Citrus Sinensis ID: 005634

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680------
MQANVYTSIKLSYDFLESEEAKSLFCLCGLYSEGHAIQVYDLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDDDAKDEVKMCDVIHVVAVSIAAEKRMFNIPNVADVKKKMEETIQKDPIAISLPRRDIQELPKRLQCPHLQLFLLITKGIAPVSMQISDLFFEGTEELKVLSLNRIHFSSLPSSLGRLINLQTLCLDGCGLKDIAIVGQLKKLEILSLRDSKIKQLPLEIGQLTRLQLLDLSDCRSLVVIAPNVISKFSRLKELYMGDSFSQWDKVKGGRNASLAELKGLSKLTTLEIQVRDAQILPQDLVFVELQRYRICIGEALGVQRVDSETSRLVELCGLANVSSLLENYGMKMLLKKTEDINLDELKGVQNVVHELDDGEGFPRLKHLQVKLCSEILHIVGSVGRVRRKVFPLLESLSLIYLNNLETICDSQLTEDQSFSNLRIIKVRNSQKLKQLFSFSIAKNLLRLQKVEVASCYKLEMIFGKNKNVRFSLQVSLPSLEELNLRELRNIKKIWPDHNQGMYCCQNLTTVIVDGCDHMKYLFSYSMVNSLLQLQYLEISYCSSMEGIVDTTGWSERDEGKFIELKVFPKLHSMRLQWLRKLTSFANTGHIHSDLVVEFPSLLNLNIDGCSNMLRFISTSSPEDTNHSEMQPPPLFDEKVFFNKKINFSHNT
ccccccHHHHccccccccccHHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEcHHHHHHHHHHHHcccEEEcccccccccccccccccccEEEEccccccccccccccccccEEEcccccccccccccccHHHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHccccccccEEEccccccccEEccccccccccccEEEccccccccccccccccccHHHccccccccEEEEEEEcccccccccccccccccEEEEEcccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEEccccEEEEccccccccccccccccEEEEccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEccccEEEcccccccccccccccccccEEEEccccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccc
cccccHHHHHEcHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcHHccccccccEEEEHHHHHHHHHHHHHcccEEEEEcccccccccccccccccEEEEEEcccccccccccccccccEEEEEccccccccccccHHHHHHccccEEEEEcccccccccccHcccccccEEEccccccccccccccccccEEEEEcccccHHcccHHcccccccEEEEccccccccccccHccccHcccEEEEEccccccccccccccccHHHHcccccccEEEEEcccccccHcHcccccHcEEEEEccccccccccccccHHHHHcccccccHHHcccccccccccccEEEEEcccccccccccccccccccccccEEEEccccccEEcccccccccccccccccEEEEcccHcHHHcccccccccccccccEEEEEccccccccccccccccccccccEEEEcccccHHHccccccccccccccccccccEEEEccccccHHccccccccccccccccEEEEcccccccccccHHHccccccccEEEEcccccHHHcccccccccccccccccccccccHHHccHHccccHcccccccccccHHccccccccEEEEcccccHHHccccccccccccEEccccccHHHHHHccccccccccc
MQANVYTSIKLSYDFLESEEAKSLFClcglyseghaIQVYDLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKsscllldddakdevkmcDVIHVVAVSIAAEkrmfnipnvADVKKKMEETIqkdpiaislprrdiqelpkrlqcphlQLFLLITkgiapvsmqISDLFFEGTEELKVLSLNrihfsslpssLGRLINLQtlcldgcglkdiaIVGQLKKLEILSLRDSkikqlpleigqltrlqlldlsdcrslvVIAPNVISKFSRLkelymgdsfsqwdkvkggrnaSLAElkglsklttlEIQVRdaqilpqdLVFVELQRYRICIGealgvqrvdsETSRLVELCGLANVSSLLENYGMKMLLKKTEDINLDELKGVQNVVhelddgegfprlKHLQVKLCSEILHIVGSVGRVRRKVFPLLESLSLIYLNNLETIcdsqltedqsfsnlrIIKVRNSQKLKQLFSFSIAKNLLRLQKVEVASCYKLEMIFGKNKNVRFSLQVslpsleelNLRELRNIKkiwpdhnqgmyccqnlttVIVDGCDHMKYLFSYSMVNSLLQLQYLEISYCssmegivdttgwserdegkfielkvfpkLHSMRLQWLRKLTSfantghihSDLVVefpsllnlnidgcsNMLRfistsspedtnhsemqppplfdekvffnkkinfshnt
MQANVYTSIKLSYDFLESEEAKSLFCLCGLYSEGHAIQVYDLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDDDAKDEVKMCDVIHVVAVSiaaekrmfnipnvadVKKKMEetiqkdpiaislpRRDIQELPKRLQCPHLQLFLLITKGIAPVSMQISDLFFEGTEELKVLSLNRIHFSSLPSSLGRLINLQTLCLDGCGLKDIAIVGQLKKLEILSLRDSKIKQLPLEIGQLTRLQLLDLSDCRSLVVIAPNVISKFSRLKELYMGDSFSQWDKVKGGRNASLAELKGLSKLTTLEIQVRDAQILPQDLVFVELQRYRICIGEalgvqrvdsETSRLVELCGLANVSSLLENYGMKMLLKKTEDINLDELKGVQNVVHELDDGEGFPRLKHLQVKLCSEILhivgsvgrvrrKVFPLLESLSLIYLNNLETICDSQLTEDQSFSNLRIIKVRNSQKLKQLFSFSIAKNLLRLQKVEVASCYKLEMIFGKNKNVRFSLQVSLPSLEELNLRELRNIKKIWPDHNQGMYCCQNLTTVIVDGCDHMKYLFSYSMVNSLLQLQYLEISYCSSMEGIVDTTGWSERDEGKFIELKVFPKLHSMRLQWLRKLTSFANTGHIHSDLVVEFPSLLNLNIDGCSNMLRFISTSSPEDTNHSEMQPPPLFDEKVFFNKKINFSHNT
MQANVYTSIKLSYDFLESEEAKSLFCLCGLYSEGHAIQVYDLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDDDAKDEVKMCDVIHVVAVSIAAEKRMFNIPNVADVKKKMEETIQKDPIAISLPRRDIQELPKRLQCPHLQLFLLITKGIAPVSMQISDLFFEGTEELKVLSLNRIHFSSLPSSLGRLINLQTLCLDGCGLKDIAIVGQLKKLEILSLRDSKIKQLPLEIGQLTRLQLLDLSDCRSLVVIAPNVISKFSRLKELYMGDSFSQWDKVKGGRNASLAELKGLSKLTTLEIQVRDAQILPQDLVFVELQRYRICIGEALGVQRVDSETSRLVELCGLANVSSLLENYGMKMLLKKTEDINLDELKGVQNVVHELDDGEGFPRLKHLQVKLCSEILHIVGSVGRVRRKVFPLLESLSLIYLNNLETICDSQLTEDQSFSNLRIIKVRNSQKLKQLFSFSIAKNLLRLQKVEVASCYKLEMIFGKNKNVRFSLQVSLPSleelnlrelrnIKKIWPDHNQGMYCCQNLTTVIVDGCDHMKYLFSYSMVNSLLQLQYLEISYCSSMEGIVDTTGWSERDEGKFIELKVFPKLHSMRLQWLRKLTSFANTGHIHSDLVVEFPSLLNLNIDGCSNMLRFISTSSPEDTNHSEMQPPPLFDEKVFFNKKINFSHNT
****VYTSIKLSYDFLESEEAKSLFCLCGLYSEGHAIQVYDLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDDDAKDEVKMCDVIHVVAVSIAAEKRMFNIPNVADVKKK***TIQKDPIAISLPRRDIQELPKRLQCPHLQLFLLITKGIAPVSMQISDLFFEGTEELKVLSLNRIHFSSLPSSLGRLINLQTLCLDGCGLKDIAIVGQLKKLEILSLRDSKIKQLPLEIGQLTRLQLLDLSDCRSLVVIAPNVISKFSRLKELYMGDSFSQWDKVKGGRNASLAELKGLSKLTTLEIQVRDAQILPQDLVFVELQRYRICIGEALGVQRVDSETSRLVELCGLANVSSLLENYGMKMLLKKTEDINLDELKGVQNVVHELDDGEGFPRLKHLQVKLCSEILHIVGSVGRVRRKVFPLLESLSLIYLNNLETICDSQLTEDQSFSNLRIIKVRNSQKLKQLFSFSIAKNLLRLQKVEVASCYKLEMIFGKNKNVRFSLQVSLPSLEELNLRELRNIKKIWPDHNQGMYCCQNLTTVIVDGCDHMKYLFSYSMVNSLLQLQYLEISYCSSMEGIVDTTGWSERDEGKFIELKVFPKLHSMRLQWLRKLTSFANTGHIHSDLVVEFPSLLNLNIDGCSNMLRFI**********************VFF**********
MQANVYTSIKLSYDFLESEEAKSLFCLCGLYSEGHAIQVYDLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDDDAKDEVKMCDVIHVVAVSIAAEKRMFNIPNVADVKKKMEETIQKDPIAISLPRRDIQELPKRLQCPHLQLFLLITKGIAPVSMQISDLFFEGTEELKVLSLNRIHFSSLPSSLGRLINLQTLCLDGCGLKDIAIVGQLKKLEILSLRDSKIKQLPLEIGQLTRLQLLDLSDCRSLVV******SKFSRLKELYMGDSFSQWDKVKGGRNASLAELKGLSKLTTLEIQVRDAQILPQDLVFVELQRYRICIGEALGVQRVDSETSRLVELCGLANVSSLLENYGMKMLLKKTEDINLDELKGVQNVVHELDDGEGFPRLKHLQVKLCSEILHIVGSVGRVRRKVFPLLESLSLIYLNNLETICDSQLTEDQSFSNLRIIKVRNSQKLKQLFSFSIAKNLLRLQKVEVASCYKLEMIFGKNKNVRFSLQVSLPSLEELNLRELRNIKKIWPDHNQGMYCCQNLTTVIVDGCDHMKYLFSYSMVNSLLQLQYLEISYCSSMEGIVDTTGWSERDEGKFIELKVFPKLHSMRLQWLRKLTSFANTGHIHSDLVVEFPSLLNLNIDGCSNMLRF***************PPPLFDEKVFFNK**NF****
MQANVYTSIKLSYDFLESEEAKSLFCLCGLYSEGHAIQVYDLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDDDAKDEVKMCDVIHVVAVSIAAEKRMFNIPNVADVKKKMEETIQKDPIAISLPRRDIQELPKRLQCPHLQLFLLITKGIAPVSMQISDLFFEGTEELKVLSLNRIHFSSLPSSLGRLINLQTLCLDGCGLKDIAIVGQLKKLEILSLRDSKIKQLPLEIGQLTRLQLLDLSDCRSLVVIAPNVISKFSRLKELYMGDSFSQWDKVKGGRNASLAELKGLSKLTTLEIQVRDAQILPQDLVFVELQRYRICIGEALGVQRVDSETSRLVELCGLANVSSLLENYGMKMLLKKTEDINLDELKGVQNVVHELDDGEGFPRLKHLQVKLCSEILHIVGSVGRVRRKVFPLLESLSLIYLNNLETICDSQLTEDQSFSNLRIIKVRNSQKLKQLFSFSIAKNLLRLQKVEVASCYKLEMIFGKNKNVRFSLQVSLPSLEELNLRELRNIKKIWPDHNQGMYCCQNLTTVIVDGCDHMKYLFSYSMVNSLLQLQYLEISYCSSMEGIVDTTGWSERDEGKFIELKVFPKLHSMRLQWLRKLTSFANTGHIHSDLVVEFPSLLNLNIDGCSNMLRFISTS**********QPPPLFDEKVFFNKKINFSHNT
*QANVYTSIKLSYDFLESEEAKSLFCLCGLYSEGHAIQVYDLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDDDAKDEVKMCDVIHVVAVSIAAEKRMFNIPNVADVKKKMEETIQKDPIAISLPRRDIQELPKRLQCPHLQLFLLITKGIAPVSMQISDLFFEGTEELKVLSLNRIHFSSLPSSLGRLINLQTLCLDGCGLKDIAIVGQLKKLEILSLRDSKIKQLPLEIGQLTRLQLLDLSDCRSLVVIAPNVISKFSRLKELYMGDSFSQWDKVKGGRNASLAELKGLSKLTTLEIQVRDAQILPQDLVFVELQRYRICIGEALGVQRVDSETSRLVELCGLANVSSLLENYGMKMLLKKTEDINLDELKGVQNVVHELDDGEGFPRLKHLQVKLCSEILHIVGSVGRVRRKVFPLLESLSLIYLNNLETICDSQLTEDQSFSNLRIIKVRNSQKLKQLFSFSIAKNLLRLQKVEVASCYKLEMIFGKNKNVRFSLQVSLPSLEELNLRELRNIKKIWPDHNQGMYCCQNLTTVIVDGCDHMKYLFSYSMVNSLLQLQYLEISYCSSMEGIVDTTGWSERDEGKFIELKVFPKLHSMRLQWLRKLTSFANTGHIHSDLVVEFPSLLNLNIDGCSNMLRFISTSSPEDTNHSEMQPPPLFDEKVFFNK********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQANVYTSIKLSYDFLESEEAKSLFCLCGLYSEGHAIQVYDLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLDDDAKDEVKMCDVIHVVAVSIAAEKRMFNIPNVADVKKKMEETIQKDPIAISLPRRDIQELPKRLQCPHLQLFLLITKGIAPVSMQISDLFFEGTEELKVLSLNRIHFSSLPSSLGRLINLQTLCLDGCGLKDIAIVGQLKKLEILSLRDSKIKQLPLEIGQLTRLQLLDLSDCRSLVVIAPNVISKFSRLKELYMGDSFSQWDKVKGGRNASLAELKGLSKLTTLEIQVRDAQILPQDLVFVELQRYRICIGEALGVQRVDSETSRLVELCGLANVSSLLENYGMKMLLKKTEDINLDELKGVQNVVHELDDGEGFPRLKHLQVKLCSEILHIVGSVGRVRRKVFPLLESLSLIYLNNLETICDSQLTEDQSFSNLRIIKVRNSQKLKQLFSFSIAKNLLRLQKVEVASCYKLEMIFGKNKNVRFSLQVSLPSLEELNLRELRNIKKIWPDHNQGMYCCQNLTTVIVDGCDHMKYLFSYSMVNSLLQLQYLEISYCSSMEGIVDTTGWSERDEGKFIELKVFPKLHSMRLQWLRKLTSFANTGHIHSDLVVEFPSLLNLNIDGCSNMLRFISTSSPEDTNHSEMQPPPLFDEKVFFNKKINFSHNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query686 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.793 0.591 0.255 1e-32
Q42484909 Disease resistance protei no no 0.721 0.544 0.247 6e-31
Q9T048985 Disease resistance protei no no 0.809 0.563 0.256 7e-31
Q8RXS5888 Probable disease resistan no no 0.629 0.486 0.258 2e-11
Q9LVT4843 Probable disease resistan no no 0.346 0.282 0.284 3e-11
Q9FLB4874 Putative disease resistan no no 0.348 0.273 0.269 5e-10
Q9C8T9898 Putative disease resistan no no 0.358 0.273 0.260 6e-10
O82484892 Putative disease resistan no no 0.351 0.270 0.268 1e-09
P60838894 Probable disease resistan no no 0.313 0.240 0.286 8e-09
Q8L3R3885 Disease resistance protei no no 0.355 0.275 0.272 1e-08
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  142 bits (357), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 152/596 (25%), Positives = 281/596 (47%), Gaps = 52/596 (8%)

Query: 2   QANVYTSIKLSYDFLESEEAKSLFCLCGLYSEGHAIQVYDLLRYGVGWGLFENVYTLEEA 61
           +  ++ ++KLSYDFL+ +  KS F  C L+ E ++I+V +L+ Y V  GL +  +  E+ 
Sbjct: 345 EEKIFGTLKLSYDFLQ-DNMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDM 403

Query: 62  RSRVHRLIDNLKSSCLLLDDDAKDEVKMCDVIHVVAVS------------IAAEKRMFNI 109
            +    L++ LK SCLL D D+ D VKM DV+   A+             + A + +   
Sbjct: 404 MNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEF 463

Query: 110 PNVADVKKKMEETIQKDPIAISLPRRDIQELPKRLQCPHLQLFLLITKGIAPVSMQISDL 169
           P     + K   ++Q+    +SL    ++ LP  +    ++  +L+ +G + V  ++ + 
Sbjct: 464 P-----QDKFVSSVQR----VSLMANKLERLPNNV-IEGVETLVLLLQGNSHVK-EVPNG 512

Query: 170 FFEGTEELKVLSLNRIHFSSLPSSLGRLINLQTLCLDGC-GLKDIAIVGQLKKLEILSLR 228
           F +    L++L L+ +   +LP S   L +L++L L  C  L+++  +  L KL+ L L 
Sbjct: 513 FLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLH 572

Query: 229 DSKIKQLPLEIGQLTRLQLLDLSDCRSLVVIAPNVISKFSRLKELYMGDSFSQWDKVKGG 288
           +S I++LP  +  L+ L+ + +S+   L  I    I + S L+ L M  S   W  +KG 
Sbjct: 573 ESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWG-IKGE 631

Query: 289 R---NASLAELKGLSKLTTLEIQVRDAQILPQ--DLVFVELQRYRICIGEALGVQRVDSE 343
                A+L E+  L  L  L I++ D        D +   L +++        V    + 
Sbjct: 632 EREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTG 691

Query: 344 TSRLVELCGLANVSSLLENYGMKMLLKKTEDINLDELKGVQNVVHEL--DDGEGFPRLKH 401
              L     +++V+  + N  +  LL+    ++L+  +G+  +   L       F  +K 
Sbjct: 692 EGCL----AISDVN--VSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKA 745

Query: 402 LQVKLCSEILHIVGSVGRVRRKVFPLLESLSLIYLNNLETICDSQLTEDQSFSNLRIIKV 461
           L +     +    G   ++   +FP LE LSL  + NLE+I +           L++++V
Sbjct: 746 LSIHYFPSLSLASGCESQL--DLFPNLEELSLDNV-NLESIGELNGFLGMRLQKLKLLQV 802

Query: 462 RNSQKLKQLFSFSI-AKNLLRLQKVEVASCYKLEMIFG-KNKNVRFSLQVSLPSLEELNL 519
              ++LK+LFS  I A  L  LQ+++V SC +LE +F   +  V F  +  LP L  + L
Sbjct: 803 SGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKL 862

Query: 520 RELRNIKKIWPDHNQGMYCCQNLTTVIVDGCDHMKYL----FSYSMVNSLLQLQYL 571
           + L  ++ +  D        ++L  + V+ C+ +K L     +  M+N  +  +Y+
Sbjct: 863 KYLPQLRSLCNDR----VVLESLEHLEVESCESLKNLPFVPGNTGMINEQMAWEYM 914
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query686
255563252 1603 Disease resistance protein RPS5, putativ 0.956 0.409 0.405 1e-120
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.948 0.485 0.402 1e-112
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.941 0.491 0.386 1e-107
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.959 0.492 0.398 1e-106
224125154 949 cc-nbs-lrr resistance protein [Populus t 0.708 0.512 0.466 1e-105
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.960 0.389 0.387 1e-103
255574526 1232 Disease resistance protein RFL1, putativ 0.903 0.503 0.397 1e-102
359488095 1347 PREDICTED: probable disease resistance p 0.956 0.487 0.379 1e-101
359488103 1530 PREDICTED: disease resistance protein At 0.956 0.428 0.376 1e-101
359488025 1781 PREDICTED: uncharacterized protein LOC10 0.948 0.365 0.383 1e-101
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  439 bits (1128), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 306/754 (40%), Positives = 430/754 (57%), Gaps = 98/754 (12%)

Query: 1    MQANVYTSIKLSYDFLESEEAKSLFCLCGLYSEGHAIQVYDLLRYGVGWGLFENVYTLEE 60
            +Q  VY++++LSY+ L   E KSLF LCGL  +   I + DLL Y  G GLF+ + TL +
Sbjct: 379  IQEKVYSALELSYNHLIGAEVKSLFLLCGLLGKSD-IAILDLLMYSTGLGLFKGIDTLGD 437

Query: 61   ARSRVHRLIDNLKSSCLLLDDDAKDEVKMCDVIHVVAVSIAAE-KRMFNIPNVADVKKKM 119
            AR+RVH+LI +LK++CLLLD D K  VK+ DV+  VA+SIA+  + +F + N A +K+  
Sbjct: 438  ARNRVHKLISDLKAACLLLDSDIKGRVKIHDVVRDVAISIASRMQHLFTVRNGALLKEWP 497

Query: 120  EETIQKDPIAISLPRRDIQELPKRLQCPHLQLFLLITKGIAPVSMQISDLFFEGTEELKV 179
             + + K    ISLP  DI  LP+ L+CP L+LFLL T+ I   S+++ DL FE T+ L+V
Sbjct: 498  NKDVCKSCTRISLPYNDIHGLPEVLECPELELFLLFTQDI---SLKVPDLCFELTKNLRV 554

Query: 180  LSLNRIHFSSLPSSLGRLINLQTLCLDGCGLKDIAIVGQLKKLEILSLRDSKIKQLPLEI 239
            L+   +HFSSLP SLG L NL TLCLD C L+D+AI+G+L  L ILS + S I +LP EI
Sbjct: 555  LNFTGMHFSSLPPSLGFLKNLFTLCLDWCALRDVAIIGELTGLTILSFKHSDIVELPREI 614

Query: 240  GQLTRLQLLDLSDCRSLVVIAPNVISKFSRLKELYMGDSFSQWD--KVKGGRNASLAELK 297
             QLT+L+ LDLS C  L VI   +IS+ ++L+ELYM +SF  WD   +   RNASLAEL+
Sbjct: 615  RQLTKLKFLDLSHCLKLKVIPAKIISELTQLEELYMNNSFDLWDVQGINNQRNASLAELE 674

Query: 298  GLSKLTTLEIQVRDAQILPQDLVFVELQRYRICIGEALGVQRVDSETSRLVELCGLANVS 357
             L  LTTLEI V DA+ILP+DL F +L+R+RI IG+       D  TSR ++L    N S
Sbjct: 675  CLPYLTTLEICVLDAKILPKDLFFRKLERFRIFIGDVWS-GTGDYGTSRTLKL--KLNTS 731

Query: 358  SLLENYGMKMLLKKTEDINLDELKGVQNVVHELDDGEGFPRLKHLQVKLCSEILHIVGSV 417
            S+   +G+ +LL+ TED+ L E+KG+++V+++L D +GF +LKHL V+   EI +I+   
Sbjct: 732  SIHLEHGLSILLEVTEDLYLAEVKGIKSVLYDL-DSQGFTQLKHLDVQNDPEIQYIIDPN 790

Query: 418  GRVRRKVFPLLESLSLIYLNNLETICDSQLTEDQSFSNLRIIKVRNSQKLKQLFSFSIAK 477
             R     FP+LESL L  L +LE IC  +LT   SFS LR + V    +LK LFSFS+ +
Sbjct: 791  RRSPCNAFPILESLYLDNLMSLEKICCGKLTTG-SFSKLRSLTVVKCDRLKNLFSFSMMR 849

Query: 478  NLLRLQKVEVASCYKLEMIF--GKNKNVRFSLQVSLPSLEELNLREL------------- 522
             LL+LQ+++V  C  LE I   G          V L  L  L L+ L             
Sbjct: 850  CLLQLQQMKVVDCANLEEIVACGSEDTDNDYEAVKLTQLCSLTLKRLPMFKSFCSKKKVS 909

Query: 523  -------------RNIKKIWPDHNQG--------MYC-------------CQ-------- 540
                           +K+I P    G        M+C             C+        
Sbjct: 910  PISLRVQKQLTTDTGLKEIAPKGELGDPLPLFNEMFCFPNLENLELSSIACEKICDDQLS 969

Query: 541  ----NLTTVIVDGCDHMKYLFSYSMVNSLLQLQYLEISYCSSMEGIVDTTGWSERDEGKF 596
                NL ++IV+ C ++KYLF+ S+V +LL L+ LE+  C S+EGI+      E +  + 
Sbjct: 970  AISSNLMSLIVERCWNLKYLFTSSLVKNLLLLKRLEVFDCMSVEGIIVAEELVEEERNR- 1028

Query: 597  IELKVFPKLHSMRLQWLRKLTSFANTGHIHSDLVVEFPSLLNLNIDGCSNMLRFISTSSP 656
               K+FP+L  ++L+ L  +T F + G+      VEF SL  L I+ C  +  F+S S  
Sbjct: 1029 --KKLFPELDFLKLKNLPHITRFCD-GY-----PVEFSSLRKLLIENCPALNMFVSKSPS 1080

Query: 657  ED--------------TNHSEMQPPPLFDEKVFF 676
             D               +H+E Q  PLF+EKV F
Sbjct: 1081 ADMIESREAKGMNSEKNHHTETQ--PLFNEKVAF 1112

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224125154|ref|XP_002319513.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857889|gb|EEE95436.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359488095|ref|XP_002270726.2| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488103|ref|XP_002263579.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488025|ref|XP_003633688.1| PREDICTED: uncharacterized protein LOC100852821 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query686
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.806 0.601 0.252 3.4e-35
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.699 0.487 0.261 2.7e-34
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.351 0.265 0.303 2.4e-22
TAIR|locus:2171579843 AT5G47250 [Arabidopsis thalian 0.351 0.285 0.287 2e-16
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.625 0.477 0.242 4e-14
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.351 0.271 0.302 1.1e-13
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.344 0.263 0.294 1.2e-12
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.383 0.294 0.265 7.5e-12
TAIR|locus:2153474874 AT5G05400 [Arabidopsis thalian 0.383 0.300 0.266 1.6e-11
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.365 0.283 0.262 1.9e-11
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 410 (149.4 bits), Expect = 3.4e-35, P = 3.4e-35
 Identities = 148/587 (25%), Positives = 278/587 (47%)

Query:     2 QANVYTSIKLSYDFLESEEAKSLFCLCGLYSEGHAIQVYDLLRYGVGWGLFENVYTLEEA 61
             +  ++ ++KLSYDFL+ +  KS F  C L+ E ++I+V +L+ Y V  GL +  +  E+ 
Sbjct:   345 EEKIFGTLKLSYDFLQ-DNMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDM 403

Query:    62 RSRVHRLIDNLKSSCLLLDDDAKDEVKMCDVIHVVAV-SIAAEKRMFNIPNVAD--VKKK 118
              +    L++ LK SCLL D D+ D VKM DV+   A+  ++++   F+   +A   + + 
Sbjct:   404 MNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEF 463

Query:   119 MEETIQKDPIAISLPRRDIQELPKRLQCPHLQLFLLITKGIAPVSMQISDLFFEGTEELK 178
              ++        +SL    ++ LP  +    ++  +L+ +G + V  ++ + F +    L+
Sbjct:   464 PQDKFVSSVQRVSLMANKLERLPNNV-IEGVETLVLLLQGNSHVK-EVPNGFLQAFPNLR 521

Query:   179 VLSLNRIHFSSLPSSLGRLINLQTLCLDGCG-LKDIAIVGQLKKLEILSLRDSKIKQLPL 237
             +L L+ +   +LP S   L +L++L L  C  L+++  +  L KL+ L L +S I++LP 
Sbjct:   522 ILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPR 581

Query:   238 EIGQLTRLQLLDLSDCRSLVVIAPNVISKFSRLKELYMGDSFSQWDKVKGGRN---ASLA 294
              +  L+ L+ + +S+   L  I    I + S L+ L M  S   W  +KG      A+L 
Sbjct:   582 GLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWG-IKGEEREGQATLD 640

Query:   295 ELKGLSKLTTLEIQVRDAQILPQ--DLVFVELQRYRICIGEALGVQRVDSETSRLVELCG 352
             E+  L  L  L I++ D        D +   L +++        V    +    L     
Sbjct:   641 EVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTGEGCLA---- 696

Query:   353 LANVSSLLENYGMKMLLKKTEDINLDELKGVQNVVHEL--DDGEGFPRLKHLQVKLCSEI 410
             +++V+  + N  +  LL+    ++L+  +G+  +   L       F  +K L +     +
Sbjct:   697 ISDVN--VSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSL 754

Query:   411 LHIVGSVGRVRRKVFPLLESLSLIYLNNLETICDSQLTEDQSFSNLRIIKVRNSQKLKQL 470
                 G   ++   +FP LE LSL  +N LE+I +           L++++V   ++LK+L
Sbjct:   755 SLASGCESQL--DLFPNLEELSLDNVN-LESIGELNGFLGMRLQKLKLLQVSGCRQLKRL 811

Query:   471 FSFSI-AKNLLRLQKVEVASCYKLEMIFG-KNKNVRFSLQVSLPSXXXXXXXXXXXIKKI 528
             FS  I A  L  LQ+++V SC +LE +F   +  V F  +  LP            ++ +
Sbjct:   812 FSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKLKYLPQLRSL 871

Query:   529 WPDHNQGMYCCQNLTTVIVDGCDHMKYL-F---SYSMVNSLLQLQYL 571
               D        ++L  + V+ C+ +K L F   +  M+N  +  +Y+
Sbjct:   872 CNDR----VVLESLEHLEVESCESLKNLPFVPGNTGMINEQMAWEYM 914
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.03110003
cc-nbs-lrr resistance protein (1340 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query686
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information 
 Score = 52.3 bits (125), Expect = 5e-07
 Identities = 37/111 (33%), Positives = 50/111 (45%), Gaps = 3/111 (2%)

Query: 165 QISDLFFEGTEELKVLSLNRIHFSSLPSSLGRLINLQTLCLDGCGLKDI-AIVGQLKKLE 223
            I  L       LK L L+     SLPS L  L NL+ L L    L D+  ++  L  L 
Sbjct: 130 DIPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLN 189

Query: 224 ILSLRDSKIKQLPLEIGQLTRLQLLDLSDCRSLVVIAPNVISKFSRLKELY 274
            L L  +KI  LP EI  L+ L+ LDLS   + ++   + +S    L  L 
Sbjct: 190 NLDLSGNKISDLPPEIELLSALEELDLS--NNSIIELLSSLSNLKNLSGLE 238

Length = 394
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 686
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.98
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.81
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.79
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.49
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.48
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.44
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.44
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.43
KOG4341483 consensus F-box protein containing LRR [General fu 99.29
KOG4341483 consensus F-box protein containing LRR [General fu 99.22
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.19
KOG4237498 consensus Extracellular matrix protein slit, conta 99.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.12
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.1
KOG4237498 consensus Extracellular matrix protein slit, conta 99.09
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.07
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.05
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.96
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.9
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.87
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.86
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.64
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.62
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.57
PLN03150623 hypothetical protein; Provisional 98.54
PLN03150623 hypothetical protein; Provisional 98.52
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.43
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.43
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.37
PRK15386 426 type III secretion protein GogB; Provisional 98.34
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.27
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.25
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.23
PRK15386 426 type III secretion protein GogB; Provisional 98.22
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.21
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.15
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.11
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.09
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.06
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.99
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.9
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.88
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.88
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.84
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.82
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.8
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.53
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.41
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.14
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.09
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.91
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.56
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.04
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.85
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.75
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.6
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.59
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.53
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.42
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.55
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.43
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.78
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.19
smart0037026 LRR Leucine-rich repeats, outliers. 91.19
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.0
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.67
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 89.2
smart0037026 LRR Leucine-rich repeats, outliers. 86.94
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.94
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 84.92
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=3.4e-47  Score=420.98  Aligned_cols=458  Identities=24%  Similarity=0.338  Sum_probs=300.7

Q ss_pred             CccccchhhhcccccCCCchhHHHHhhhcccCCCCccCHHHHHHHhhhcccccccCCHHHHHHHHHHHHHHHHHcccccc
Q 005634            1 MQANVYTSIKLSYDFLESEEAKSLFCLCGLYSEGHAIQVYDLLRYGVGWGLFENVYTLEEARSRVHRLIDNLKSSCLLLD   80 (686)
Q Consensus         1 ~~~~i~~~L~lSY~~Lp~~~lk~cfly~s~fp~~~~i~~~~Li~~Wiaegfi~~~~~~e~~~~~~~~~~~~L~~~~l~~~   80 (686)
                      |++.|+++|++|||+||.+ +|.||+|||+|||||+|++++||++|||||||.+....+.|++.|++|+.+|+++++++.
T Consensus       393 ~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~  471 (889)
T KOG4658|consen  393 MEESILPILKLSYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIE  471 (889)
T ss_pred             hhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhh
Confidence            5678999999999999977 999999999999999999999999999999998855667799999999999999999997


Q ss_pred             cC---CCCcEEechhHHHHHHHHHh-----ccCeeeecCCCchhhhhcccCCCCCEEEEccCCCCCCCCCcCCCCCcceE
Q 005634           81 DD---AKDEVKMCDVIHVVAVSIAA-----EKRMFNIPNVADVKKKMEETIQKDPIAISLPRRDIQELPKRLQCPHLQLF  152 (686)
Q Consensus        81 ~~---~~~~~~mhdl~~dla~~i~~-----~~~~~~~~~~~~~~~~~~~~~~~~l~~l~l~~~~~~~l~~~~~~~~L~~L  152 (686)
                      .+   ...+|+|||+|||||.++|.     +++ ..+.++......|....+..+|++++.++.+..++....+++|++|
T Consensus       472 ~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~-~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tL  550 (889)
T KOG4658|consen  472 ERDEGRKETVKMHDVVREMALWIASDFGKQEEN-QIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTL  550 (889)
T ss_pred             cccccceeEEEeeHHHHHHHHHHhccccccccc-eEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceE
Confidence            65   34679999999999999999     455 3344333333355556678899999999999999888888899999


Q ss_pred             EcccCCCcccccccchhHhcCCCCccEEEecCcc-CCCCchhhhcCCCCcEEEccCCCCCCcccccCCCCCCEEEccCCC
Q 005634          153 LLITKGIAPVSMQISDLFFEGTEELKVLSLNRIH-FSSLPSSLGRLINLQTLCLDGCGLKDIAIVGQLKKLEILSLRDSK  231 (686)
Q Consensus       153 ~l~~~~~~~~~~~~~~~~~~~l~~Lr~L~l~~~~-~~~lp~~l~~l~~Lr~L~L~~~~l~~~~~i~~L~~L~~L~l~~~~  231 (686)
                      .+.+|..  ....++..+|..++.||+||+++|. +.++|+++                      +.|.+||||+++++.
T Consensus       551 ll~~n~~--~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I----------------------~~Li~LryL~L~~t~  606 (889)
T KOG4658|consen  551 LLQRNSD--WLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSI----------------------GELVHLRYLDLSDTG  606 (889)
T ss_pred             EEeecch--hhhhcCHHHHhhCcceEEEECCCCCccCcCChHH----------------------hhhhhhhcccccCCC
Confidence            9999861  1456777777778888888777653 34555555                      445555555566666


Q ss_pred             CCCcchhhcCCCCCCEEeCcCCcCccccChhhhcCCCCCcEEEecCCccccccccCCCccchhhhCCCCCccEEEEeecC
Q 005634          232 IKQLPLEIGQLTRLQLLDLSDCRSLVVIAPNVISKFSRLKELYMGDSFSQWDKVKGGRNASLAELKGLSKLTTLEIQVRD  311 (686)
Q Consensus       232 i~~lp~~i~~L~~L~~L~l~~~~~l~~lp~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~  311 (686)
                      |+.+|.++++|.+|++|++..+..+..+|. ++..|++||+|.+......      .......++.++.+|+.+.+....
T Consensus       607 I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~-i~~~L~~Lr~L~l~~s~~~------~~~~~l~el~~Le~L~~ls~~~~s  679 (889)
T KOG4658|consen  607 ISHLPSGLGNLKKLIYLNLEVTGRLESIPG-ILLELQSLRVLRLPRSALS------NDKLLLKELENLEHLENLSITISS  679 (889)
T ss_pred             ccccchHHHHHHhhheeccccccccccccc-hhhhcccccEEEeeccccc------cchhhHHhhhcccchhhheeecch
Confidence            667777777777777777776665555543 2555777777777655422      334456666666677666664332


Q ss_pred             CCcCCCcc-cccCccEEEEEecCcCCccccCCCCccEEEEcCccCccchhhhhhHhhhhccccEEEEccccCcccccccC
Q 005634          312 AQILPQDL-VFVELQRYRICIGEALGVQRVDSETSRLVELCGLANVSSLLENYGMKMLLKKTEDINLDELKGVQNVVHEL  390 (686)
Q Consensus       312 ~~~~~~~~-~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l  390 (686)
                      . .+-... .+..|.                                            ...+.+.+.++...+    ..
T Consensus       680 ~-~~~e~l~~~~~L~--------------------------------------------~~~~~l~~~~~~~~~----~~  710 (889)
T KOG4658|consen  680 V-LLLEDLLGMTRLR--------------------------------------------SLLQSLSIEGCSKRT----LI  710 (889)
T ss_pred             h-HhHhhhhhhHHHH--------------------------------------------HHhHhhhhcccccce----ee
Confidence            2 100000 111111                                            111111111111111    11


Q ss_pred             CCCCCCCCCceEEeecCCCceEeeccccccccc-cCCcccEeeccccccchhhcccCCCCCCcCCCcCEEEEecCCCCcc
Q 005634          391 DDGEGFPRLKHLQVKLCSEILHIVGSVGRVRRK-VFPLLESLSLIYLNNLETICDSQLTEDQSFSNLRIIKVRNSQKLKQ  469 (686)
Q Consensus       391 ~~l~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~-~~~~L~~L~l~~~~~l~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~  469 (686)
                      ..+..+.+|+.|.|.+|...+............ .|+++.++.+.+|..+++.....     ..|+|+.|.+..|+.+.+
T Consensus       711 ~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~-----f~~~L~~l~l~~~~~~e~  785 (889)
T KOG4658|consen  711 SSLGSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLL-----FAPHLTSLSLVSCRLLED  785 (889)
T ss_pred             cccccccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccccccccchhh-----ccCcccEEEEeccccccc
Confidence            125678889999999887654322111111112 26677777777776666544322     347777777777777776


Q ss_pred             ccCchhhhhcCCccEEEEeecccceeeeccccccccccccccCCccee-ecccccccccccccCCCccccCCCCeEEEEe
Q 005634          470 LFSFSIAKNLLRLQKVEVASCYKLEMIFGKNKNVRFSLQVSLPSLEEL-NLRELRNIKKIWPDHNQGMYCCQNLTTVIVD  548 (686)
Q Consensus       470 l~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~~~~~~~~~~L~~L-~l~~~~~l~~~~~~~~~~~~~l~~L~~L~i~  548 (686)
                      ..+  ....+..++++.                      ..|.+++.+ .+.+.+.++.+.....    .++.|+.+.+.
T Consensus       786 ~i~--~~k~~~~l~~~i----------------------~~f~~~~~l~~~~~l~~l~~i~~~~l----~~~~l~~~~ve  837 (889)
T KOG4658|consen  786 IIP--KLKALLELKELI----------------------LPFNKLEGLRMLCSLGGLPQLYWLPL----SFLKLEELIVE  837 (889)
T ss_pred             CCC--HHHHhhhcccEE----------------------ecccccccceeeecCCCCceeEeccc----Cccchhheehh
Confidence            544  334444444421                      234444444 3555555555433333    25568888888


Q ss_pred             cCCCcccccchhHHHhhccCcEEEEeec-cCcceE
Q 005634          549 GCDHMKYLFSYSMVNSLLQLQYLEISYC-SSMEGI  582 (686)
Q Consensus       549 ~C~~L~~l~~~~~~~~l~~L~~L~i~~C-~~l~~l  582 (686)
                      .|+++..+         |.+.++.|.+| +.+..+
T Consensus       838 ~~p~l~~~---------P~~~~~~i~~~~~~~~~~  863 (889)
T KOG4658|consen  838 ECPKLGKL---------PLLSTLTIVGCEEKLKEY  863 (889)
T ss_pred             cCcccccC---------ccccccceeccccceeec
Confidence            88877665         67778888887 544433

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query686
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 5e-04
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 8e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 8e-04
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 8e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 9e-04
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure 
Iteration: 1

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 90/177 (50%), Gaps = 23/177 (12%)
Query: 192 SSLGRLINLQTLCLDGCGLKDIAIVGQLKKLEILSLRDSKIKQLPLEIGQLTRLQLLDLS 251
           S L +L NL++L      + DI  +G L  L+ LSL  +++K +   +  LT L  LDL+
Sbjct: 189 SVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLA 247
Query: 252 DCRSLVVIAPNVISKFSRLKELYMGDSFSQWDKVKGGRNASLAELKGLSKLTTLEI---Q 308
           + + +  +AP  +S  ++L EL +G            + ++++ L GL+ LT LE+   Q
Sbjct: 248 NNQ-ISNLAP--LSGLTKLTELKLG----------ANQISNISPLAGLTALTNLELNENQ 294
Query: 309 VRDAQILP--QDLVFVELQRYRIC----IGEALGVQRVDSETSRLVELCGLANVSSL 359
           + D   +   ++L ++ L    I     +     +QR+    +++ ++  LAN++++
Sbjct: 295 LEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFSNNKVSDVSSLANLTNI 351
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query686
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-04
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-06
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 7e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 84.6 bits (210), Expect = 6e-18
 Identities = 27/113 (23%), Positives = 44/113 (38%), Gaps = 9/113 (7%)

Query: 175 EELKVLSLNRIHFSSLPSSLGRLINLQTLCLDGCGLKDI-AIVGQLKKLEILSLRDSKIK 233
                L L  +     P    RL +LQ + +D  GL ++   + Q   LE L+L  + ++
Sbjct: 81  PGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLR 140

Query: 234 QLPLEIGQLTRLQLLDLSDCRSLVVI--------APNVISKFSRLKELYMGDS 278
            LP  I  L RL+ L +  C  L  +        A         L+ L +  +
Sbjct: 141 ALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWT 193
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query686
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.98
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.98
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.81
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.78
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.78
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.78
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.77
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.7
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.68
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.66
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.64
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.63
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.63
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.62
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.61
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.59
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.59
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.58
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.58
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.57
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.57
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.56
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.55
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.55
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.54
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.52
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.52
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.52
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.49
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.48
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.47
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.4
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.37
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.37
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.34
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.34
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.33
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.25
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.24
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.06
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.92
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.88
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.87
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.85
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.83
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.72
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.61
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.58
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.52
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.48
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.42
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.4
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.36
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.28
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.19
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.19
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.89
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.88
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.81
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.58
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.74
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.73
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.42
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.34
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.25
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.58
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
Probab=100.00  E-value=6.2e-33  Score=309.30  Aligned_cols=464  Identities=18%  Similarity=0.155  Sum_probs=274.2

Q ss_pred             CchhhhhcccCCCCCEEEEccCCCCCCCCCc-C-CCCCcceEEcccCCCcccccccchhHhcCCCCccEEEecCccCCCC
Q 005634          113 ADVKKKMEETIQKDPIAISLPRRDIQELPKR-L-QCPHLQLFLLITKGIAPVSMQISDLFFEGTEELKVLSLNRIHFSSL  190 (686)
Q Consensus       113 ~~~~~~~~~~~~~~l~~l~l~~~~~~~l~~~-~-~~~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~Lr~L~l~~~~~~~l  190 (686)
                      .....+|. ...+++++|++++|.+..++.. + ++++|++|++++|.    ...+++..|.++++|++|++++|.++.+
T Consensus        21 ~~l~~ip~-~~~~~l~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~----l~~i~~~~~~~l~~L~~L~Ls~n~l~~~   95 (606)
T 3vq2_A           21 QKLSKVPD-DIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCE----IETIEDKAWHGLHHLSNLILTGNPIQSF   95 (606)
T ss_dssp             SCCSSCCT-TSCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECTTCC----CCEECTTTTTTCTTCCEEECTTCCCCCC
T ss_pred             CCcccCCC-CCCCCcCEEECCCCCcCEeChhhccCCccCcEEeCCCCc----ccccCHHHhhchhhcCEeECCCCccccc
Confidence            34455554 3468899999999999877763 3 89999999999998    4456565669999999999999999877


Q ss_pred             -chhhhcCCCCcEEEccCCCCCC-c-ccccCCCCCCEEEccCCCCC--CcchhhcCCCCCCEEeCcCCcCccccChhhhc
Q 005634          191 -PSSLGRLINLQTLCLDGCGLKD-I-AIVGQLKKLEILSLRDSKIK--QLPLEIGQLTRLQLLDLSDCRSLVVIAPNVIS  265 (686)
Q Consensus       191 -p~~l~~l~~Lr~L~L~~~~l~~-~-~~i~~L~~L~~L~l~~~~i~--~lp~~i~~L~~L~~L~l~~~~~l~~lp~~~l~  265 (686)
                       |..++++++|++|++++|.++. + ..++++++|++|++++|.++  .+|..++++++|++|++++|. +..++...++
T Consensus        96 ~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~lp~~~~~l~~L~~L~Ls~n~-l~~~~~~~~~  174 (606)
T 3vq2_A           96 SPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNY-IQTITVNDLQ  174 (606)
T ss_dssp             CTTSSTTCTTCCEEECTTSCCCCSSSSCCTTCTTCCEEECCSSCCCCCCCCGGGGTCTTCCEEECCSSC-CCEECTTTTH
T ss_pred             ChhhcCCcccCCEEEccCCccccccccccCCCCCCCEEeCCCCcccceechHhHhhcCCCCEEEccCCc-ceecChhhhh
Confidence             7889999999999999999887 4 78999999999999999998  589999999999999999997 7777655466


Q ss_pred             CCCCCc----EEEecCCccccccccCCCccchhhhCCCCCccEEEEeecCCC--cCCCcc--------------------
Q 005634          266 KFSRLK----ELYMGDSFSQWDKVKGGRNASLAELKGLSKLTTLEIQVRDAQ--ILPQDL--------------------  319 (686)
Q Consensus       266 ~l~~L~----~L~l~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~--~~~~~~--------------------  319 (686)
                      .+++|+    +|++++|.+...         ........+|+.|++++|...  ..+..+                    
T Consensus       175 ~l~~L~~~l~~L~l~~n~l~~~---------~~~~~~~~~L~~L~L~~n~~~~~~~~~~~~~l~~L~~l~l~~~~~~~~~  245 (606)
T 3vq2_A          175 FLRENPQVNLSLDMSLNPIDFI---------QDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKDER  245 (606)
T ss_dssp             HHHHCTTCCCEEECTTCCCCEE---------CTTTTTTCEEEEEEEESCCSCHHHHHHHHHTTTTCEEEEEEEECCTTSC
T ss_pred             hhhccccccceeeccCCCccee---------CcccccCceeeeeeccCCccchhHHHHHhccccccccccccccccccCC
Confidence            666554    788888876511         111222225666666555432  011111                    


Q ss_pred             -------------------------------------cccCccEEEEEecCcCCcc-ccCCCCccEEEEcCccCccchhh
Q 005634          320 -------------------------------------VFVELQRYRICIGEALGVQ-RVDSETSRLVELCGLANVSSLLE  361 (686)
Q Consensus       320 -------------------------------------~l~~L~~L~l~~~~~~~~~-~~~~~~l~~l~l~~~~~~~~~~~  361 (686)
                                                           .+.+|+.+.+..+...... .....+++.+.+.++.- ..++ 
T Consensus       246 ~l~~~~~~~~~~l~~l~l~~l~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~l~~l~~~~~L~~L~l~~n~l-~~lp-  323 (606)
T 3vq2_A          246 NLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQL-KQFP-  323 (606)
T ss_dssp             CCSCCCGGGGTTGGGSEEEEEEECCCTTCCGGGGSCGGGTTCSEEEEESCCCCCCCCCCTTCCCSEEEEESCCC-SSCC-
T ss_pred             cccccChHHhhhhhhccHhheeccccccccccccccccCCCCCEEEecCccchhhhhccccccCCEEEcccccC-cccc-
Confidence                                                 2333444444333211111 12233444555544321 1111 


Q ss_pred             hhhHhhhhccccEEEEccccCcccccccCCCCCCCCCCceEEeecCCCceEeeccccccccccCCcccEeeccccccchh
Q 005634          362 NYGMKMLLKKTEDINLDELKGVQNVVHELDDGEGFPRLKHLQVKLCSEILHIVGSVGRVRRKVFPLLESLSLIYLNNLET  441 (686)
Q Consensus       362 ~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~  441 (686)
                        .+  .+++|+.|.+.++......    . ...+++|+.|+++++. +..+..  .......+++|++|+++++. ++.
T Consensus       324 --~~--~l~~L~~L~l~~n~~~~~~----~-~~~l~~L~~L~ls~n~-l~~~~~--~~~~~~~~~~L~~L~L~~n~-l~~  390 (606)
T 3vq2_A          324 --TL--DLPFLKSLTLTMNKGSISF----K-KVALPSLSYLDLSRNA-LSFSGC--CSYSDLGTNSLRHLDLSFNG-AII  390 (606)
T ss_dssp             --CC--CCSSCCEEEEESCSSCEEC----C-CCCCTTCCEEECCSSC-EEEEEE--CCHHHHCCSCCCEEECCSCS-EEE
T ss_pred             --cC--CCCccceeeccCCcCccch----h-hccCCCCCEEECcCCc-cCCCcc--hhhhhccCCcccEeECCCCc-ccc
Confidence              11  3445555555544332211    1 3455555555555542 211100  00123345666666666543 333


Q ss_pred             hcccCCCCCCcCCCcCEEEEecCCCCccccCchhhhhcCCccEEEEeecccceeeeccccccccccccccCCcceeeccc
Q 005634          442 ICDSQLTEDQSFSNLRIIKVRNSQKLKQLFSFSIAKNLLRLQKVEVASCYKLEMIFGKNKNVRFSLQVSLPSLEELNLRE  521 (686)
Q Consensus       442 ~~~~~~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~  521 (686)
                      ++..    ...+++|++|++++|. +...++...+..+++|++|++++|......+        .....+++|++|++++
T Consensus       391 ~~~~----~~~l~~L~~L~l~~n~-l~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~--------~~~~~l~~L~~L~l~~  457 (606)
T 3vq2_A          391 MSAN----FMGLEELQHLDFQHST-LKRVTEFSAFLSLEKLLYLDISYTNTKIDFD--------GIFLGLTSLNTLKMAG  457 (606)
T ss_dssp             ECCC----CTTCTTCCEEECTTSE-EESTTTTTTTTTCTTCCEEECTTSCCEECCT--------TTTTTCTTCCEEECTT
T ss_pred             chhh----ccCCCCCCeeECCCCc-cCCccChhhhhccccCCEEECcCCCCCccch--------hhhcCCCCCCEEECCC
Confidence            3311    4456666666666643 3443333345566666666666655333222        2345566777777776


Q ss_pred             cccccc-ccccCCCccccCCCCeEEEEecCCCcccccchhHHHhhccCcEEEEeeccCcceEecCCCCccCCCCcccccc
Q 005634          522 LRNIKK-IWPDHNQGMYCCQNLTTVIVDGCDHMKYLFSYSMVNSLLQLQYLEISYCSSMEGIVDTTGWSERDEGKFIELK  600 (686)
Q Consensus       522 ~~~l~~-~~~~~~~~~~~l~~L~~L~i~~C~~L~~l~~~~~~~~l~~L~~L~i~~C~~l~~l~~~~~~~~~~~~~l~~~~  600 (686)
                      + .++. +....   ...+++|++|++++| +++.+++ ..+..+++|++|++++|. ++.+.. ..           +.
T Consensus       458 n-~l~~~~~~~~---~~~l~~L~~L~Ls~n-~l~~~~~-~~~~~l~~L~~L~Ls~N~-l~~~~~-~~-----------~~  518 (606)
T 3vq2_A          458 N-SFKDNTLSNV---FANTTNLTFLDLSKC-QLEQISW-GVFDTLHRLQLLNMSHNN-LLFLDS-SH-----------YN  518 (606)
T ss_dssp             C-EEGGGEECSC---CTTCTTCCEEECTTS-CCCEECT-TTTTTCTTCCEEECCSSC-CSCEEG-GG-----------TT
T ss_pred             C-cCCCcchHHh---hccCCCCCEEECCCC-cCCccCh-hhhcccccCCEEECCCCc-CCCcCH-HH-----------cc
Confidence            6 3332 11111   235667777777776 4555433 345566777777777663 433321 11           11


Q ss_pred             cccccccccccccccccccccCCcccccccccCC-CcceeeecCCCC
Q 005634          601 VFPKLHSMRLQWLRKLTSFANTGHIHSDLVVEFP-SLLNLNIDGCSN  646 (686)
Q Consensus       601 ~~p~L~~L~l~~c~~L~~l~~~~~~~~~~~~~l~-sL~~L~i~~C~~  646 (686)
                      .+++|+.|++.++. +++++..-       ..++ +|+.|+++++|-
T Consensus       519 ~l~~L~~L~l~~N~-l~~~p~~~-------~~l~~~L~~l~l~~N~~  557 (606)
T 3vq2_A          519 QLYSLSTLDCSFNR-IETSKGIL-------QHFPKSLAFFNLTNNSV  557 (606)
T ss_dssp             TCTTCCEEECTTSC-CCCEESCG-------GGSCTTCCEEECCSCCC
T ss_pred             CCCcCCEEECCCCc-CcccCHhH-------hhhcccCcEEEccCCCc
Confidence            25666666666653 55554432       3554 477777766553
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 686
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 55.8 bits (133), Expect = 8e-09
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 2/76 (2%)

Query: 177 LKVLSLNRIHFSSLPSSLGRLINLQTLCLDGCGLKDIAIVGQLKKLEILSLRDSKIKQLP 236
           L  L+L   + S +   +  L  LQ L      + D++ +  L  +  LS   ++I  L 
Sbjct: 309 LTYLTLYFNNISDISP-VSSLTKLQRLFFANNKVSDVSSLANLTNINWLSAGHNQISDLT 367

Query: 237 LEIGQLTRLQLLDLSD 252
             +  LTR+  L L+D
Sbjct: 368 -PLANLTRITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query686
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.68
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.56
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.54
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.34
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.34
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.28
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.13
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.95
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.9
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.86
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.68
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.56
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.04
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.66
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.37
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.22
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.82
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.72
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.87  E-value=1.2e-20  Score=195.03  Aligned_cols=188  Identities=20%  Similarity=0.241  Sum_probs=103.3

Q ss_pred             CCCCCceEEeecCCCceEeeccccccccccCCcccEeeccccccchhhcccCCCCCCcCCCcCEEEEecCCCCccccCch
Q 005634          395 GFPRLKHLQVKLCSEILHIVGSVGRVRRKVFPLLESLSLIYLNNLETICDSQLTEDQSFSNLRIIKVRNSQKLKQLFSFS  474 (686)
Q Consensus       395 ~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~l~~~~  474 (686)
                      .+++++.+.++++. ++.+      ......++|++|++.++. +++++.     ...+++|+.|++.+|. ++.+++  
T Consensus       195 ~l~~~~~l~l~~n~-i~~~------~~~~~~~~L~~L~l~~n~-l~~~~~-----l~~l~~L~~L~l~~n~-l~~~~~--  258 (384)
T d2omza2         195 KLTNLESLIATNNQ-ISDI------TPLGILTNLDELSLNGNQ-LKDIGT-----LASLTNLTDLDLANNQ-ISNLAP--  258 (384)
T ss_dssp             GCTTCSEEECCSSC-CCCC------GGGGGCTTCCEEECCSSC-CCCCGG-----GGGCTTCSEEECCSSC-CCCCGG--
T ss_pred             cccccceeeccCCc-cCCC------CcccccCCCCEEECCCCC-CCCcch-----hhcccccchhccccCc-cCCCCc--
Confidence            45556666655542 1111      123345566666666542 333321     3456677777776653 555543  


Q ss_pred             hhhhcCCccEEEEeecccceeeeccccccccccccccCCcceeecccccccccccccCCCccccCCCCeEEEEecCCCcc
Q 005634          475 IAKNLLRLQKVEVASCYKLEMIFGKNKNVRFSLQVSLPSLEELNLRELRNIKKIWPDHNQGMYCCQNLTTVIVDGCDHMK  554 (686)
Q Consensus       475 ~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~l~~L~~L~i~~C~~L~  554 (686)
                       +..+++|++|+++++. +..++         ....++.++.+.+.++ .++.+..     ...+++++.|+++++ +++
T Consensus       259 -~~~~~~L~~L~l~~~~-l~~~~---------~~~~~~~l~~l~~~~n-~l~~~~~-----~~~~~~l~~L~ls~n-~l~  320 (384)
T d2omza2         259 -LSGLTKLTELKLGANQ-ISNIS---------PLAGLTALTNLELNEN-QLEDISP-----ISNLKNLTYLTLYFN-NIS  320 (384)
T ss_dssp             -GTTCTTCSEEECCSSC-CCCCG---------GGTTCTTCSEEECCSS-CCSCCGG-----GGGCTTCSEEECCSS-CCS
T ss_pred             -ccccccCCEeeccCcc-cCCCC---------cccccccccccccccc-ccccccc-----cchhcccCeEECCCC-CCC
Confidence             4566677777775543 33322         3445666666666665 3443211     234667777777766 566


Q ss_pred             cccchhHHHhhccCcEEEEeeccCcceEecCCCCccCCCCcccccccccccccccccccccccccccCCcccccccccCC
Q 005634          555 YLFSYSMVNSLLQLQYLEISYCSSMEGIVDTTGWSERDEGKFIELKVFPKLHSMRLQWLRKLTSFANTGHIHSDLVVEFP  634 (686)
Q Consensus       555 ~l~~~~~~~~l~~L~~L~i~~C~~l~~l~~~~~~~~~~~~~l~~~~~~p~L~~L~l~~c~~L~~l~~~~~~~~~~~~~l~  634 (686)
                      .+++   +..+++|++|++++| .++.+.              .+..+|+|+.|++.++ ++++++++.        .++
T Consensus       321 ~l~~---l~~l~~L~~L~L~~n-~l~~l~--------------~l~~l~~L~~L~l~~N-~l~~l~~l~--------~l~  373 (384)
T d2omza2         321 DISP---VSSLTKLQRLFFANN-KVSDVS--------------SLANLTNINWLSAGHN-QISDLTPLA--------NLT  373 (384)
T ss_dssp             CCGG---GGGCTTCCEEECCSS-CCCCCG--------------GGGGCTTCCEEECCSS-CCCBCGGGT--------TCT
T ss_pred             CCcc---cccCCCCCEEECCCC-CCCCCh--------------hHcCCCCCCEEECCCC-cCCCChhhc--------cCC
Confidence            6532   456777777777776 354431              1222567777776544 466655444        677


Q ss_pred             CcceeeecC
Q 005634          635 SLLNLNIDG  643 (686)
Q Consensus       635 sL~~L~i~~  643 (686)
                      +|+.|++++
T Consensus       374 ~L~~L~L~~  382 (384)
T d2omza2         374 RITQLGLND  382 (384)
T ss_dssp             TCSEEECCC
T ss_pred             CCCEeeCCC
Confidence            777777764
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure