylate kinase 98.51
KOG1477469 consensus SPRY domain-containing proteins [General 98.51
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 98.5
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 98.48
PRK04220301 2-phosphoglycerate kinase; Provisional 98.48
PRK14528186 adenylate kinase; Provisional 98.47
PLN02674244 adenylate kinase 98.47
PRK13947171 shikimate kinase; Provisional 98.45
PRK00300205 gmk guanylate kinase; Provisional 98.45
PRK13808333 adenylate kinase; Provisional 98.44
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 98.41
PRK07261171 topology modulation protein; Provisional 98.4
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 98.39
PRK03839180 putative kinase; Provisional 98.39
PRK00698205 tmk thymidylate kinase; Validated 98.39
PRK06217183 hypothetical protein; Validated 98.38
PF08303168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 98.37
PRK04040188 adenylate kinase; Provisional 98.36
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 98.35
PRK04182180 cytidylate kinase; Provisional 98.32
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 98.31
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 98.3
PRK14529223 adenylate kinase; Provisional 98.29
PTZ00088229 adenylate kinase 1; Provisional 98.29
PRK05057172 aroK shikimate kinase I; Reviewed 98.28
PRK14730195 coaE dephospho-CoA kinase; Provisional 98.28
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 98.28
PRK08118167 topology modulation protein; Reviewed 98.25
PRK13948182 shikimate kinase; Provisional 98.23
PRK06547172 hypothetical protein; Provisional 98.22
PRK13973213 thymidylate kinase; Provisional 98.22
PRK05480209 uridine/cytidine kinase; Provisional 98.22
PRK03731171 aroL shikimate kinase II; Reviewed 98.21
PRK00081194 coaE dephospho-CoA kinase; Reviewed 98.2
COG0703172 AroK Shikimate kinase [Amino acid transport and me 98.18
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 98.18
PLN02459261 probable adenylate kinase 98.17
TIGR00152188 dephospho-CoA kinase. This model produces scores i 98.15
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 98.15
PRK13949169 shikimate kinase; Provisional 98.14
PRK14731208 coaE dephospho-CoA kinase; Provisional 98.12
PRK14526211 adenylate kinase; Provisional 98.09
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 98.09
TIGR00235207 udk uridine kinase. Model contains a number of lon 98.07
PRK08233182 hypothetical protein; Provisional 98.07
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 98.07
PLN02422232 dephospho-CoA kinase 98.06
PRK08154309 anaerobic benzoate catabolism transcriptional regu 98.05
PRK06696223 uridine kinase; Validated 98.04
PTZ00451244 dephospho-CoA kinase; Provisional 98.02
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 98.01
PRK06761282 hypothetical protein; Provisional 97.98
PTZ00301210 uridine kinase; Provisional 97.98
PRK14732196 coaE dephospho-CoA kinase; Provisional 97.97
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 97.93
PRK14734200 coaE dephospho-CoA kinase; Provisional 97.92
COG1936180 Predicted nucleotide kinase (related to CMP and AM 97.91
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 97.89
PRK13975196 thymidylate kinase; Provisional 97.85
PLN02924220 thymidylate kinase 97.82
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 97.81
PRK13974212 thymidylate kinase; Provisional 97.78
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 97.74
PRK14733204 coaE dephospho-CoA kinase; Provisional 97.74
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 97.74
PRK13951488 bifunctional shikimate kinase/3-dehydroquinate syn 97.73
KOG0234438 consensus Fructose-6-phosphate 2-kinase/fructose-2 97.71
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.71
PLN02199303 shikimate kinase 97.66
PLN02842505 nucleotide kinase 97.64
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 97.54
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 97.53
PRK07667193 uridine kinase; Provisional 97.49
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 97.48
PLN02348395 phosphoribulokinase 97.48
PLN02165334 adenylate isopentenyltransferase 97.47
PRK13976209 thymidylate kinase; Provisional 97.47
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 97.45
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 97.45
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 97.44
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 97.43
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 97.42
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.39
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 97.37
COG3709192 Uncharacterized component of phosphonate metabolis 97.37
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 97.36
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 97.29
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 97.28
PF00004132 AAA: ATPase family associated with various cellula 97.27
PRK07933213 thymidylate kinase; Validated 97.22
COG3896205 Chloramphenicol 3-O-phosphotransferase [Defense me 97.19
PLN02318 656 phosphoribulokinase/uridine kinase 97.19
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.18
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 97.15
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 97.09
KOG3078235 consensus Adenylate kinase [Nucleotide transport a 97.08
PRK09087226 hypothetical protein; Validated 97.08
PRK00023225 cmk cytidylate kinase; Provisional 97.07
PRK09270229 nucleoside triphosphate hydrolase domain-containin 97.01
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 96.99
PRK05439311 pantothenate kinase; Provisional 96.99
PRK07429327 phosphoribulokinase; Provisional 96.98
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 96.97
PHA03132580 thymidine kinase; Provisional 96.96
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 96.91
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.91
KOG3877393 consensus NADH:ubiquinone oxidoreductase, NDUFA10/ 96.89
CHL00181287 cbbX CbbX; Provisional 96.88
PHA00729226 NTP-binding motif containing protein 96.87
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.81
PRK15453290 phosphoribulokinase; Provisional 96.79
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.72
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.68
PRK06893229 DNA replication initiation factor; Validated 96.65
PRK14086617 dnaA chromosomal replication initiation protein; P 96.63
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.61
cd03115173 SRP The signal recognition particle (SRP) mediates 96.6
KOG0707231 consensus Guanylate kinase [Nucleotide transport a 96.6
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.59
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 96.57
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 96.55
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.55
PRK08084235 DNA replication initiation factor; Provisional 96.54
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.52
PRK00149450 dnaA chromosomal replication initiation protein; R 96.52
KOG1477469 consensus SPRY domain-containing proteins [General 96.5
smart00382148 AAA ATPases associated with a variety of cellular 96.5
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.47
PRK10867433 signal recognition particle protein; Provisional 96.47
TIGR00959428 ffh signal recognition particle protein. This mode 96.46
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.46
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 96.45
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 96.43
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.42
PRK00771437 signal recognition particle protein Srp54; Provisi 96.4
KOG0780483 consensus Signal recognition particle, subunit Srp 96.39
PLN03025319 replication factor C subunit; Provisional 96.38
PRK14974336 cell division protein FtsY; Provisional 96.35
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 96.33
PRK08099399 bifunctional DNA-binding transcriptional repressor 96.29
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.29
PRK08727233 hypothetical protein; Validated 96.25
PRK06620214 hypothetical protein; Validated 96.24
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 96.21
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.18
PRK05642234 DNA replication initiation factor; Validated 96.17
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 96.14
COG1660286 Predicted P-loop-containing kinase [General functi 96.13
KOG3308225 consensus Uncharacterized protein of the uridine k 96.12
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 96.12
KOG1384348 consensus tRNA delta(2)-isopentenylpyrophosphate t 96.12
PF13173128 AAA_14: AAA domain 96.11
TIGR00064272 ftsY signal recognition particle-docking protein F 96.09
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.06
PRK14088440 dnaA chromosomal replication initiation protein; P 96.04
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 95.88
PRK10416318 signal recognition particle-docking protein FtsY; 95.85
COG5324758 Uncharacterized conserved protein [Function unknow 95.84
COG2256436 MGS1 ATPase related to the helicase subunit of the 95.84
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 95.77
COG2884223 FtsE Predicted ATPase involved in cell division [C 95.77
PF1324576 AAA_19: Part of AAA domain 95.76
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.76
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 95.68
COG0552340 FtsY Signal recognition particle GTPase [Intracell 95.67
cd03246173 ABCC_Protease_Secretion This family represents the 95.64
PRK12402337 replication factor C small subunit 2; Reviewed 95.64
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 95.63
PRK13695174 putative NTPase; Provisional 95.63
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.62
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 95.62
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 95.62
PRK12422445 chromosomal replication initiation protein; Provis 95.6
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 95.59
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 95.57
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 95.54
PRK04195482 replication factor C large subunit; Provisional 95.49
PRK08116268 hypothetical protein; Validated 95.46
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 95.45
PRK13342413 recombination factor protein RarA; Reviewed 95.45
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 95.45
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 95.43
PRK09183259 transposase/IS protein; Provisional 95.41
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 95.4
PRK12377248 putative replication protein; Provisional 95.38
PLN02840421 tRNA dimethylallyltransferase 95.36
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 95.33
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.33
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 95.32
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 95.3
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 95.28
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.27
KOG1533290 consensus Predicted GTPase [General function predi 95.26
KOG4238 627 consensus Bifunctional ATP sulfurylase/adenosine 5 95.22
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.2
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 95.17
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.17
PHA02544316 44 clamp loader, small subunit; Provisional 95.13
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.13
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.11
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.1
cd03269210 ABC_putative_ATPase This subfamily is involved in 95.09
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.08
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 95.04
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.03
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.03
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 95.02
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.02
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 95.0
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 94.98
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 94.96
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 94.95
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 94.95
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 94.94
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 94.92
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.91
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 94.91
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 94.9
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 94.88
PLN02748468 tRNA dimethylallyltransferase 94.86
KOG1969 877 consensus DNA replication checkpoint protein CHL12 94.83
PRK08181269 transposase; Validated 94.8
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 94.75
PRK03992389 proteasome-activating nucleotidase; Provisional 94.74
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 94.74
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 94.74
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 94.73
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 94.71
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 94.7
PF05729166 NACHT: NACHT domain 94.69
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 94.63
cd03215182 ABC_Carb_Monos_II This family represents domain II 94.55
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 94.54
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 94.54
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 94.51
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 94.51
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 94.5
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 94.5
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.48
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 94.48
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 94.44
COG3911183 Predicted ATPase [General function prediction only 94.42
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 94.41
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 94.4
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 94.39
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 94.38
COG1126240 GlnQ ABC-type polar amino acid transport system, A 94.37
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 94.36
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 94.35
PRK06526254 transposase; Provisional 94.35
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 94.33
PRK13894319 conjugal transfer ATPase TrbB; Provisional 94.32
COG4619223 ABC-type uncharacterized transport system, ATPase 94.29
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.28
PRK13833323 conjugal transfer protein TrbB; Provisional 94.28
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 94.27
PHA02244383 ATPase-like protein 94.24
PRK06067234 flagellar accessory protein FlaH; Validated 94.19
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 94.18
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 94.18
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 94.18
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 94.17
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 94.16
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 94.13
PRK07952244 DNA replication protein DnaC; Validated 94.13
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 94.1
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 94.07
PLN02796347 D-glycerate 3-kinase 94.04
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 94.01
COG1618179 Predicted nucleotide kinase [Nucleotide transport 93.96
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 93.93
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 93.93
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 93.93
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 93.92
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 93.91
PRK06921266 hypothetical protein; Provisional 93.87
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 93.86
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 93.86
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 93.81
KOG0734752 consensus AAA+-type ATPase containing the peptidas 93.8
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 93.78
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 93.77
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 93.77
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 93.76
CHL00195489 ycf46 Ycf46; Provisional 93.75
CHL00095 821 clpC Clp protease ATP binding subunit 93.74
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 93.73
PF13479213 AAA_24: AAA domain 93.7
PHA02575227 1 deoxynucleoside monophosphate kinase; Provisiona 93.69
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 93.68
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 93.67
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 93.66
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 93.65
PRK10865857 protein disaggregation chaperone; Provisional 93.64
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 93.6
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 93.59
PLN03046460 D-glycerate 3-kinase; Provisional 93.59
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 93.58
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 93.53
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 93.53
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 93.51
PRK04328249 hypothetical protein; Provisional 93.5
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 93.49
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 93.48
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 93.45
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 93.39
PRK13341 725 recombination factor protein RarA/unknown domain f 93.39
PTZ00202550 tuzin; Provisional 93.35
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 93.34
PRK00440319 rfc replication factor C small subunit; Reviewed 93.33
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 93.31
PRK09435332 membrane ATPase/protein kinase; Provisional 93.29
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 93.25
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 93.25
PRK10865 857 protein disaggregation chaperone; Provisional 93.23
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 93.23
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 93.22
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 93.21
COG1855604 ATPase (PilT family) [General function prediction 93.16
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 93.13
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 93.13
COG4175386 ProV ABC-type proline/glycine betaine transport sy 93.12
PRK14087450 dnaA chromosomal replication initiation protein; P 93.1
cd03116159 MobB Molybdenum is an essential trace element in t 93.1
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 93.07
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 93.06
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 93.05
PRK05636505 replicative DNA helicase; Provisional 93.02
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 92.99
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 92.99
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 92.97
PF00005137 ABC_tran: ABC transporter This structure is on hol 92.97
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 92.97
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 92.95
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 92.94
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 92.93
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 92.9
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 92.88
COG1341398 Predicted GTPase or GTP-binding protein [General f 92.88
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 92.8
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 92.8
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 92.79
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 92.77
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 92.75
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 92.68
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 92.67
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 92.65
PRK06835329 DNA replication protein DnaC; Validated 92.62
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 92.62
PRK00411394 cdc6 cell division control protein 6; Reviewed 92.59
TIGR00763775 lon ATP-dependent protease La. This protein is ind 92.58
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 92.57
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 92.56
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 92.55
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 92.54
PRK08939306 primosomal protein DnaI; Reviewed 92.52
CHL00176638 ftsH cell division protein; Validated 92.52
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 92.51
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 92.49
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 92.49
cd03112158 CobW_like The function of this protein family is u 92.49
TIGR00101199 ureG urease accessory protein UreG. This model rep 92.43
COG3842352 PotA ABC-type spermidine/putrescine transport syst 92.4
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 92.39
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 92.33
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.32
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 92.31
PRK08533230 flagellar accessory protein FlaH; Reviewed 92.29
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 92.27
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 92.25
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 92.23
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 92.21
PRK08760476 replicative DNA helicase; Provisional 92.21
PRK10790592 putative multidrug transporter membrane\ATP-bindin 92.19
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 92.18
TIGR00665434 DnaB replicative DNA helicase. This model describe 92.12
PRK15064530 ABC transporter ATP-binding protein; Provisional 92.07
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 92.06
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 92.03
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 92.0
PLN03130 1622 ABC transporter C family member; Provisional 92.0
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 91.99
PRK10789569 putative multidrug transporter membrane\ATP-bindin 91.98
PRK13768253 GTPase; Provisional 91.9
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 91.83
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 91.82
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 91.8
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 91.79
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 91.76
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 91.75
cd01394218 radB RadB. The archaeal protein radB shares simila 91.74
PF07726131 AAA_3: ATPase family associated with various cellu 91.72
PRK09165497 replicative DNA helicase; Provisional 91.67
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 91.66
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 91.65
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 91.63
TIGR02237209 recomb_radB DNA repair and recombination protein R 91.61
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 91.61
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 91.6
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 91.58
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 91.57
cd03114148 ArgK-like The function of this protein family is u 91.57
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 91.56
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 91.54
PRK06321472 replicative DNA helicase; Provisional 91.51
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 91.5
TIGR00231161 small_GTP small GTP-binding protein domain. This m 91.5
TIGR00767415 rho transcription termination factor Rho. Members 91.5
PRK13545549 tagH teichoic acids export protein ATP-binding sub 91.48
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 91.48
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 91.46
cd00154159 Rab Rab family. Rab GTPases form the largest famil 91.44
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 91.43
PRK05973237 replicative DNA helicase; Provisional 91.42
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 91.41
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 91.4
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 91.4
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 91.39
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 91.39
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 91.39
cd02034116 CooC The accessory protein CooC, which contains a 91.38
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 91.36
PF1355562 AAA_29: P-loop containing region of AAA domain 91.35
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 91.34
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 91.34
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 91.33
PRK15455 644 PrkA family serine protein kinase; Provisional 91.31
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=9.8e-34  Score=300.85  Aligned_cols=174  Identities=34%  Similarity=0.563  Sum_probs=156.3

Q ss_pred             CCceecCcCCCCCCeEEcCCCceEeecCCCCccceeeeeeeeeeEe-CcEEEEEEEEEecCCCCCCCCCCCCCCcEEEEE
Q 005604           41 KQRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGIN-GGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGT  119 (688)
Q Consensus        41 ~~~v~Ls~~D~~~~l~Is~dgl~v~~~~~~g~~~~w~~vRAn~gv~-~Gk~YfEV~I~~~~~~~~~~t~~~~~g~irVGw  119 (688)
                      ...|++|+.|+++.|.|++|||.+++..    -+.|-+||||.|+. .|||||||+|.+             .|+|||||
T Consensus        86 ~~~w~mn~~Drg~alaI~~dGL~CqSre----~KeWhGcRaT~Gl~gkGK~YyEvtitd-------------~GLCRVGW  148 (725)
T KOG0349|consen   86 PREWKMNKQDRGLALAIDEDGLACQSRE----KKEWHGCRATAGLYGKGKYYYEVTITD-------------KGLCRVGW  148 (725)
T ss_pred             ccccccCccccCceeeEcCCccccchhH----HhhhhccccccccccCceEEEEEEecc-------------Cceeeech
Confidence            3459999999999999999999998753    47899999999999 899999999985             58999999


Q ss_pred             ecCCCCCCCCCCCCcceEEccCCceeeCCCcccCCCCCCCCCEEEEEEecCCCCccEEEEEECCeeeeeeeeccCCCCCc
Q 005604          120 SRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGL  199 (688)
Q Consensus       120 st~~~~~~~lG~d~~SyGy~g~G~~~~~~~~~~YG~~f~~GDVIGC~LDl~~~p~~~I~FtkNG~~LG~Af~~~~~~~~L  199 (688)
                      ||.. .+.-||.+..+|||.|+|++.++.+|.+||++|+..|||||+||+++   ++|+|+|||+.||.||+++...   
T Consensus       149 sT~q-asLdlGt~~~gFGfGGTGkKS~nkqFDdYGe~Ft~~DvIGCyLDld~---~~v~fsKNG~~lg~AF~ip~~~---  221 (725)
T KOG0349|consen  149 STLQ-ASLDLGTGLDGFGFGGTGKKSTNKQFDDYGEPFTLNDVIGCYLDLDS---RTVWFSKNGEQLGAAFSIPVKY---  221 (725)
T ss_pred             hhcc-cccccCccccccccCccCccccccccccccCcccccceeeEEEeccC---ceEEEecCccccceeEEcChhh---
Confidence            9977 46789999999999999999999999999999999999999999999   8999999999999999987543   


Q ss_pred             ccccccccccccCCcceeEEEEcCeEEEEEccCCCCCCC-ccCchhhhhhc
Q 005604          200 GVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIP-VEGYKSWVSAL  249 (688)
Q Consensus       200 ~la~~d~~g~~~~~~lfPaVsl~n~~v~vNFG~~~~~~p-~~gf~p~~~a~  249 (688)
                                 ....|||||.|+|+++.||||.++|.|| -+||.....|.
T Consensus       222 -----------kn~~lfPAvvlkNael~fNFG~~~FKfpPgngFva~s~Ap  261 (725)
T KOG0349|consen  222 -----------KNSNLFPAVVLKNAELSFNFGSQPFKFPPGNGFVAVSDAP  261 (725)
T ss_pred             -----------cccccchheeeccceEEEecCCCccccCCCCceEEeecCC
Confidence                       3578999999999999999999876555 47888777664

>KOG2626 consensus Histone H3 (Lys4) methyltransferase complex, subunit CPS60/ASH2/BRE2 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF00622 SPRY: SPRY domain; InterPro: IPR003877 The SPRY domain is of unknown function Back     alignment and domain information
>smart00449 SPRY Domain in SPla and the RYanodine Receptor Back     alignment and domain information
>KOG2242 consensus Scaffold/matrix specific factor hnRNP-U/SAF-A, contains SPRY domain [RNA processing and modification] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>KOG3953 consensus SOCS box protein SSB-1, contains SPRY domain [General function prediction only] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>KOG4030 consensus Uncharacterized conserved protein, contains SPRY domain [Function unknown] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>KOG4622 consensus Predicted nucleotide kinase [General function prediction only] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] Back     alignment and domain information
>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>KOG1477 consensus SPRY domain-containing proteins [General function prediction only] Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>KOG0234 consensus Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>COG3896 Chloramphenicol 3-O-phosphotransferase [Defense mechanisms] Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3078 consensus Adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PHA03132 thymidine kinase; Provisional Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>KOG0707 consensus Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG1477 consensus SPRY domain-containing proteins [General function prediction only] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>KOG1384 consensus tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG5324 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG4238 consensus Bifunctional ATP sulfurylase/adenosine 5'-phosphosulfate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3911 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query688
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 5e-27
3toj_A213 SET1/ASH2 histone methyltransferase complex subun; 6e-25
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 2e-24
3emw_A217 SPRY domain-containing SOCS box protein 2; apoptos 1e-22
2jk9_A212 SPRY domain-containing SOCS box protein 1; transcr 5e-21
2afj_A226 Gene rich cluster, C9 gene; beta sandwich, gene re 3e-20
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 4e-19
2yyo_A171 SPRY domain-containing protein 3; NPPSFA, national 6e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 7e-10
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 3e-07
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 3e-06
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 6e-06
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 4e-04
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 Back     alignment and structure
 Score =  109 bits (274), Expect = 5e-27
 Identities = 42/220 (19%), Positives = 85/220 (38%), Gaps = 35/220 (15%)

Query: 263 MKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRY--ILLGTNLILEQMKVPGLLRKHNYSE 320
           M D  ++++ GLP  GK+T+++   K   +     I+LG++LI E   V        + E
Sbjct: 1   MGDIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPV--------WKE 52

Query: 321 RFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFR-KIAVVVFPK 379
           +++            L+  A +     I+D TN + S R+  + +   +    A++    
Sbjct: 53  KYE---EFIKKSTYRLIDSALKN-YWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKA 108

Query: 380 PEDLKIRSVKRFKEMGKEVPADAVNNMLANYVLPVNKDTPGSDELFDQVMFV-----ELD 434
             D+    ++R  E G+++P + +  M   +      D PG    +D+   +     ++D
Sbjct: 109 SLDV---LIRRNIERGEKIPNEVIKKMYEKF------DEPGKKYKWDEPFLIIDTTKDID 159

Query: 435 REEAQRHLDEMKGTLGSVSNPNLQANYAPYSHE-NFVKSL 473
             E  + L E          P         +   N    +
Sbjct: 160 FNEIAKKLIEKSK-----EIPKFYVLEENKNKNNNISDKI 194
>3toj_A SET1/ASH2 histone methyltransferase complex subun; transcription, SPRY domain, prote binding, histone methylation, RBBP5, DPY-30, nuclear; 2.07A {Homo sapiens} Length = 213 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 Back     alignment and structure
>3emw_A SPRY domain-containing SOCS box protein 2; apoptosis nucleus, apoptosis, UBL conjugation pathwayc, CL transcription regulation, transcription, phosphoprotein; 1.80A {Homo sapiens} PDB: 3ek9_A Length = 217 Back     alignment and structure
>2jk9_A SPRY domain-containing SOCS box protein 1; transcription regulation, transcription; 1.79A {Homo sapiens} PDB: 3f2o_A 2fnj_A 2v24_A 2ihs_A Length = 212 Back     alignment and structure
>2afj_A Gene rich cluster, C9 gene; beta sandwich, gene regulation; NMR {Mus musculus} SCOP: b.29.1.22 Length = 226 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 Back     alignment and structure
>2yyo_A SPRY domain-containing protein 3; NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} Length = 171 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Length = 416 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 253 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Length = 287 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 688
d2fnja1217 b.29.1.22 (A:35-251) LD34464p {Fruit fly (Drosophi 5e-17
d2afja1213 b.29.1.22 (A:12-224) SPRY domain-containing SOCS b 5e-14
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 2e-10
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 1e-08
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 8e-04
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 0.001
d1m7ga_208 c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (A 0.002
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 0.003
>d2fnja1 b.29.1.22 (A:35-251) LD34464p {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 217 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: SPRY domain
domain: LD34464p
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score = 78.3 bits (192), Expect = 5e-17
 Identities = 27/151 (17%), Positives = 50/151 (33%), Gaps = 13/151 (8%)

Query: 46  LNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQP---- 101
            N  D  L+  ++++   +   H+   A      R  VG+  G + +     + Q     
Sbjct: 26  WNSEDRSLNIFVKEDDKLT--FHRHPVAQSTDCIRGKVGLTKGLHIWEIYWPTRQRGTHA 83

Query: 102 ---VDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFG 158
              V   D P        +  S  +   G      + +              L   E F 
Sbjct: 84  VVGVCTADAPLHSVGYQSLVGST-EQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFL 142

Query: 159 VGDTIICAIDLESKPLATIGFAKNGKWLGTA 189
           V D  + A+D++     T+ F  + ++LG A
Sbjct: 143 VPDKFLVALDMDEG---TLSFIVDQQYLGIA 170
>d2afja1 b.29.1.22 (A:12-224) SPRY domain-containing SOCS box protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 213 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 208 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query688
d2fnja1217 LD34464p {Fruit fly (Drosophila melanogaster) [Tax 99.97
d2afja1213 SPRY domain-containing SOCS box protein 2 {Mouse ( 99.96
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 99.95
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 99.81
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 99.57
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 99.56
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 99.51
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 99.4
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 99.4
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 99.38
d2fbea1188 Similar to Ret finger protein-like 1 {Human (Homo 99.35
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 99.34
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 99.28
d2iwgb1179 52 kDa Ro protein {Human (Homo sapiens) [TaxId: 96 99.27
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 99.21
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 99.09
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 99.03
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 99.02
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 98.98
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.94
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.93
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 98.91
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 98.91
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.89
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.88
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.88
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 98.87
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 98.82
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 98.81
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.8
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 98.77
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 98.74
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 98.67
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.62
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.62
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 98.54
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 98.48
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.47
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.47
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 98.46
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.42
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 98.38
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.37
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 98.29
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 98.25
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 98.23
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 98.04
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 98.01
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 97.98
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.86
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 97.83
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.77
d2qy9a2211 GTPase domain of the signal recognition particle r 97.76
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.74
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.65
d1vmaa2213 GTPase domain of the signal recognition particle r 97.6
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 97.6
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.57
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.5
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 97.42
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 97.39
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 97.31
d1okkd2207 GTPase domain of the signal recognition particle r 97.23
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.2
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 97.19
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.17
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 97.15
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.08
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.05
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.01
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.94
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.87
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.85
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.85
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.81
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.73
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.71
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.67
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.64
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 96.61
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 96.54
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.54
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.4
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 96.39
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.38
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.35
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.35
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.29
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.28
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.23
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.15
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.09
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.08
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.05
d2hyda1255 Putative multidrug export ATP-binding/permease pro 95.97
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.81
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.52
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.42
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.3
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.28
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.26
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.26
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.23
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.17
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.14
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.95
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.92
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.92
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.85
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.83
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.66
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.61
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.51
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.49
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.32
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 94.31
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 94.26
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.23
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.12
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.09
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.06
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 94.04
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.95
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.92
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.82
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 93.59
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 93.5
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 93.45
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.37
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.37
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.31
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 93.28
d1g2912240 Maltose transport protein MalK, N-terminal domain 93.24
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.21
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.19
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 93.16
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 93.09
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 93.07
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.06
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 92.99
d2awna2232 Maltose transport protein MalK, N-terminal domain 92.98
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 92.96
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.96
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.89
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.88
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.87
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 92.87
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.81
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.76
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.74
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 92.73
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.61
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 92.51
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.44
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.4
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.38
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.33
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 92.32
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.27
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.25
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 92.17
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 92.11
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.03
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 92.0
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.96
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.95
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 91.95
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.91
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 91.87
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 91.82
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.67
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 91.66
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 91.66
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 91.61
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 91.61
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 91.55
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 91.5
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 91.49
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 91.46
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.45
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 91.42
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 91.19
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 91.14
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 91.09
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 91.07
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.9
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 90.84
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 90.78
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 90.75
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.65
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 90.64
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.64
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.48
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 90.43
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.38
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 90.29
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 90.25
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 90.24
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 90.22
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.18
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 90.13
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 90.1
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 90.06
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.87
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.83
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.79
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 89.66
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 89.65
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 89.37
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 89.21
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 88.98
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 88.97
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 88.93
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.93
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 88.83
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 88.78
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 88.78
d1tuea_205 Replication protein E1 helicase domain {Human papi 88.68
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 88.6
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 88.19
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 87.99
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 87.67
d2axpa1164 Hypothetical protein YorR {Bacillus subtilis [TaxI 87.22
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 87.06
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 86.84
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 86.22
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 85.93
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 85.69
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 85.57
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 85.22
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 84.67
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 84.49
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 84.46
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 84.42
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 84.34
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 83.95
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.81
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 82.98
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 81.79
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 81.76
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 81.2
d1xpua3289 Transcription termination factor Rho, ATPase domai 81.0
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 80.31
>d2fnja1 b.29.1.22 (A:35-251) LD34464p {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: SPRY domain
domain: LD34464p
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.97  E-value=1e-30  Score=199.40  Aligned_cols=162  Identities=23%  Similarity=0.331  Sum_probs=132.4

Q ss_pred             CCCEECCCCCCCCCEEECCCCCEEEECCCCCCCCEEEEEEEEEEEECCEEEEEEEEEECCCCCCCCCCCCCCCCEEEEEE
Q ss_conf             87066186899998599279954860678986301100665256739579999999831788889999999981899772
Q 005604           41 KQRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTS  120 (688)
Q Consensus        41 ~~~v~Ls~~d~~~~l~Is~dglsv~~~~~~g~~~~w~~vRAn~gv~~Gk~YfEV~I~~~~~~~~~~t~~~~~g~irVGws  120 (688)
                      ...+.||+.|++.++.|++|++.+...  +..+.+|++||++.|+.+|||||||+|....          ....+.|||+
T Consensus        21 ~~~~~wn~~~~~~~~~ls~~~~~~~~~--~~~~~~~~~vrgt~g~ssGk~YWEV~v~~~~----------~~~~~~IGV~   88 (217)
T d2fnja1          21 QLKHSWNSEDRSLNIFVKEDDKLTFHR--HPVAQSTDCIRGKVGLTKGLHIWEIYWPTRQ----------RGTHAVVGVC   88 (217)
T ss_dssp             HHHTSEEEEEECTTEEEETTEEEEEEE--CCCTTEEEEEEESCCBCSSEEEEEEECCGGG----------CTTCCEEEEE
T ss_pred             CCCCCCCHHCCCCCEEEECCCCEEEEE--CCCCCCCCEEEECCCCCCCCEEEEEEEECCC----------CCCEEEEEEE
T ss_conf             455537800178877981899369985--8865447748876454587389999991278----------9870589999


Q ss_pred             CCCCC------CCCCCCCCCCEEECC-CCCEEECCCC---------CCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCE
Q ss_conf             69999------998788996258805-8933539876---------4689998889989999836899950799987871
Q 005604          121 RGDDP------VGKLGETEQSFGFGG-TGKFSHGGNF---------LNFGEKFGVGDTIICAIDLESKPLATIGFAKNGK  184 (688)
Q Consensus       121 t~~~~------~~~lG~d~~Sygy~g-~G~~~~~~~~---------~~yG~~f~~GDVIGc~LDl~~~p~~~I~FtkNG~  184 (688)
                      +.++.      ...+|.+.+||+|.. +|.++|++..         ..||.+|..||||||+||++.   ++|+|+|||+
T Consensus        89 ~~~~~~~~~~~~~~~G~~~~s~~~~~~~g~~~~~~~~~~~~~~~~~~~~g~~~~~gDvIGV~LD~d~---gtLsF~kNG~  165 (217)
T d2fnja1          89 TADAPLHSVGYQSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVALDMDE---GTLSFIVDQQ  165 (217)
T ss_dssp             CTTSCSEEESSCCCTTSSTTEEEEETTTTEEEESTTTSCCEESSTTCCTTCCCCCCSEEEEEEETTT---TEEEEEETTE
T ss_pred             ECCCCCCCCCCCCCCCCCCCCCEEECCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCC---CEEEEEECCE
T ss_conf             4465744577534336788763374499879824888564325754456776679999999996799---8899999997


Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEEEC--CEEEEEECCCCC
Q ss_conf             22210110379899642121000023688614389890--859999814789
Q 005604          185 WLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLK--NVVVVMQFSVEQ  234 (688)
Q Consensus       185 ~LG~Af~~~~~~~~L~l~~~dv~gr~~~~~lFPaVsl~--n~~v~vNFG~~~  234 (688)
                      +||+||+   +   |           .+..|||+|+..  +++|.++|....
T Consensus       166 ~lGvAf~---~---l-----------~~~~lyP~vs~~~~~~~v~~~~~~~~  200 (217)
T d2fnja1         166 YLGIAFR---G---L-----------RGKKLYPIVSAVWGHCEITMRYIGGL  200 (217)
T ss_dssp             EEEEEEC---C---C-----------TTCCBEEEEEECCTTCEEEEEEEEEE
T ss_pred             EEEEEEE---C---C-----------CCCEEEEEEEECCCCCEEEEEECCCC
T ss_conf             9567773---7---9-----------99818889995358848999976876
>d2afja1 b.29.1.22 (A:12-224) SPRY domain-containing SOCS box protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fbea1 b.29.1.22 (A:1-188) Similar to Ret finger protein-like 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2iwgb1 b.29.1.22 (B:4-182) 52 kDa Ro protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure