Citrus Sinensis ID: 005619


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------69
MSSNQLSGILPSVIANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQVKIENCLPTFQLKVLSLPNCNLGVIPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTKLEVLYLTNNSFSGFQLTSAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNISKNSFEGNIPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIFPNYVNLTRLLFLYLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSWMGNFSNLYILSMSKNLLEGNIPVQFNNLAILQILDISENNLSGSMISTLNLSSVEHLYLQSNALGGSIPNTIFRGSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPACITNLLFWKVGSRYLSGFVMVVMDLGVADIRNYYNSTVQLSLDGIDGRSLGTQVEVNFMTKNRYESYKGVILDYMAGLDLSSNKLTGDIPSEICDLQNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLTELHSLSKFDVSYNDLSGPIPDKEQFSTFDESSYRGNLHLCGPPINKSCTNLLELLETSSKGAEDESAVDMVAFYWSFVASCVTVMLGLLAILWVNPYWRRLWFYFIEECIDLCYYWLFKYVFYW
cccccccccccHHHHccccccEEEcccccccccccccccccccccccEEEcccccccccEEcccccccccccEEEccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccEEEccccccEEEccccHHcccccccEEEcccccccccccccccccccccEEEccccccEEEcccccccccccccEEEccccEEEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccEEEEEccccccccccccEEEccccccEEcccccccccccccEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccEEcccccccccccccccEEEccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccEEEEEEEEccccEEEccccccccEEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEEEEEEEEEHccccHHHHHHHHHHHHHcEEEEEEEEEEEcc
cccccccccccHHHcccccccEEEcccccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHHcccccccEEEcccccccccccHHHcccccEEEEccccccccccHHHHHccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccEEEEcccccccccccHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEcccccccccccccccccEEEcccccccccccccHcHHHHHHHHHHccccccccccccccccHHHEEHHHccccccccccccccccEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHcccHHHccHHHcccccEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccc
mssnqlsgilPSVIANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQVKIENCLPTFQLKvlslpncnlgvipnflLHQFNlkyldlshnklagnfptwllenntkLEVLYLTNnsfsgfqlTSAQHGLisldissnnftgklpqnmgivlpkldcmnisknsfegnipssigkmqglrlldvssnkfagelsqspvtncfsLEWLQlsnnnfdgqifpnyVNLTRLLFLYLdnnhfsgkikdgllrsSELMVLDISnnhlsghipswmgnfSNLYILSMSKNllegnipvqfnnLAILQILDisennlsgsmisTLNLSSVEHLYLQSnalggsipntifrgsaletldlrdnyffgriphqinEHSNLRALLLRGnylqgpiphqlcqLRKLSImdlshnrlngsipaCITNLLFWKVGSRYLSGFVMVVMDLGVADIRNYYNSTVqlsldgidgrslgtQVEVNFMTKNRYESYKGVILDYMAgldlssnkltgdipseicdlqnihglnlshnflsgsipesfsnlkMIESLDlshnklngqippqltelhslskfdvsyndlsgpipdkeqfstfdessyrgnlhlcgppinksCTNLLELLETsskgaedesaVDMVAFYWSFVASCVTVMLGLLAILWVNPYWRRLWFYFIEECIDLCYYWLFKYVFYW
mssnqlsgiLPSVIANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQVKIENCLPTFQLKVLSLPNCNLGVIPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTKLEVLYLTNNSFSGFQLTSAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNISKNSFEGNIPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIFPNYVNLTRLLFLYLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSWMGNFSNLYILSMSKNLLEGNIPVQFNNLAILQILDISENNLSGSMISTLNLSSVEHLYLQSNALGGSIPNTIFRGSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPACITNLLFWKVGSRYLSGFVMVVMDLGVADIRNYYNSTVQlsldgidgrsLGTQVEVNFMTKNRYESYKGVILDYMAGLDLSSNKLTGDIPSEICDLQNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLTELHSLSKFDVSYNDLSGPIPDKEQFSTFDESSYRGNLHLCGPPINKSCTNLLELLETSSKGAEDESAVDMVAFYWSFVASCVTVMLGLLAILWVNPYWRRLWFYFIEECIDLCYYWLFKYVFYW
MSSNQLSGILPSVIANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQVKIENCLPTFQLKVLSLPNCNLGVIPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTKLEVLYLTNNSFSGFQLTSAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNISKNSFEGNIPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIFPNYVNLTRLLFLYLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSWMGNFSNLYILSMSKNLLEGNIPVQFNNLAILQILDISENNLSGSMISTLNLSSVEHLYLQSNALGGSIPNTIFRGSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPACITNLLFWKVGSRYLSGFVMVVMDLGVADIRNYYNSTVQLSLDGIDGRSLGTQVEVNFMTKNRYESYKGVILDYMAGLDLSSNKLTGDIPSEICDLQNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLTELHSLSKFDVSYNDLSGPIPDKEQFSTFDESSYRGNLHLCGPPINKSCTNLLELLETSSKGAEDESAVDMVAFYWSFVASCVTVMLGLLAILWVNPYWRRLWFYFIEECIDLCYYWLFKYVFYW
*******GILPSVIANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQVKIENCLPTFQLKVLSLPNCNLGVIPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTKLEVLYLTNNSFSGFQLTSAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNISKNSFEGNIPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIFPNYVNLTRLLFLYLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSWMGNFSNLYILSMSKNLLEGNIPVQFNNLAILQILDISENNLSGSMISTLNLSSVEHLYLQSNALGGSIPNTIFRGSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPACITNLLFWKVGSRYLSGFVMVVMDLGVADIRNYYNSTVQLSLDGIDGRSLGTQVEVNFMTKNRYESYKGVILDYMAGLDLSSNKLTGDIPSEICDLQNIHGLNLSHNFLSGSIPESFSNLKMIESL***********************FDV**********************YRGNLHLCGPPINKSCTNLLELLE**********AVDMVAFYWSFVASCVTVMLGLLAILWVNPYWRRLWFYFIEECIDLCYYWLFKYVFYW
MSSNQLSGILPSVIANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQVKIENCLPTFQLKVLSLPNCNLGVIPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTKLEVLYLTNNSFSGFQLTSAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNISKNSFEGNIPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIFPNYVNLTRLLFLYLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSWMGNFSNLYILSMSKNLLEGNIPVQFNNLAILQILDISENNLSGSMISTLNLSSVEHLYLQSNALGGSIPNTIFRGSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPACITNLLFWKVGSRYLSGFVMVVMDLGVADIRNYYNSTVQLSLDGIDGRSLGTQVEVNFMTKNRYESYKGVILDYMAGLDLSSNKLTGDIPSEICDLQNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLTELHSLSKFDVSYNDLSGPIPDKEQFSTFDESSYRGNLHLCGPP****************************AFYWSFVASCVTVMLGLLAILWVNPYWRRLWFYFIEECIDLCYYWLFKYVFYW
MSSNQLSGILPSVIANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQVKIENCLPTFQLKVLSLPNCNLGVIPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTKLEVLYLTNNSFSGFQLTSAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNISKNSFEGNIPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIFPNYVNLTRLLFLYLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSWMGNFSNLYILSMSKNLLEGNIPVQFNNLAILQILDISENNLSGSMISTLNLSSVEHLYLQSNALGGSIPNTIFRGSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPACITNLLFWKVGSRYLSGFVMVVMDLGVADIRNYYNSTVQLSLDGIDGRSLGTQVEVNFMTKNRYESYKGVILDYMAGLDLSSNKLTGDIPSEICDLQNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLTELHSLSKFDVSYNDLSGPIPDKEQFSTFDESSYRGNLHLCGPPINKSCTNLLELLETSSKGAEDESAVDMVAFYWSFVASCVTVMLGLLAILWVNPYWRRLWFYFIEECIDLCYYWLFKYVFYW
*****LSGILPSVIANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQVKIENCLPTFQLKVLSLPNCNLGVIPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTKLEVLYLTNNSFSGFQLTSAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNISKNSFEGNIPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIFPNYVNLTRLLFLYLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSWMGNFSNLYILSMSKNLLEGNIPVQFNNLAILQILDISENNLSGSMISTLNLSSVEHLYLQSNALGGSIPNTIFRGSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPACITNLLFWKVGSRYLSGFVMVVMDLGVADIRNYYNSTVQLSLDGIDGRSLGTQVEVNFMTKNRYESYKGVILDYMAGLDLSSNKLTGDIPSEICDLQNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLTELHSLSKFDVSYNDLSGPIPDKEQFSTFDESSYRGNLHLCGPPINKSCT****************SAVDMVAFYWSFVASCVTVMLGLLAILWVNPYWRRLWFYFIEECIDLCYYWLFKYVFYW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSNQLSGILPSVIANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQVKIENCLPTFQLKVLSLPNCNLGVIPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTKLEVLYLTNNSFSGFQLTSAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNISKNSFEGNIPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIFPNYVNLTRLLFLYLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSWMGNFSNLYILSMSKNLLEGNIPVQFNNLAILQILDISENNLSGSMISTLNLSSVEHLYLQSNALGGSIPNTIFRGSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPACITNLLFWKVGSRYLSGFVMVVMDLGVADIRNYYNSTVQLSLDGIDGRSLGTQVEVNFMTKNRYESYKGVILDYMAGLDLSSNKLTGDIPSEICDLQNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLTELHSLSKFDVSYNDLSGPIPDKEQFSTFDESSYRGNLHLCGPPINKSCTNLLELLETSSKGAEDESAVDMVAFYWSFVASCVTVMLGLLAILWVNPYWRRLWFYFIEECIDLCYYWLFKYVFYW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query688 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ no no 0.872 0.480 0.297 7e-63
Q9FL28 1173 LRR receptor-like serine/ no no 0.843 0.494 0.330 8e-62
O22476 1196 Protein BRASSINOSTEROID I no no 0.812 0.467 0.323 3e-61
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.856 0.470 0.310 2e-59
Q9ZWC8 1166 Serine/threonine-protein no no 0.821 0.484 0.315 2e-59
Q9LJF3 1164 Receptor-like protein kin no no 0.819 0.484 0.322 1e-58
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.834 0.475 0.331 4e-57
Q9FRS6 1029 Leucine-rich repeat recep no no 0.825 0.551 0.308 6e-57
Q8L899 1207 Systemin receptor SR160 O N/A no 0.834 0.475 0.330 9e-57
C0LGS2 1136 Probable LRR receptor-lik no no 0.863 0.522 0.308 7e-56
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  242 bits (618), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 228/766 (29%), Positives = 357/766 (46%), Gaps = 166/766 (21%)

Query: 1   MSSNQLSGILPSVIANLTSLEYLALYDNKFKGRLFS-FCSLANLSKLEVFQLSMEADLLQ 59
           +SSN L G +P+ ++NLTSLE L L+ N+  G + S   SL N+  L +    +  D+  
Sbjct: 102 LSSNNLVGPIPTALSNLTSLESLFLFSNQLTGEIPSQLGSLVNIRSLRIGDNELVGDI-- 159

Query: 60  VKIENCLPTFQLKVLSLPNCNL-GVIPNFLLHQFNLKYLDLSHNKLAGNFPTWL------ 112
              E       L++L+L +C L G IP+ L     ++ L L  N L G  P  L      
Sbjct: 160 --PETLGNLVNLQMLALASCRLTGPIPSQLGRLVRVQSLILQDNYLEGPIPAELGNCSDL 217

Query: 113 --------------------LENNTKLEVLYLTNNSFSG--------------FQLTSAQ 138
                               LEN   LE+L L NNS +G                L + Q
Sbjct: 218 TVFTAAENMLNGTIPAELGRLEN---LEILNLANNSLTGEIPSQLGEMSQLQYLSLMANQ 274

Query: 139 -HGLI-----------SLDISSNNFTGKLPQ---NMGIV-------------LPKLDCMN 170
             GLI           +LD+S+NN TG++P+   NM  +             LPK  C N
Sbjct: 275 LQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGSLPKSICSN 334

Query: 171 --------ISKNSFEGNIPSSIGKMQGLRLLDVSSNKFAGELSQ---------------- 206
                   +S     G IP  + K Q L+ LD+S+N  AG + +                
Sbjct: 335 NTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLHNN 394

Query: 207 ------SP-VTNCFSLEWLQLSNNNFDGQIFPNYVNLTRLLFLYLDNNHFSGKIKDGLLR 259
                 SP ++N  +L+WL L +NN +G++      L +L  L+L  N FSG+I   +  
Sbjct: 395 TLEGTLSPSISNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSGEIPQEIGN 454

Query: 260 SSELMVLDISNNHLSGHIPSWMGNFSNLYILSMSKNLLEGNIPVQFNNLAILQILDISEN 319
            + L ++D+  NH  G IP  +G    L +L + +N L G +P    N   L ILD+++N
Sbjct: 455 CTSLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADN 514

Query: 320 NLSGSMISTLN-LSSVEHLYLQSNALGGSIPNTIFR-----------------------G 355
            LSGS+ S+   L  +E L L +N+L G++P+++                          
Sbjct: 515 QLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNGTIHPLCGS 574

Query: 356 SALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSIMDLSHNR 415
           S+  + D+ +N F   IP ++    NL  L L  N L G IP  L ++R+LS++D+S N 
Sbjct: 575 SSYLSFDVTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNA 634

Query: 416 LNGSIP---ACITNLLFWKVGSRYLSG----FVMVVMDLGVADIRN----------YYNS 458
           L G+IP        L    + + +LSG    ++  +  LG   + +           +N 
Sbjct: 635 LTGTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVESLPTELFNC 694

Query: 459 T--VQLSLDG--IDG---RSLGTQVEVNFMTKNRYESYKGVILDYMAGLD------LSSN 505
           T  + LSLDG  ++G   + +G    +N +  ++ + + G +   M  L       LS N
Sbjct: 695 TKLLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQ-FSGSLPQAMGKLSKLYELRLSRN 753

Query: 506 KLTGDIPSEICDLQNIH-GLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLT 564
            LTG+IP EI  LQ++   L+LS+N  +G IP +   L  +E+LDLSHN+L G++P  + 
Sbjct: 754 SLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTGEVPGSVG 813

Query: 565 ELHSLSKFDVSYNDLSGPIPDKEQFSTFDESSYRGNLHLCGPPINK 610
           ++ SL   +VS+N+L G +  K+QFS +   S+ GN  LCG P+++
Sbjct: 814 DMKSLGYLNVSFNNLGGKL--KKQFSRWPADSFLGNTGLCGSPLSR 857




Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query688
358345471 933 Receptor kinase [Medicago truncatula] gi 0.989 0.729 0.497 1e-168
297842171 966 leucine-rich repeat family protein [Arab 0.969 0.690 0.469 1e-159
15221162 965 receptor like protein 15 [Arabidopsis th 0.962 0.686 0.460 1e-157
12324907 910 putative disease resistance protein; 468 0.962 0.727 0.460 1e-157
255553269 2793 receptor-kinase, putative [Ricinus commu 0.902 0.222 0.502 1e-155
12323814 1068 disease resistance protein, putative; 11 0.950 0.612 0.460 1e-154
186495296 1000 receptor like protein 13 [Arabidopsis th 0.950 0.654 0.460 1e-154
238478394 1083 receptor like protein 1 [Arabidopsis tha 0.969 0.615 0.456 1e-154
238478392 913 receptor like protein 1 [Arabidopsis tha 0.969 0.730 0.456 1e-154
240254032 1034 receptor like protein 1 [Arabidopsis tha 0.969 0.645 0.456 1e-153
>gi|358345471|ref|XP_003636801.1| Receptor kinase [Medicago truncatula] gi|355502736|gb|AES83939.1| Receptor kinase [Medicago truncatula] Back     alignment and taxonomy information
 Score =  598 bits (1542), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 362/727 (49%), Positives = 473/727 (65%), Gaps = 46/727 (6%)

Query: 1   MSSNQLSGILPSVIANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQV 60
           +SSN   G +PS I +L SLEYL+L+D  F G +FSF SL N SKLEVF LS + + L V
Sbjct: 213 LSSNNFVGNIPSFIISLKSLEYLSLFDTNFDG-IFSFSSLNNHSKLEVFLLSPKTNNLYV 271

Query: 61  KIENC---LPTFQLKVLSLPNCNL-----GVIPNFLLHQFNLKYLDLSHNKLAGNFPTWL 112
           + E      PTFQLKVL L NC L     G  P FLL+Q  L+ LDLSHNKL+GNFP+W+
Sbjct: 272 ETEESPSWHPTFQLKVLQLRNCFLNSKRDGTFPTFLLYQHELQLLDLSHNKLSGNFPSWI 331

Query: 113 LENNTKLEVLYLTNNSFSG-FQLTSAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNI 171
           LENNTKLE LYL NNSF+G  +L + +HGL+ L IS+N   G+L +++G + P L  +N+
Sbjct: 332 LENNTKLETLYLMNNSFTGTLELPTFKHGLLDLQISNNKIGGQLQEDIGKIFPNLYYVNL 391

Query: 172 SKNSFEGNIPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIFP 231
           SKNSFEG +PSSIG+MQ +R LD+S+N F+GELS   ++N  SL  L+LS+N+F G + P
Sbjct: 392 SKNSFEGILPSSIGEMQTIRTLDLSNNNFSGELSSHLISNLTSLRLLRLSHNSFHGLV-P 450

Query: 232 NYVNLTRLLFLYLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSWMGNFSNLYILS 291
              NLTRL +LYL+NN FSG I+DG+  +S L  LDISNN LSG IP W+G F+ L +LS
Sbjct: 451 LLSNLTRLNWLYLNNNSFSGVIEDGVSNNSSLFSLDISNNMLSGRIPRWIGRFTKLSVLS 510

Query: 292 MSKNLLEGNIPVQFNNLAILQILDISENNLSGSMISTL-NLSSVEHLYLQSNALGGSIPN 350
           +SKN L+G IP +  NL  L  LD+SENNLS  +     N   ++ LYLQ NAL G+IP 
Sbjct: 511 LSKNRLQGEIPNELCNLISLSYLDLSENNLSDFLPYCFKNFKYMKFLYLQKNALQGNIPY 570

Query: 351 TIFRGSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSIMD 410
              + + L +LDLRDN FFG IP  IN  S LR LLL GN L GPIP  +C+L  + IMD
Sbjct: 571 AFSQLTKLTSLDLRDNNFFGNIPQWINRLSKLRVLLLAGNKLTGPIPIYVCELEHVRIMD 630

Query: 411 LSHNRLNGSIPACITNLLF-------WKVGSRYL-----------------SGFVMVVMD 446
           LSHN +N +IP CI N+ F         VG R +                 + ++ +V D
Sbjct: 631 LSHNWINETIPPCIKNISFKMVEFQTTAVGGRAVQNDNDSKDKIQYYGNTATSYIFLVDD 690

Query: 447 L-----GVADIRNYYNSTVQLSLDGIDGRSLGTQ-VEVNFMTKNRYESYKGVILDYMAGL 500
           +        DI  +YNS++ L+    D   +  + VE+ F TK+ Y SYKG  L+ M GL
Sbjct: 691 IWFTPGNTFDI--FYNSSLSLNHPIADEYMISYEIVEIEFRTKSYYLSYKGNNLNLMTGL 748

Query: 501 DLSSNKLTGDIPSEICDLQNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIP 560
           DLSSN L+G IP EI +L++I  LNLSHN  SGSIP +F NL  IESLDLS+N L+G +P
Sbjct: 749 DLSSNNLSGSIPPEIGELRDIKALNLSHNRFSGSIPGTFPNLINIESLDLSYNNLSGALP 808

Query: 561 PQLTELHSLSKFDVSYNDLSGPIPDKEQFSTFDESSYRGNLHLCGPPINKSCTNLLELLE 620
             LT L+SL+ F+VSYN  SG +P   QF+ FDE++YRGN  LCG  IN +C N   +  
Sbjct: 809 QNLTNLYSLAIFNVSYNKFSGRVPTTMQFANFDENNYRGNSDLCGSVINITC-NHTSIFP 867

Query: 621 TSSKGAEDESAVDMVAFYWSFVASCVTVMLGLLAILWVNPYWRRLWFYFIEECIDLCYYW 680
            +S   + ++A+DM +FYWS VAS VTV++GL  ILWVN +W R+WF +++ CI  C+  
Sbjct: 868 PAST-TQHQTAIDMESFYWSCVASYVTVVIGLAVILWVNSHWCRVWFRYVDLCIFYCFSR 926

Query: 681 LFKYVFY 687
            FK VF+
Sbjct: 927 CFKNVFH 933




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297842171|ref|XP_002888967.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297334808|gb|EFH65226.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15221162|ref|NP_177559.1| receptor like protein 15 [Arabidopsis thaliana] gi|12323812|gb|AAG51871.1|AC079678_1 disease resistance protein, putative; 1096-4664 [Arabidopsis thaliana] gi|332197443|gb|AEE35564.1| receptor like protein 15 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12324907|gb|AAG52409.1|AC020579_11 putative disease resistance protein; 46848-50365 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255553269|ref|XP_002517677.1| receptor-kinase, putative [Ricinus communis] gi|223543309|gb|EEF44841.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|12323814|gb|AAG51873.1|AC079678_3 disease resistance protein, putative; 11609-15699 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|186495296|ref|NP_177557.2| receptor like protein 13 [Arabidopsis thaliana] gi|332197441|gb|AEE35562.1| receptor like protein 13 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|238478394|ref|NP_001154318.1| receptor like protein 1 [Arabidopsis thaliana] gi|332189998|gb|AEE28119.1| receptor like protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|238478392|ref|NP_001154317.1| receptor like protein 1 [Arabidopsis thaliana] gi|332189997|gb|AEE28118.1| receptor like protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|240254032|ref|NP_172219.5| receptor like protein 1 [Arabidopsis thaliana] gi|332189996|gb|AEE28117.1| receptor like protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query688
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.970 0.692 0.465 1.1e-153
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.959 0.66 0.468 1.3e-153
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.970 0.616 0.461 5.2e-152
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.969 0.683 0.464 1.9e-145
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.960 0.741 0.456 6.3e-140
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.966 0.711 0.415 4.8e-126
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.946 0.716 0.376 4.2e-95
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.925 0.785 0.315 2.1e-68
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.870 0.479 0.324 5.3e-67
TAIR|locus:2005498 1196 BRI1 "BRASSINOSTEROID INSENSIT 0.867 0.499 0.331 5e-65
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1499 (532.7 bits), Expect = 1.1e-153, P = 1.1e-153
 Identities = 321/689 (46%), Positives = 450/689 (65%)

Query:     1 MSSNQLSGILPSVIANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQV 60
             +SSN+L+G +PS + +L SLEYL+L+DN F+G  FSF SLANLS L V +L  ++  LQV
Sbjct:   275 LSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGS-FSFGSLANLSNLMVLKLCSKSSSLQV 333

Query:    61 KIENCL-PTFQLKVLSLPNCNLGVIPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTKL 119
               E+   P FQL V++L +CN+  +P+FLLHQ +L+++DLS N ++G  P+WLL NNTKL
Sbjct:   334 LSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKL 393

Query:   120 EVLYLTNNSFSGFQLTSAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNISKNSFEGN 179
             +VL L NN F+ FQ+  + H L+ LD+S+N+F    P+N+G + P L  +N SKN+F+ N
Sbjct:   394 KVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQEN 453

Query:   180 IPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIFPNYVNLTRL 239
             +PSS+G M G++ +D+S N F G L +S V  C+S+  L+LS+N   G+IFP   N T +
Sbjct:   454 LPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNI 513

Query:   240 LFLYLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSWMGNFSNLYILSMSKNLLEG 299
             L L++DNN F+GKI  GL     L +LD+SNN+L+G IPSW+G   +L  L +S N L+G
Sbjct:   514 LGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKG 573

Query:   300 NIPVQFNNLAILQILDISENNLSGSMISTLNLSSVEHLYLQSNALGGSIPNTIFRGSALE 359
             +IP+   N + LQ+LD+S N+LSG +    +  +   L LQ N L G+IP+T+     +E
Sbjct:   574 DIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLLAN--VE 631

Query:   360 TLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGS 419
              LDLR+N F G+IP  IN   N+  LLLRGN   G IPHQLC L  + ++DLS+NRLNG+
Sbjct:   632 ILDLRNNRFSGKIPEFINIQ-NISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGT 690

Query:   420 IPACITNLLFW--KVGSRYLSGF-VMVVMDL--GVA---DIRNYYNSTVQL-SLDGIDGR 470
             IP+C++N  F   K  + Y   F +    D+  G +   D  +  N  +   SL  +D  
Sbjct:   691 IPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPL 750

Query:   471 SL----GTQVEVNFMTKNRYESYKGVILDYMAGLDLSSNKLTGDIPSEICDLQNIHGLNL 526
             S+     TQ ++ F TK+RY++Y G  L  + G+DLS N+L+G+IP E   L  +  LNL
Sbjct:   751 SMDYKAATQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELRALNL 810

Query:   527 SHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLTELHSLSKFDVSYNDLSGPIPDK 586
             SHN LSG IP+S S+++ +ES DLS N+L G+IP QLTEL SLS F VS+N+LSG IP  
Sbjct:   811 SHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQG 870

Query:   587 EQFSTFDESSYRGNLHLCGPPINKSCTNLLELLETSSKGAE-DESAVDMVAFYWSFVASC 645
              QF+TFD  SY GN  LCG P N+SC N     E +  G E DES +DMV+FY SF A+ 
Sbjct:   871 RQFNTFDAESYFGNRLLCGQPTNRSCNN--NSYEEADNGVEADESIIDMVSFYLSFAAAY 928

Query:   646 VTVMLGLLAILWVNPYWRRLWFYFIEECI 674
             VT+++G+LA L  +  W R WFY ++  I
Sbjct:   929 VTILIGILASLSFDSPWSRFWFYKVDAFI 957


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005498 BRI1 "BRASSINOSTEROID INSENSITIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.2__1688__AT1G74190.1
annotation not avaliable (966 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query688
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-66
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-48
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-35
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  234 bits (598), Expect = 6e-66
 Identities = 173/623 (27%), Positives = 287/623 (46%), Gaps = 78/623 (12%)

Query: 65  CLPTFQLKVLSLPNCNL-GVIPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTKLEVLY 123
           C  + ++  + L   N+ G I + +     ++ ++LS+N+L+G  P  +   ++ L  L 
Sbjct: 65  CNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLN 124

Query: 124 LTNNSFSGFQLTSAQHGLISLDISSNNFTGKLPQNMGIV--------------------- 162
           L+NN+F+G     +   L +LD+S+N  +G++P ++G                       
Sbjct: 125 LSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSL 184

Query: 163 --LPKLDCMNISKNSFEGNIPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQL 220
             L  L+ + ++ N   G IP  +G+M+ L+ + +  N  +GE+    +    SL  L L
Sbjct: 185 TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYE-IGGLTSLNHLDL 243

Query: 221 SNNNFDGQIFPNYVNLTRLLFLYLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSW 280
             NN  G I  +  NL  L +L+L  N  SG I   +    +L+ LD+S+N LSG IP  
Sbjct: 244 VYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPEL 303

Query: 281 MGNFSNLYILSMSKNLLEGNIPVQFNNLAILQILDISENNLSGSMISTL----NLSSVEH 336
           +    NL IL +  N   G IPV   +L  LQ+L +  N  SG +   L    NL+ ++ 
Sbjct: 304 VIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLD- 362

Query: 337 LYLQSNALGGSIPNTIFRGSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPI 396
             L +N L G IP  +     L  L L  N   G IP  +    +LR + L+ N   G +
Sbjct: 363 --LSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGEL 420

Query: 397 PHQLCQLRKLSIMDLSHNRLNGSIPACITNLLFWKVGSRYLSGFVMVVMDLGVADIRNYY 456
           P +  +L  +  +D+S+N L G I     N   W + S       + ++ L     RN +
Sbjct: 421 PSEFTKLPLVYFLDISNNNLQGRI-----NSRKWDMPS-------LQMLSLA----RNKF 464

Query: 457 NSTVQLSLDGIDGRSLGTQVEVNFMTKNRYESYKGVI------LDYMAGLDLSSNKLTGD 510
                    G+       ++E   +++N++    G +      L  +  L LS NKL+G+
Sbjct: 465 -------FGGLPDSFGSKRLENLDLSRNQFS---GAVPRKLGSLSELMQLKLSENKLSGE 514

Query: 511 IPSEICDLQNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLTELHSLS 570
           IP E+   + +  L+LSHN LSG IP SFS + ++  LDLS N+L+G+IP  L  + SL 
Sbjct: 515 IPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLV 574

Query: 571 KFDVSYNDLSGPIPDKEQFSTFDESSYRGNLHLCGPPINKSCTNLLELLETSSKGAEDES 630
           + ++S+N L G +P    F   + S+  GN+ LCG                ++ G     
Sbjct: 575 QVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCG--------------GDTTSGLPPCK 620

Query: 631 AVDMVAFYWSFVASCVTVMLGLL 653
            V     +W ++   +   L L 
Sbjct: 621 RVRKTPSWWFYITCTLGAFLVLA 643


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 688
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
PLN03150623 hypothetical protein; Provisional 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.41
PLN03150623 hypothetical protein; Provisional 99.36
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.27
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.26
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.2
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.18
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.17
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.16
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.13
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.94
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.87
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.86
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.81
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.75
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.73
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.61
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.52
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.51
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.35
KOG4341483 consensus F-box protein containing LRR [General fu 98.28
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.25
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.17
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.13
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.12
KOG4341483 consensus F-box protein containing LRR [General fu 98.08
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.85
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.84
PRK15386426 type III secretion protein GogB; Provisional 97.73
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.7
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.68
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.63
PRK15386426 type III secretion protein GogB; Provisional 97.48
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.05
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.91
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.82
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.78
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.63
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.54
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.93
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.55
KOG4308478 consensus LRR-containing protein [Function unknown 94.36
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.54
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.5
KOG4308478 consensus LRR-containing protein [Function unknown 92.84
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.36
smart0037026 LRR Leucine-rich repeats, outliers. 91.36
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.65
smart0037026 LRR Leucine-rich repeats, outliers. 90.65
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.99
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 86.63
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.77
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.3
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.11
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.3e-64  Score=593.91  Aligned_cols=532  Identities=33%  Similarity=0.495  Sum_probs=448.2

Q ss_pred             CCCCCCcccCchhhcCCCCCCEEeCCCCcCcccccCHHhhccCCCCCEEEccCCCCcccccccCCCCCcceeEEECCCCC
Q 005619            1 MSSNQLSGILPSVIANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQVKIENCLPTFQLKVLSLPNCN   80 (688)
Q Consensus         1 Ls~n~~~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~l~~l~~L~~L~Ls~~~~~~~~~~~~~~~l~~L~~L~l~~n~   80 (688)
                      |++|+++|.++..|.++++|++|+|++|.+.+ .+|...+.++++|++|++++|.+.+.++.   ..+++|++|++++|.
T Consensus        76 L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~-~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~---~~l~~L~~L~Ls~n~  151 (968)
T PLN00113         76 LSGKNISGKISSAIFRLPYIQTINLSNNQLSG-PIPDDIFTTSSSLRYLNLSNNNFTGSIPR---GSIPNLETLDLSNNM  151 (968)
T ss_pred             ecCCCccccCChHHhCCCCCCEEECCCCccCC-cCChHHhccCCCCCEEECcCCccccccCc---cccCCCCEEECcCCc
Confidence            46778888888888888888888888888876 67755566888888888888887665553   456788888888888


Q ss_pred             C-CCcchhhhCCCCCCEEECCCCcCCCCCchHHhhCCCCCcEEEccCCCCCCCCCC--CCCCCcCEEEccCCCCCCCCCh
Q 005619           81 L-GVIPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTKLEVLYLTNNSFSGFQLT--SAQHGLISLDISSNNFTGKLPQ  157 (688)
Q Consensus        81 l-~~lp~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~--~~~~~L~~L~ls~n~~~~~~~~  157 (688)
                      + +.+|..+..+++|++|++++|.+.+.+|..+ .++++|++|++++|.+.+....  ..+++|++|++++|++++.+|.
T Consensus       152 ~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~-~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~  230 (968)
T PLN00113        152 LSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSL-TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPY  230 (968)
T ss_pred             ccccCChHHhcCCCCCEEECccCcccccCChhh-hhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCCh
Confidence            8 4678888888888888888888887777765 4788888888888887754221  3677888888888888878887


Q ss_pred             hhhhcCCCCCEEEccCCCCCcccchhhhcCCCCCEEEccCCcCccccCchhhcCCCCCCEEEcccCcCCCcCcccccCCC
Q 005619          158 NMGIVLPKLDCMNISKNSFEGNIPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIFPNYVNLT  237 (688)
Q Consensus       158 ~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~  237 (688)
                      .+. .+++|++|++++|.+++..|..++++++|++|++++|.+.+.+|.. +..+++|+.|++++|.+.+..|..+..++
T Consensus       231 ~l~-~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~-l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~  308 (968)
T PLN00113        231 EIG-GLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPS-IFSLQKLISLDLSDNSLSGEIPELVIQLQ  308 (968)
T ss_pred             hHh-cCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchh-HhhccCcCEEECcCCeeccCCChhHcCCC
Confidence            775 6888888888888888888888888888888888888887766655 35778888888888888877888888888


Q ss_pred             CCCEEeccCCcCCCcccccccCCCCCCEEEccCCcCCCCCchhhhCCcCCcEEEccccccCCCCcccccCCCCCcEEEcc
Q 005619          238 RLLFLYLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSWMGNFSNLYILSMSKNLLEGNIPVQFNNLAILQILDIS  317 (688)
Q Consensus       238 ~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~Ls  317 (688)
                      +|+.|++++|.+.+..|..+..+++|+.|++++|.+.+..|..++.+++|+.|++++|.+.+.+|..+..+++|+.|+++
T Consensus       309 ~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~  388 (968)
T PLN00113        309 NLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILF  388 (968)
T ss_pred             CCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECc
Confidence            88888888888888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             CCcCcccccccc-ccCccceEeeecCccccCCchhccCCCCccEEeCcCCcCCCcCchhhhcCCCccEEeccCCcCCCCC
Q 005619          318 ENNLSGSMISTL-NLSSVEHLYLQSNALGGSIPNTIFRGSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPI  396 (688)
Q Consensus       318 ~n~l~~~~~~~~-~~~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~  396 (688)
                      +|.+.+..+..+ .+++|+.|++++|.+++.+|..+..++.|+.|++++|.+++.++..+..+++|+.|++++|++.+.+
T Consensus       389 ~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~  468 (968)
T PLN00113        389 SNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGL  468 (968)
T ss_pred             CCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeec
Confidence            888887777665 7788888888888888888888888888888888888888888877788888888888888888777


Q ss_pred             chhhcCCCCCCEEEccCCcCccccchhhhhhhhcccCCcccccceeEEecccccccccccccceecccCCCCCCCCCcce
Q 005619          397 PHQLCQLRKLSIMDLSHNRLNGSIPACITNLLFWKVGSRYLSGFVMVVMDLGVADIRNYYNSTVQLSLDGIDGRSLGTQV  476 (688)
Q Consensus       397 ~~~~~~l~~L~~L~ls~n~l~~~~p~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~  476 (688)
                      |..+ ..++|+.|++++|++++.+|..+.+                                                  
T Consensus       469 p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~--------------------------------------------------  497 (968)
T PLN00113        469 PDSF-GSKRLENLDLSRNQFSGAVPRKLGS--------------------------------------------------  497 (968)
T ss_pred             Cccc-ccccceEEECcCCccCCccChhhhh--------------------------------------------------
Confidence            7655 4578888888888888877776543                                                  


Q ss_pred             EEEeeeccccccccccccccccEEEccCCcccccCChhhhccCCCCeeeCCCCcCccCCCccccCCCCCCeEeCCCCccc
Q 005619          477 EVNFMTKNRYESYKGVILDYMAGLDLSSNKLTGDIPSEICDLQNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLN  556 (688)
Q Consensus       477 ~~~~~~~~~~~~~~~~~l~~L~~LdLs~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~  556 (688)
                                       ++.|+.|+|++|.+++.+|..+..+++|+.|+|++|.+++.+|..|+++++|+.|||++|+++
T Consensus       498 -----------------l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~  560 (968)
T PLN00113        498 -----------------LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLS  560 (968)
T ss_pred             -----------------hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCccc
Confidence                             567899999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCcCCCCCCCCCEEecCCCcCccCCCCCcccCCcCccccCCCCCCCCCC
Q 005619          557 GQIPPQLTELHSLSKFDVSYNDLSGPIPDKEQFSTFDESSYRGNLHLCGPP  607 (688)
Q Consensus       557 ~~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~l~~~p  607 (688)
                      +.+|..+.++++|++|++++|+++|.+|..+++.++...++.||+.+||.+
T Consensus       561 ~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        561 GEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             ccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            999999999999999999999999999999999999999999999999865



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query688
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-62
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-31
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-18
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-62
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-31
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-14
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-10
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-05
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 2e-05
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 9e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 2e-04
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 3e-04
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 9e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 236 bits (603), Expect = 2e-62, Method: Compositional matrix adjust. Identities = 204/630 (32%), Positives = 304/630 (48%), Gaps = 68/630 (10%) Query: 17 LTSLEYLALYDNKFKG-RLFSFCSLANLSKLEVFQLSMEADLLQVKIENCLPTFQLKVLS 75 L SLE L L N G + + +L+ +S V + C+ L+ L Sbjct: 150 LNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCV---NLEFLD 206 Query: 76 LPNCNLGVIPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTKLEVLYLTNNSFSGFQLT 135 + + N FL L++LD+S NKL+G+F + + T+L++L +++N F G Sbjct: 207 VSSNNFSTGIPFLGDCSALQHLDISGNKLSGDF-SRAISTCTELKLLNISSNQFVGPIPP 265 Query: 136 SAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNISKNSFEGNIPSSIG---------- 185 L L ++ N FTG++P + L +++S N F G +P G Sbjct: 266 LPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLAL 325 Query: 186 ---------------KMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIF 230 KM+GL++LD+S N+F+GEL +S SL L LS+NNF G I Sbjct: 326 SSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPIL 385 Query: 231 PNYVNLTR--LLFLYLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSWMGNFSNLY 288 PN + L LYL NN F+GKI L SEL+ L +S N+LSG IPS +G+ S L Sbjct: 386 PNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLR 445 Query: 289 ILSMSKNLLEGNIPVQFNNLAILQILDISENNLSGSMISTLNLSSVEHLYLQSNALGGSI 348 L + N+LEG IP + + + ++E L L N L G I Sbjct: 446 DLKLWLNMLEGEIPQEL-----------------------MYVKTLETLILDFNDLTGEI 482 Query: 349 PNTIFRGSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSI 408 P+ + + L + L +N G IP I NL L L N G IP +L R L Sbjct: 483 PSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIW 542 Query: 409 MDLSHNRLNGSIPACITNLLFWKVGSRYLSG--FVMVVMDLGVADIRNYYNSTVQLSLDG 466 +DL+ N NG+IPA + K+ + +++G +V + D G+ + + + L G Sbjct: 543 LDLNTNLFNGTIPAAMFKQ-SGKIAANFIAGKRYVYIKND-GMK--KECHGAGNLLEFQG 598 Query: 467 IDGRSL---GTQVEVNFMTKNRYESYKGVILD---YMAGLDLSSNKLTGDIPSEICDLQN 520 I L T+ N +T Y + D M LD+S N L+G IP EI + Sbjct: 599 IRSEQLNRLSTRNPCN-ITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPY 657 Query: 521 IHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLTELHSLSKFDVSYNDLS 580 + LNL HN +SGSIP+ +L+ + LDLS NKL+G+IP ++ L L++ D+S N+LS Sbjct: 658 LFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLS 717 Query: 581 GPIPDKEQFSTFDESSYRGNLHLCGPPINK 610 GPIP+ QF TF + + N LCG P+ + Sbjct: 718 GPIPEMGQFETFPPAKFLNNPGLCGYPLPR 747
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query688
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-166
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-98
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-82
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-51
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-40
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-32
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-73
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-60
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-50
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-44
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-41
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-34
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-64
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-50
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-30
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-63
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-48
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-51
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-50
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-47
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-46
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-46
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-45
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-53
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-45
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-48
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-47
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-48
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-45
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-35
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-25
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-24
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-19
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-26
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-10
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  496 bits (1279), Expect = e-166
 Identities = 199/625 (31%), Positives = 299/625 (47%), Gaps = 19/625 (3%)

Query: 2   SSNQLSGILP-SVIANLTSLEYLALYDNKFKGRL-FSFCSLANLSKLEVFQLSMEADLLQ 59
           SSN L      S    L SLE L L  N   G     +       +L+   +S     + 
Sbjct: 134 SSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNK--IS 191

Query: 60  VKIENCLPTFQLKVLSLPNCNL-GVIPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTK 118
             ++       L+ L + + N    IP FL     L++LD+S NKL+G+F   +    T+
Sbjct: 192 GDVDVSRCV-NLEFLDVSSNNFSTGIP-FLGDCSALQHLDISGNKLSGDFSRAIS-TCTE 248

Query: 119 LEVLYLTNNSFSGFQLTSAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNISKNSFEG 178
           L++L +++N F G         L  L ++ N FTG++P  +      L  +++S N F G
Sbjct: 249 LKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYG 308

Query: 179 NIPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIFPNYVNLT- 237
            +P   G    L  L +SSN F+GEL    +     L+ L LS N F G++  +  NL+ 
Sbjct: 309 AVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 368

Query: 238 RLLFLYLDNNHFSGKIKDGLLRS--SELMVLDISNNHLSGHIPSWMGNFSNLYILSMSKN 295
            LL L L +N+FSG I   L ++  + L  L + NN  +G IP  + N S L  L +S N
Sbjct: 369 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 428

Query: 296 LLEGNIPVQFNNLAILQILDISENNLSGSMISTL-NLSSVEHLYLQSNALGGSIPNTIFR 354
            L G IP    +L+ L+ L +  N L G +   L  + ++E L L  N L G IP+ +  
Sbjct: 429 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSN 488

Query: 355 GSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSIMDLSHN 414
            + L  + L +N   G IP  I    NL  L L  N   G IP +L   R L  +DL+ N
Sbjct: 489 CTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTN 548

Query: 415 RLNGSIPACITNLLFWKVGSRYLSGFVMVVMDLGVADIRNYYNSTVQLSLDGIDGRSLG- 473
             NG+IPA +      K+ + +++G   V +       +  + +   L   GI    L  
Sbjct: 549 LFNGTIPAAMFKQSG-KIAANFIAGKRYVYIK-NDGMKKECHGAGNLLEFQGIRSEQLNR 606

Query: 474 -TQVEVNFMTKNRY---ESYKGVILDYMAGLDLSSNKLTGDIPSEICDLQNIHGLNLSHN 529
            +      +T   Y    S        M  LD+S N L+G IP EI  +  +  LNL HN
Sbjct: 607 LSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHN 666

Query: 530 FLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLTELHSLSKFDVSYNDLSGPIPDKEQF 589
            +SGSIP+   +L+ +  LDLS NKL+G+IP  ++ L  L++ D+S N+LSGPIP+  QF
Sbjct: 667 DISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQF 726

Query: 590 STFDESSYRGNLHLCGPPINKSCTN 614
            TF  + +  N  LCG P+ +   +
Sbjct: 727 ETFPPAKFLNNPGLCGYPLPRCDPS 751


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query688
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.67
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.63
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.42
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.4
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.33
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.2
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.18
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.18
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.86
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.53
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.52
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.42
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.95
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.93
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.59
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.07
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.97
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.85
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=6.8e-73  Score=646.18  Aligned_cols=609  Identities=32%  Similarity=0.450  Sum_probs=485.6

Q ss_pred             CCCCCCcccCch--hhcCCCCCCEEeCCCCcCcccccCHHhhccCCCCCEEEccCCCCcccccc----------------
Q 005619            1 MSSNQLSGILPS--VIANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQVKI----------------   62 (688)
Q Consensus         1 Ls~n~~~~~~~~--~~~~l~~L~~L~Ls~n~~~~~~~~~~~l~~l~~L~~L~Ls~~~~~~~~~~----------------   62 (688)
                      |++|.++|.+|.  .++++++|++|+|++|.+.+ .+|...+.++++|++|++++|.+.+..+.                
T Consensus       107 Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~-~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~L  185 (768)
T 3rgz_A          107 LSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDF-PGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAI  185 (768)
T ss_dssp             CCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEEC-CSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEEC
T ss_pred             CCCCcCCCcCCChHHHhCCCCCCEEECcCCccCC-cCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEEC
Confidence            456667766666  66677777777777766654 33322224455555555555544322111                


Q ss_pred             --------cCCCCCcceeEEECCCCCCCC-cchhhhCCCCCCEEECCCCcCCCCCchHHhhCCCCCcEEEccCCCCCCCC
Q 005619           63 --------ENCLPTFQLKVLSLPNCNLGV-IPNFLLHQFNLKYLDLSHNKLAGNFPTWLLENNTKLEVLYLTNNSFSGFQ  133 (688)
Q Consensus        63 --------~~~~~l~~L~~L~l~~n~l~~-lp~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~  133 (688)
                              ..+..+++|++|++++|.+.. +|. +.++++|++|++++|.+++.+|..+ .++++|++|++++|.+++..
T Consensus       186 s~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l-~~l~~L~~L~Ls~n~l~~~~  263 (768)
T 3rgz_A          186 SGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAI-STCTELKLLNISSNQFVGPI  263 (768)
T ss_dssp             CSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHT-TTCSSCCEEECCSSCCEESC
T ss_pred             CCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHH-hcCCCCCEEECCCCcccCcc
Confidence                    113567788888888888844 454 8888889999999888887777654 58889999999999887654


Q ss_pred             CCCCCCCcCEEEccCCCCCCCCChhhhhcCCCCCEEEccCCCCCcccchhhhcCCCCCEEEccCCcCccccCchhhcCCC
Q 005619          134 LTSAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNISKNSFEGNIPSSIGKMQGLRLLDVSSNKFAGELSQSPVTNCF  213 (688)
Q Consensus       134 ~~~~~~~L~~L~ls~n~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~  213 (688)
                      ....+++|++|++++|.+++.+|..++..+++|++|++++|.+++.+|..++++++|++|++++|.+.+.+|...+..++
T Consensus       264 ~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~  343 (768)
T 3rgz_A          264 PPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMR  343 (768)
T ss_dssp             CCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCT
T ss_pred             CccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCC
Confidence            44478899999999999998999988765699999999999999999999999999999999999999899988788999


Q ss_pred             CCCEEEcccCcCCCcCcccccCCC-CCCEEeccCCcCCCcccccccC--CCCCCEEEccCCcCCCCCchhhhCCcCCcEE
Q 005619          214 SLEWLQLSNNNFDGQIFPNYVNLT-RLLFLYLDNNHFSGKIKDGLLR--SSELMVLDISNNHLSGHIPSWMGNFSNLYIL  290 (688)
Q Consensus       214 ~L~~L~L~~n~i~~~~~~~~~~l~-~L~~L~L~~n~l~~~~~~~~~~--~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L  290 (688)
                      +|++|++++|.+++..|..+..++ +|++|++++|.+.+..+..+..  +++|++|++++|.+++.+|..+..+++|++|
T Consensus       344 ~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L  423 (768)
T 3rgz_A          344 GLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSL  423 (768)
T ss_dssp             TCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEE
T ss_pred             CCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEE
Confidence            999999999999988899998887 9999999999999888887766  7899999999999999999999999999999


Q ss_pred             EccccccCCCCcccccCCCCCcEEEccCCcCcccccccc-ccCccceEeeecCccccCCchhccCCCCccEEeCcCCcCC
Q 005619          291 SMSKNLLEGNIPVQFNNLAILQILDISENNLSGSMISTL-NLSSVEHLYLQSNALGGSIPNTIFRGSALETLDLRDNYFF  369 (688)
Q Consensus       291 ~l~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~-~~~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~  369 (688)
                      ++++|.+++.+|..+..+++|++|++++|.+.+..+..+ .+++|++|++++|.+++.+|..+..+++|++|++++|+++
T Consensus       424 ~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~  503 (768)
T 3rgz_A          424 HLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLT  503 (768)
T ss_dssp             ECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCC
T ss_pred             ECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccC
Confidence            999999999999999999999999999999998888777 8999999999999999999999999999999999999999


Q ss_pred             CcCchhhhcCCCccEEeccCCcCCCCCchhhcCCCCCCEEEccCCcCccccchhhhhhhhcccCCcccccceeEEecccc
Q 005619          370 GRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPACITNLLFWKVGSRYLSGFVMVVMDLGV  449 (688)
Q Consensus       370 ~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~ls~n~l~~~~p~~l~~l~~~~~~~~~~~~~~~~~~~~~~  449 (688)
                      +.+|.+++.+++|++|++++|++++.+|..++.+++|+.|++++|+++|.+|.++.+....... ....+..........
T Consensus       504 ~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~-~~~~~~~~~~~~~~~  582 (768)
T 3rgz_A          504 GEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAA-NFIAGKRYVYIKNDG  582 (768)
T ss_dssp             SCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCC-STTCSCEEEEEECCS
T ss_pred             CcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhh-hcccccccccccccc
Confidence            9999999999999999999999999999999999999999999999999999988765422110 000000000000000


Q ss_pred             ccccccccc-ceecccCCCCCCCC--CcceEEEeeeccccc---cccccccccccEEEccCCcccccCChhhhccCCCCe
Q 005619          450 ADIRNYYNS-TVQLSLDGIDGRSL--GTQVEVNFMTKNRYE---SYKGVILDYMAGLDLSSNKLTGDIPSEICDLQNIHG  523 (688)
Q Consensus       450 ~~~~~~~~~-~~~l~~~~~~~~~~--~~~~~~~~~~~~~~~---~~~~~~l~~L~~LdLs~N~l~~~~p~~~~~l~~L~~  523 (688)
                      ..  ..... ...+...+......  ...........+.+.   ......++.|+.|||++|+++|.+|..|+.+++|+.
T Consensus       583 ~~--~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~  660 (768)
T 3rgz_A          583 MK--KECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFI  660 (768)
T ss_dssp             CC--TTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCE
T ss_pred             cc--ccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCE
Confidence            00  00000 00000000000000  000000000000000   001133678999999999999999999999999999


Q ss_pred             eeCCCCcCccCCCccccCCCCCCeEeCCCCcccccCCcCCCCCCCCCEEecCCCcCccCCCCCcccCCcCccccCCCCCC
Q 005619          524 LNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLTELHSLSKFDVSYNDLSGPIPDKEQFSTFDESSYRGNLHL  603 (688)
Q Consensus       524 L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~l  603 (688)
                      |+|++|+++|.+|..|+++++|++|||++|+++|.+|..+.++++|++||+++|+++|.+|.+++|.++...+|.||+.+
T Consensus       661 L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~L  740 (768)
T 3rgz_A          661 LNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGL  740 (768)
T ss_dssp             EECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEE
T ss_pred             EeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCcc
Q 005619          604 CGPPINKSCTNLL  616 (688)
Q Consensus       604 ~~~p~~~~C~~~~  616 (688)
                      ||.|+. .|....
T Consensus       741 cg~~l~-~C~~~~  752 (768)
T 3rgz_A          741 CGYPLP-RCDPSN  752 (768)
T ss_dssp             ESTTSC-CCCSCC
T ss_pred             cCCCCc-CCCCCc
Confidence            999987 897543



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 688
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 79.3 bits (194), Expect = 2e-16
 Identities = 58/341 (17%), Positives = 110/341 (32%), Gaps = 29/341 (8%)

Query: 14  IANLTSLEYLALYDNKFKGRLFSFCSLANLSKLEVFQLSMEADLLQVKIENCLPTFQLKV 73
           +  L +L  +   +N+    +    +L  L  + +    +        + N         
Sbjct: 62  VEYLNNLTQINFSNNQLTD-ITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNN 120

Query: 74  LSLPNCNLGVIPNFL-----------LHQFNLKYLDLSHNKLAGNFPTWLLENNTKLEVL 122
                  L  + N             +   +        +          L N T LE L
Sbjct: 121 QITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERL 180

Query: 123 YLTNNSFSGFQLTSAQHGLISLDISSNNFTGKLPQNMGIVLPKLDCMNISKNSFEGNIPS 182
            +++N  S   + +    L SL  ++N  +   P  +   L +L       N  +     
Sbjct: 181 DISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNG---NQLKD--IG 235

Query: 183 SIGKMQGLRLLDVSSNKFAGELSQSPVTNCFSLEWLQLSNNNFDGQIFPNYVNLTRLLFL 242
           ++  +  L  LD+++N+ +     +P++    L  L+L  N            LT L  L
Sbjct: 236 TLASLTNLTDLDLANNQISNL---APLSGLTKLTELKLGANQISN--ISPLAGLTALTNL 290

Query: 243 YLDNNHFSGKIKDGLLRSSELMVLDISNNHLSGHIPSWMGNFSNLYILSMSKNLLEGNIP 302
            L+ N          L+   L  L +  N++S   P  + + + L  L  + N +     
Sbjct: 291 ELNENQLEDISPISNLK--NLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--V 344

Query: 303 VQFNNLAILQILDISENNLSGSMISTLNLSSVEHLYLQSNA 343
               NL  +  L    N +S       NL+ +  L L   A
Sbjct: 345 SSLANLTNINWLSAGHNQISDL-TPLANLTRITQLGLNDQA 384


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query688
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.35
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.14
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.65
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.65
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.15
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.95
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=1.2e-31  Score=270.10  Aligned_cols=258  Identities=34%  Similarity=0.548  Sum_probs=200.9

Q ss_pred             CCCEEEccCCcCCC--CCchhhhCCcCCcEEEccc-cccCCCCcccccCCCCCcEEEccCCcCccccccccccCccceEe
Q 005619          262 ELMVLDISNNHLSG--HIPSWMGNFSNLYILSMSK-NLLEGNIPVQFNNLAILQILDISENNLSGSMISTLNLSSVEHLY  338 (688)
Q Consensus       262 ~L~~L~Ls~n~l~~--~~~~~~~~l~~L~~L~l~~-n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~L~~L~  338 (688)
                      +++.|+|+++.+.+  .+|..++++++|++|++++ |.+.|.+|..+.++++                       |++|+
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~-----------------------L~~L~  107 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQ-----------------------LHYLY  107 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTT-----------------------CSEEE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccc-----------------------cchhh
Confidence            45556666665554  2445555555555555553 4455555555555444                       55555


Q ss_pred             eecCccccCCchhccCCCCccEEeCcCCcCCCcCchhhhcCCCccEEeccCCcCCCCCchhhcCCCCC-CEEEccCCcCc
Q 005619          339 LQSNALGGSIPNTIFRGSALETLDLRDNYFFGRIPHQINEHSNLRALLLRGNYLQGPIPHQLCQLRKL-SIMDLSHNRLN  417 (688)
Q Consensus       339 L~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L-~~L~ls~n~l~  417 (688)
                      +++|++.+..+..+..+..|+.+++++|.+.+.+|..+..++.++.+++++|.+.+.+|..+..+..+ +.+++++|+++
T Consensus       108 Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~  187 (313)
T d1ogqa_         108 ITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLT  187 (313)
T ss_dssp             EEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEE
T ss_pred             hccccccccccccccchhhhcccccccccccccCchhhccCcccceeecccccccccccccccccccccccccccccccc
Confidence            55555555555566667778888888888877888888888888888888888888888888887765 88999999998


Q ss_pred             cccchhhhhhhhcccCCcccccceeEEecccccccccccccceecccCCCCCCCCCcceEEEeeeccccccccccccccc
Q 005619          418 GSIPACITNLLFWKVGSRYLSGFVMVVMDLGVADIRNYYNSTVQLSLDGIDGRSLGTQVEVNFMTKNRYESYKGVILDYM  497 (688)
Q Consensus       418 ~~~p~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L  497 (688)
                      +..|..+.++                                                                    ..
T Consensus       188 ~~~~~~~~~l--------------------------------------------------------------------~~  199 (313)
T d1ogqa_         188 GKIPPTFANL--------------------------------------------------------------------NL  199 (313)
T ss_dssp             EECCGGGGGC--------------------------------------------------------------------CC
T ss_pred             cccccccccc--------------------------------------------------------------------cc
Confidence            8777665432                                                                    23


Q ss_pred             cEEEccCCcccccCChhhhccCCCCeeeCCCCcCccCCCccccCCCCCCeEeCCCCcccccCCcCCCCCCCCCEEecCCC
Q 005619          498 AGLDLSSNKLTGDIPSEICDLQNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPPQLTELHSLSKFDVSYN  577 (688)
Q Consensus       498 ~~LdLs~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N  577 (688)
                      ..++++++...+.+|..+..+++++.+++++|.+++.+| .++.+++|+.|||++|+++|.+|..+.++++|++|||++|
T Consensus       200 ~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N  278 (313)
T d1ogqa_         200 AFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFN  278 (313)
T ss_dssp             SEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSS
T ss_pred             ccccccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCC
Confidence            458999999999999999999999999999999997665 6888999999999999999999999999999999999999


Q ss_pred             cCccCCCCCcccCCcCccccCCCCCCCCCCCCCCC
Q 005619          578 DLSGPIPDKEQFSTFDESSYRGNLHLCGPPINKSC  612 (688)
Q Consensus       578 ~l~~~~p~~~~~~~~~~~~~~~n~~l~~~p~~~~C  612 (688)
                      +++|.+|....+..+....+.+|+.+||.|+. .|
T Consensus       279 ~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp-~c  312 (313)
T d1ogqa_         279 NLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP-AC  312 (313)
T ss_dssp             EEEEECCCSTTGGGSCGGGTCSSSEEESTTSS-CC
T ss_pred             cccccCCCcccCCCCCHHHhCCCccccCCCCC-CC
Confidence            99999998888889999999999999998864 56



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure