Citrus Sinensis ID: 005777

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------
MAGFVGVLVSDPWLQSQFTQVELRTLKSKFISTRSQSGRVTVGDLPPLFAKLKAFSEMFKEDEIKAIMGESHTNMEDEVDFESYLRAYLNLQARAAAKSGGSKNSSSFLKAATTTVHHAINESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDGEAYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLAFVAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRNGWVLLEVLDKVSPGSVSWKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQGNKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNWANRKVKKANRTSQIESFKDKNLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPEDIMEVNQKMILILTASIMYWSLQQQSDESDDSGIDASSAASGDGEIERTLSGDISNLAINETASDPNPSVSSQAEVEE
ccccccEEEccHHHHccccHHHHHHHHHHccccccccccEEccccHHHHHHHccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHcccccccHHHHccccHHHHHHHHHHHHHHHccccccEEcccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccEEEEEHHcccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccEEccccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccc
ccccEEEEEEcHHHHccccHHHHHHHHHHHHHcccccccEcHHHHHHHHHHHccccccccHHHHHHHHHHccccccccEcHHHHHHHHHHHHHcccccccccEEcccEEEccccccEEcccHHHHHHHHHHHHHHHHccccHHccccccccHHHHHHHHcccEEHHHHHHHcccccccHHHHcccccccccEHHHHHHHHHHHHHHcccEEEEccHHHHHccccHHHHHHHHHHHHHHHHHHccHHccHHHHHHccccccHHHHHHccHHHHHHHHHHHHHHHcccccEEEcccHHcHcHHHHHHHHHHHcccccccHHHcHcHHHHHHHHHHHHHHccccEEEEcHHHHHcccHHHHHHHHHHHHcccccccccHHHHccccHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHcHHHHHHHHHHcccccccHHEcccccccccHHHHHHHHHHHHHHHHcccEEEEEccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccEEccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEccHHHHHccHHHHHHHHHHHHHcccccccccHcccccccccccccccHHHHHHHHHHHcccccccccccccccccHHcccc
MAGFVGVlvsdpwlqsqFTQVELRTLKSKFIstrsqsgrvtvgdlpPLFAKLKAFSEMFKEDEIKAImgeshtnmedevDFESYLRAYLNLQARAAAksggsknsssFLKAATTTVHHAINESEKASYVAHINSflgedpflskylpidpstnalfdlakDGVLLCKLInvavpgtideraintkrvlnpwernenhtlclnsakaigctvvnigtqdlvegrPHLLLGLISQIIKIQLLAdlnlkktpqlvelvddnndveellglppekVLLKWMNFHLKKAGYEKQVTNFSSDLKDGEAYAHLLNalapehcspatfdtkdptERASKVIEQAEKMdckryltpkdivegspnlNLAFVAHIFQhrnglsmdsnKISFAEMMtddaqtsrEERCFRLWINSLGTATYVNNVFEDVRNGWVLLEVLdkvspgsvswkqatkppikmpfrkvenCNQVVKIGKELNFSLVNVAGNDIVQGNKKLILAFLWQLMRFTMLQLLKNLRthsqgkeitdtdiLNWANrkvkkanrtsqiesfkdknlsngIFFLELLSAVeprvvnwslvtkgeteedkkLNATYIISVARKLGCSIFLLPEDIMEVNQKMILILTASIMYWSLQqqsdesddsgidassaasgdgeiertlsgdisnlainetasdpnpsvssqaevee
MAGFVGVlvsdpwlqsQFTQVELRTLKSkfistrsqsgrvtvgdlppLFAKLKAFSEMFKEDEIKAIMGESHTNMEDEVDFESYLRAYLNLQARAAAKsggsknssSFLKAATTTVHHAINESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINvavpgtideraintkrvlnpwernENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDGEAYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLAFVAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRNGWVLLEVLdkvspgsvswkqatkppikmpfrkVENCNQVVKIGKELNFSLVNVAGNDIVQGNKKLILAFLWQLMRFTMLQLLKNLRthsqgkeitdtdilnwanrkvkkanrtsqiesfkdknlsnGIFFLELLSAVEPRVVNWSLvtkgeteedkklnATYIISVARKLGCSIFLLPEDIMEVNQKMILILTASIMYWSLQQQSDESDDSGIDASSAASGDGEIERTLSGDISNLainetasdpnpsvssqaevee
MAGFVGVLVSDPWLQSQFTQVELRTLKSKFISTRSQSGRVTVGDLPPLFAKLKAFSEMFKEDEIKAIMGESHTNMEDEVDFESYLRAYLNLQaraaaksggsknsssFLKAATTTVHHAINESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDGEAYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLAFVAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRNGWVLLEVLDKVSPGSVSWKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQGNKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNWANRKVKKANRTSQIESFKDKNLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPEDIMEVNQKMILILTASIMYWSLqqqsdesddsgidassaasgdgeieRTLSGDISNLAINETASDPNPSVSSQAEVEE
***FVGVLVSDPWLQSQFTQVELRTLKSKFISTRSQSGRVTVGDLPPLFAKLKAFSEMFKEDEIKAIM*********EVDFESYLRAYLNLQ*******************ATTTVHHAINESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDGEAYAHLLNALAPE**************************DCKRYLTPKDIVEGSPNLNLAFVAHIFQHRNGLS*********************ERCFRLWINSLGTATYVNNVFEDVRNGWVLLEVLDKVSPGSVSWKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQGNKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNWANRKVK*********SFKDKNLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPEDIMEVNQKMILILTASIMYWSL********************************************************
**GFVGVLVSDPWLQSQFTQVELRTLKSKFISTRSQSGRVTVGDLPPLFAKLKAFSEMFKEDEI***************DFESYLRA*********************************NESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLADLNLKKTPQLVE*****************KVLLKWMNFHLKKAGYEKQVTNFSSDLKDGEAYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLAFVAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRNGWVLLEVLDKVSPGSVSWKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQGNKKLILAFLWQLMRFTMLQ******************ILNWANRKVKKANRTSQIESFKDKNLSNGIFFLELLSAVEPRVVNWSLVT******DKKLNATYIISVARKLGCSIFLLPEDIMEVNQKMILILTASIMYWS*****************AASGDGEIERTLSGDISNLA********************
MAGFVGVLVSDPWLQSQFTQVELRTLKSKFISTRSQSGRVTVGDLPPLFAKLKAFSEMFKEDEIKAIMGESHTNMEDEVDFESYLRAYLNLQAR**************LKAATTTVHHAINESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDGEAYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLAFVAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRNGWVLLEVLDKVSPGSVSWKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQGNKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNWANRKVKKANRTSQIESFKDKNLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPEDIMEVNQKMILILTASIMYWSLQ**********************IERTLSGDISNLAINETA***************
*AGFVGVLVSDPWLQSQFTQVELRTLKSKFISTRSQSGRVTVGDLPPLFAKLKAFSEMFKEDEIKAIMGESHTNMEDEVDFESYLRAYLNLQARAAAKSGGSKNSSSFLKAATTTVHHAINESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDGEAYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLAFVAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRNGWVLLEVLDKVSPGSVSWKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQGNKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNWANRKVKKANRTSQIESFKDKNLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPEDIMEVNQKMILILTASIMYWSLQQ************SS**SGDGEIERTLSGDISNLA********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGFVGVLVSDPWLQSQFTQVELRTLKSKFISTRSQSGRVTVGDLPPLFAKLKAFSEMFKEDEIKAIMGESHTNMEDEVDFESYLRAYLNLQARAAAKSGGSKNSSSFLKAATTTVHHAINESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDGEAYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLAFVAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRNGWVLLEVLDKVSPGSVSWKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQGNKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNWANRKVKKANRTSQIESFKDKNLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPEDIMEVNQKMILILTASIMYWSLQQQSDESDDSGIDASSAASGDGEIERTLSGDISNLAINETASDPNPSVSSQAEVEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query677 2.2.26 [Sep-21-2011]
Q9FKI0687 Fimbrin-like protein 2 OS yes no 0.983 0.969 0.784 0.0
Q7G188687 Fimbrin-1 OS=Arabidopsis no no 0.995 0.981 0.706 0.0
Q9FJ70714 Putative fimbrin-like pro no no 0.971 0.921 0.700 0.0
O59945614 Fimbrin OS=Schizosaccharo yes no 0.828 0.913 0.411 1e-127
P32599642 Fimbrin OS=Saccharomyces yes no 0.830 0.875 0.416 1e-125
P54680610 Fimbrin OS=Dictyostelium yes no 0.871 0.967 0.396 1e-123
Q3V0K9630 Plastin-1 OS=Mus musculus yes no 0.865 0.930 0.390 1e-119
P13797630 Plastin-3 OS=Homo sapiens yes no 0.874 0.939 0.376 1e-119
Q99K51630 Plastin-3 OS=Mus musculus no no 0.874 0.939 0.376 1e-118
O88818630 Plastin-3 OS=Cricetulus g yes no 0.874 0.939 0.376 1e-118
>sp|Q9FKI0|FIMB2_ARATH Fimbrin-like protein 2 OS=Arabidopsis thaliana GN=FIM2 PE=2 SV=1 Back     alignment and function desciption
 Score = 1110 bits (2870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/672 (78%), Positives = 598/672 (88%), Gaps = 6/672 (0%)

Query: 1   MAGFVGVLVSDPWLQSQFTQVELRTLKSKFISTRSQSGRVTVGDLPPLFAKLKAFSEMFK 60
           M+ +VGVLVSDPWLQSQFTQVELRTLKSKF+S ++Q GR TVGDLPP+F KLKAF+    
Sbjct: 1   MSSYVGVLVSDPWLQSQFTQVELRTLKSKFVSNKTQLGRFTVGDLPPVFEKLKAFNGTID 60

Query: 61  EDEIKAIMGESHTNMEDEVDFESYLRAYLNLQARAAAKSGGSKNSSSFLKAATTTVHHAI 120
           EDEIK+++ +S+ N +DEVDFE +LRA+L++QAR   KSGGSK +SSFLK +TTTVHHAI
Sbjct: 61  EDEIKSVLDKSYPNADDEVDFEFFLRAFLSVQARGVEKSGGSKGASSFLKTSTTTVHHAI 120

Query: 121 NESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDER 180
           NESEKASYV+H+N++L +DPFL  YLPIDP+TNA FDL KDGVLLCKLINVAVPGTIDER
Sbjct: 121 NESEKASYVSHVNNYLRDDPFLKSYLPIDPATNAFFDLVKDGVLLCKLINVAVPGTIDER 180

Query: 181 AINTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLL 240
           AINTK+ LNPWERNEN TL LNSAKAIGCTVVNIGTQD+ EGRP+L+LGLISQIIKIQ+L
Sbjct: 181 AINTKKTLNPWERNENLTLGLNSAKAIGCTVVNIGTQDIAEGRPYLVLGLISQIIKIQML 240

Query: 241 ADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDG 300
           ADLN KKTP L +LVDD  D EEL+GL PEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDG
Sbjct: 241 ADLNFKKTPSLFQLVDDTQDAEELMGLAPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDG 300

Query: 301 EAYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLA 360
           EAYA+LLNALAPEH +    +TKDPTERA KV+EQAEK+DCKRYL+PKDIV+GS NLNLA
Sbjct: 301 EAYAYLLNALAPEHSTHVALETKDPTERAKKVLEQAEKLDCKRYLSPKDIVDGSANLNLA 360

Query: 361 FVAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRN 420
           FVA IFQHRNGL++D +K SFAEMMTDD +TSREERCFRLWINSLGTATYVNNVFED+RN
Sbjct: 361 FVAQIFQHRNGLTVDDSKTSFAEMMTDDVETSREERCFRLWINSLGTATYVNNVFEDLRN 420

Query: 421 GWVLLEVLDKVSPGSVSWKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQ 480
           GWVLLEVLDKVSPGSV+WK A KPPIKMPF+KVENCN+V+KIGKEL FSLVNVAGNDIVQ
Sbjct: 421 GWVLLEVLDKVSPGSVNWKHANKPPIKMPFKKVENCNEVIKIGKELRFSLVNVAGNDIVQ 480

Query: 481 GNKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNWANRKVKKANRTSQIESFK 540
           GNKKL+LAFLWQLMR+TMLQLL+NLR+HSQGKEITD DILNWANRKVK+  RTSQ +SF+
Sbjct: 481 GNKKLLLAFLWQLMRYTMLQLLRNLRSHSQGKEITDADILNWANRKVKRGGRTSQADSFR 540

Query: 541 DKNLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPED 600
           DKNLS+G+FFLELLSAVEPRVVNWSLVT GETEEDKKLNATYIISVARKLGCSIFLLPED
Sbjct: 541 DKNLSSGMFFLELLSAVEPRVVNWSLVTNGETEEDKKLNATYIISVARKLGCSIFLLPED 600

Query: 601 IMEVNQKMILILTASIMYWSLQQQSDESDDSGIDASSAASGDGEIERTLSGDISNLAINE 660
           I+EVNQKM+LIL ASIMYWSLQQQSD   +S +   +   GD     +++G+ISNL+I +
Sbjct: 601 IIEVNQKMMLILAASIMYWSLQQQSDT--ESTVSEDATDDGDA---NSVAGEISNLSI-D 654

Query: 661 TASDPNPSVSSQ 672
            AS+ +P+V  Q
Sbjct: 655 GASESSPTVQDQ 666
Cross-links actin filaments (F-actin). Stabilizes and prevents F-actin depolymerization mediated by profilin. May regulate actin cytoarchitecture, cell cycle, cell division, cell elongation and cytoplasmic tractus.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7G188|FIMB1_ARATH Fimbrin-1 OS=Arabidopsis thaliana GN=FIM1 PE=1 SV=2 Back     alignment and function description
>sp|Q9FJ70|FIMB3_ARATH Putative fimbrin-like protein 3 OS=Arabidopsis thaliana GN=FIM3 PE=3 SV=1 Back     alignment and function description
>sp|O59945|FIMB_SCHPO Fimbrin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fim1 PE=1 SV=1 Back     alignment and function description
>sp|P32599|FIMB_YEAST Fimbrin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC6 PE=1 SV=1 Back     alignment and function description
>sp|P54680|FIMB_DICDI Fimbrin OS=Dictyostelium discoideum GN=fimA PE=2 SV=2 Back     alignment and function description
>sp|Q3V0K9|PLSI_MOUSE Plastin-1 OS=Mus musculus GN=Pls1 PE=2 SV=1 Back     alignment and function description
>sp|P13797|PLST_HUMAN Plastin-3 OS=Homo sapiens GN=PLS3 PE=1 SV=4 Back     alignment and function description
>sp|Q99K51|PLST_MOUSE Plastin-3 OS=Mus musculus GN=Pls3 PE=1 SV=3 Back     alignment and function description
>sp|O88818|PLST_CRIGR Plastin-3 OS=Cricetulus griseus GN=PLS3 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query677
356554593667 PREDICTED: fimbrin-like protein 2-like [ 0.976 0.991 0.827 0.0
224129126679 predicted protein [Populus trichocarpa] 0.986 0.983 0.824 0.0
356501731675 PREDICTED: fimbrin-like protein 2-like [ 0.974 0.977 0.826 0.0
357495467666 Fimbrin/plastin-like protein [Medicago t 0.976 0.992 0.829 0.0
449453575694 PREDICTED: fimbrin-like protein 2-like [ 0.982 0.958 0.828 0.0
297737515692 unnamed protein product [Vitis vinifera] 0.991 0.969 0.810 0.0
225460813710 PREDICTED: fimbrin-like protein 2-like [ 0.995 0.949 0.794 0.0
15238586687 fimbrin-like protein 2 [Arabidopsis thal 0.983 0.969 0.784 0.0
297805116687 hypothetical protein ARALYDRAFT_493629 [ 0.983 0.969 0.781 0.0
225446993731 PREDICTED: fimbrin-like protein 2 [Vitis 0.997 0.923 0.776 0.0
>gi|356554593|ref|XP_003545629.1| PREDICTED: fimbrin-like protein 2-like [Glycine max] Back     alignment and taxonomy information
 Score = 1137 bits (2940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/665 (82%), Positives = 612/665 (92%), Gaps = 4/665 (0%)

Query: 1   MAGFVGVLVSDPWLQSQFTQVELRTLKSKFISTRSQSGRVTVGDLPPLFAKLKAFSEMFK 60
           M+ FVGVLVSD WLQSQFTQVELRTLKSK++S R+QSGRVTVG+LPP+F KLK FSE+F 
Sbjct: 1   MSSFVGVLVSDQWLQSQFTQVELRTLKSKYVSERTQSGRVTVGNLPPIFKKLKGFSELFT 60

Query: 61  EDEIKAIMGESHTNMEDEVDFESYLRAYLNLQARAAAKSGGSKNSSSFLKAATTTVHHAI 120
           EDEIK  + ES+ NM++E+DFES+LRA+LNLQ+RA AK GGSK+SSSFLKAATTTVHHAI
Sbjct: 61  EDEIKDALAESYQNMDEEIDFESFLRAHLNLQSRAIAKDGGSKSSSSFLKAATTTVHHAI 120

Query: 121 NESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDER 180
           NESEKASYVAHIN++L ED F+S++LPIDPSTNALFDLAKDGVLLCKLIN+AVPGTID+R
Sbjct: 121 NESEKASYVAHINNYLAEDKFMSQFLPIDPSTNALFDLAKDGVLLCKLINIAVPGTIDDR 180

Query: 181 AINTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLL 240
           AINTKRVLNPWERNENHTL LNSAKAIGCTVVNIGTQDL+EGRPHL+LGLISQ+IKIQLL
Sbjct: 181 AINTKRVLNPWERNENHTLGLNSAKAIGCTVVNIGTQDLIEGRPHLVLGLISQVIKIQLL 240

Query: 241 ADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDG 300
           ADLNLKKTPQLVELV+D+ DVEEL+ L P+K+LLKWMNFHLKKAGYEKQVTNFSSDLKDG
Sbjct: 241 ADLNLKKTPQLVELVEDDKDVEELISLAPDKLLLKWMNFHLKKAGYEKQVTNFSSDLKDG 300

Query: 301 EAYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLA 360
           EAYA+LLNALAPE   P+   T DPTERA+ V+EQAEK+DCKRYLTPKDIVEGSPNLNLA
Sbjct: 301 EAYAYLLNALAPEVAGPSALATSDPTERANMVLEQAEKLDCKRYLTPKDIVEGSPNLNLA 360

Query: 361 FVAHIFQHRNGL-SMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVR 419
           FVA IFQHRNGL ++DS K+SFAEMMTDDA+TSREERCFRLWINSLG ATYVNNVFEDVR
Sbjct: 361 FVAQIFQHRNGLTTVDSQKMSFAEMMTDDAETSREERCFRLWINSLGIATYVNNVFEDVR 420

Query: 420 NGWVLLEVLDKVSPGSVSWKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIV 479
           NGWVLLEVLDKVSP SV+WK ATKPPIKMPFRKVENCNQV+KIGKELNFSLVNVAGNDIV
Sbjct: 421 NGWVLLEVLDKVSPASVNWKLATKPPIKMPFRKVENCNQVIKIGKELNFSLVNVAGNDIV 480

Query: 480 QGNKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNWANRKVKKANRTSQIESF 539
           QGNKKL+LAFLWQLMRFTMLQLL+NLR+HSQGKEITD DILNWAN KVK+A RTSQ++SF
Sbjct: 481 QGNKKLLLAFLWQLMRFTMLQLLRNLRSHSQGKEITDADILNWANNKVKRAGRTSQMDSF 540

Query: 540 KDKNLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPE 599
           KDKNLS G+FFLELLSAVEPRVVNWSLVTKGET+EDKKLNATYIISVARKLGCSIFLLPE
Sbjct: 541 KDKNLSGGVFFLELLSAVEPRVVNWSLVTKGETDEDKKLNATYIISVARKLGCSIFLLPE 600

Query: 600 DIMEVNQKMILILTASIMYWSLQQQSDESDDSGIDASSAASGDGEIERTLSGDISNLAIN 659
           DI+EVNQKMILILTASIMYWSL++     ++   +AS  AS DGE E  +  ++SNLAI+
Sbjct: 601 DIIEVNQKMILILTASIMYWSLKK---PEENITPEASPKASVDGESETDVVDEVSNLAID 657

Query: 660 ETASD 664
           +T S+
Sbjct: 658 DTTSE 662

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224129126|ref|XP_002320507.1| predicted protein [Populus trichocarpa] gi|222861280|gb|EEE98822.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356501731|ref|XP_003519677.1| PREDICTED: fimbrin-like protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|357495467|ref|XP_003618022.1| Fimbrin/plastin-like protein [Medicago truncatula] gi|355519357|gb|AET00981.1| Fimbrin/plastin-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449453575|ref|XP_004144532.1| PREDICTED: fimbrin-like protein 2-like [Cucumis sativus] gi|449515963|ref|XP_004165017.1| PREDICTED: fimbrin-like protein 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297737515|emb|CBI26716.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225460813|ref|XP_002276851.1| PREDICTED: fimbrin-like protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|15238586|ref|NP_198420.1| fimbrin-like protein 2 [Arabidopsis thaliana] gi|59797968|sp|Q9FKI0.1|FIMB2_ARATH RecName: Full=Fimbrin-like protein 2 gi|9758643|dbj|BAB09267.1| fimbrin [Arabidopsis thaliana] gi|15027847|gb|AAK76454.1| putative fimbrin protein [Arabidopsis thaliana] gi|23296651|gb|AAN13139.1| putative fimbrin protein [Arabidopsis thaliana] gi|332006624|gb|AED94007.1| fimbrin-like protein 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297805116|ref|XP_002870442.1| hypothetical protein ARALYDRAFT_493629 [Arabidopsis lyrata subsp. lyrata] gi|297316278|gb|EFH46701.1| hypothetical protein ARALYDRAFT_493629 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225446993|ref|XP_002268518.1| PREDICTED: fimbrin-like protein 2 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query677
TAIR|locus:2177291687 FIM5 "FIMBRIN5" [Arabidopsis t 0.983 0.969 0.757 9.8e-277
TAIR|locus:2049158652 AT2G04750 "AT2G04750" [Arabido 0.908 0.943 0.772 4.7e-262
TAIR|locus:2116382687 FIM1 "fimbrin 1" [Arabidopsis 0.995 0.981 0.679 2.6e-253
TAIR|locus:2173867714 AT5G55400 [Arabidopsis thalian 0.983 0.932 0.679 5.7e-249
TAIR|locus:2166096654 AT5G48460 [Arabidopsis thalian 0.917 0.949 0.693 1.3e-235
POMBASE|SPBC1778.06c614 fim1 "fimbrin" [Schizosaccharo 0.872 0.962 0.399 3.8e-117
SGD|S000002536642 SAC6 "Fimbrin, actin-bundling 0.737 0.777 0.452 4.2e-117
ASPGD|ASPL0000003499640 fimA [Emericella nidulans (tax 0.750 0.793 0.433 3.4e-116
DICTYBASE|DDB_G0277855610 fimA "fimbrin-1" [Dictyosteliu 0.870 0.965 0.393 2.9e-112
UNIPROTKB|G4MKI5650 MGG_04478 "Fimbrin" [Magnaport 0.750 0.781 0.424 5.9e-112
TAIR|locus:2177291 FIM5 "FIMBRIN5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2660 (941.4 bits), Expect = 9.8e-277, P = 9.8e-277
 Identities = 509/672 (75%), Positives = 576/672 (85%)

Query:     1 MAGFVGVLVSDPWLQSQFTQVELRTLKSKFISTRSQSGRVTVGDLPPLFAKLKAFSEMFK 60
             M+ +VGVLVSDPWLQSQFTQVELRTLKSKF+S ++Q GR TVGDLPP+F KLKAF+    
Sbjct:     1 MSSYVGVLVSDPWLQSQFTQVELRTLKSKFVSNKTQLGRFTVGDLPPVFEKLKAFNGTID 60

Query:    61 EDEIKAIMGESHTNMEDEVDFESYLRAYLNLQXXXXXXXXXXXXXXXFLKAATTTVHHAI 120
             EDEIK+++ +S+ N +DEVDFE +LRA+L++Q               FLK +TTTVHHAI
Sbjct:    61 EDEIKSVLDKSYPNADDEVDFEFFLRAFLSVQARGVEKSGGSKGASSFLKTSTTTVHHAI 120

Query:   121 NESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDER 180
             NESEKASYV+H+N++L +DPFL  YLPIDP+TNA FDL KDGVLLCKLINVAVPGTIDER
Sbjct:   121 NESEKASYVSHVNNYLRDDPFLKSYLPIDPATNAFFDLVKDGVLLCKLINVAVPGTIDER 180

Query:   181 AINTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLL 240
             AINTK+ LNPWERNEN TL LNSAKAIGCTVVNIGTQD+ EGRP+L+LGLISQIIKIQ+L
Sbjct:   181 AINTKKTLNPWERNENLTLGLNSAKAIGCTVVNIGTQDIAEGRPYLVLGLISQIIKIQML 240

Query:   241 ADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDG 300
             ADLN KKTP L +LVDD  D EEL+GL PEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDG
Sbjct:   241 ADLNFKKTPSLFQLVDDTQDAEELMGLAPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDG 300

Query:   301 EAYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLA 360
             EAYA+LLNALAPEH +    +TKDPTERA KV+EQAEK+DCKRYL+PKDIV+GS NLNLA
Sbjct:   301 EAYAYLLNALAPEHSTHVALETKDPTERAKKVLEQAEKLDCKRYLSPKDIVDGSANLNLA 360

Query:   361 FVAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRN 420
             FVA IFQHRNGL++D +K SFAEMMTDD +TSREERCFRLWINSLGTATYVNNVFED+RN
Sbjct:   361 FVAQIFQHRNGLTVDDSKTSFAEMMTDDVETSREERCFRLWINSLGTATYVNNVFEDLRN 420

Query:   421 GWVLLEVLDKVSPGSVSWKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQ 480
             GWVLLEVLDKVSPGSV+WK A KPPIKMPF+KVENCN+V+KIGKEL FSLVNVAGNDIVQ
Sbjct:   421 GWVLLEVLDKVSPGSVNWKHANKPPIKMPFKKVENCNEVIKIGKELRFSLVNVAGNDIVQ 480

Query:   481 GNKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNWANRKVKKANRTSQIESFK 540
             GNKKL+LAFLWQLMR+TMLQLL+NLR+HSQGKEITD DILNWANRKVK+  RTSQ +SF+
Sbjct:   481 GNKKLLLAFLWQLMRYTMLQLLRNLRSHSQGKEITDADILNWANRKVKRGGRTSQADSFR 540

Query:   541 DKNLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPED 600
             DKNLS+G+FFLELLSAVEPRVVNWSLVT GETEEDKKLNATYIISVARKLGCSIFLLPED
Sbjct:   541 DKNLSSGMFFLELLSAVEPRVVNWSLVTNGETEEDKKLNATYIISVARKLGCSIFLLPED 600

Query:   601 IMEVNQKMILILTASIMYWSLXXXXXXXXXXXXXXXXXXXXXXXXXRTLSGDISNLAINE 660
             I+EVNQKM+LIL ASIMYWSL                          +++G+ISNL+I +
Sbjct:   601 IIEVNQKMMLILAASIMYWSLQQQSDTESTVSEDATDDGDA-----NSVAGEISNLSI-D 654

Query:   661 TASDPNPSVSSQ 672
              AS+ +P+V  Q
Sbjct:   655 GASESSPTVQDQ 666
GO:0003779 "actin binding" evidence=IEA
GO:0009846 "pollen germination" evidence=IMP
GO:0009860 "pollen tube growth" evidence=IMP
GO:0030036 "actin cytoskeleton organization" evidence=IMP
GO:0051015 "actin filament binding" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0030048 "actin filament-based movement" evidence=RCA
GO:0051645 "Golgi localization" evidence=RCA
GO:0051646 "mitochondrion localization" evidence=RCA
GO:0060151 "peroxisome localization" evidence=RCA
TAIR|locus:2049158 AT2G04750 "AT2G04750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116382 FIM1 "fimbrin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173867 AT5G55400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166096 AT5G48460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPBC1778.06c fim1 "fimbrin" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000002536 SAC6 "Fimbrin, actin-bundling protein" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ASPGD|ASPL0000003499 fimA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0277855 fimA "fimbrin-1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|G4MKI5 MGG_04478 "Fimbrin" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q63598PLST_RATNo assigned EC number0.37670.87440.9396yesno
P13797PLST_HUMANNo assigned EC number0.37670.87440.9396yesno
P32599FIMB_YEASTNo assigned EC number0.41690.83010.8753yesno
Q9FJ70FIMB3_ARATHNo assigned EC number0.70070.97190.9215nono
Q7G188FIMB1_ARATHNo assigned EC number0.70680.99550.9810nono
A6H742PLSI_BOVINNo assigned EC number0.38230.86550.9301yesno
A7E3Q8PLST_BOVINNo assigned EC number0.37510.87440.9396yesno
O88818PLST_CRIGRNo assigned EC number0.37670.87440.9396yesno
Q3V0K9PLSI_MOUSENo assigned EC number0.39020.86550.9301yesno
O59945FIMB_SCHPONo assigned EC number0.41140.82860.9136yesno
P54680FIMB_DICDINo assigned EC number0.39640.87140.9672yesno
Q9FKI0FIMB2_ARATHNo assigned EC number0.78420.98370.9694yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
COG5069612 COG5069, SAC6, Ca2+-binding actin-bundling protein 3e-75
pfam00307104 pfam00307, CH, Calponin homology (CH) domain 9e-21
smart00033101 smart00033, CH, Calponin homology domain 2e-20
cd00014107 cd00014, CH, Calponin homology domain; actin-bindi 7e-19
cd00014107 cd00014, CH, Calponin homology domain; actin-bindi 3e-18
pfam00307104 pfam00307, CH, Calponin homology (CH) domain 4e-18
smart00033101 smart00033, CH, Calponin homology domain 2e-16
smart00033101 smart00033, CH, Calponin homology domain 2e-15
smart00033101 smart00033, CH, Calponin homology domain 2e-15
cd00014107 cd00014, CH, Calponin homology domain; actin-bindi 2e-15
pfam00307104 pfam00307, CH, Calponin homology (CH) domain 5e-15
pfam00307104 pfam00307, CH, Calponin homology (CH) domain 7e-13
cd00014107 cd00014, CH, Calponin homology domain; actin-bindi 1e-10
COG5069612 COG5069, SAC6, Ca2+-binding actin-bundling protein 2e-05
COG5069 612 COG5069, SAC6, Ca2+-binding actin-bundling protein 2e-04
>gnl|CDD|227401 COG5069, SAC6, Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information 
 Score =  252 bits (646), Expect = 3e-75
 Identities = 165/524 (31%), Positives = 250/524 (47%), Gaps = 37/524 (7%)

Query: 110 KAATTTVHHAINESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLI 169
              +      INE  +     HIN  L  D     Y P +  T   F   +DG+    LI
Sbjct: 108 SLISRLTIATINEEGE--LTKHINLLLWCDEDTGGYKP-EVDTFDFFRSWRDGLAFSALI 164

Query: 170 NVAVPGTIDERAINTKR---VLNPWERNENHTLCLNSAKAIG-CTVVNIGTQDLVEGRPH 225
           + + P T+D   ++ ++    LN ++  EN    +  A+ IG   +VN+   D    R  
Sbjct: 165 HDSRPDTLDPNVLDLQKKNKALNNFQAFENANKVIGIARLIGVEDIVNVSIPD---ERSI 221

Query: 226 LLLGLISQIIKIQLLA--DLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKK 283
           +   +   II+  LL   D+ L +  +L+E  +        L LP E +LL+ +N    K
Sbjct: 222 MTY-VSWYIIRFGLLEKIDIALHRVYRLLEADETLIQ----LRLPYEIILLRLLNLIHLK 276

Query: 284 AGYEKQVTNFSSDLKDGEAYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKR 343
               K V NFS D+ DGE Y  LLN L    CS A  +T D    A ++++ AEK DC++
Sbjct: 277 QANWK-VVNFSKDVSDGENYTDLLNQLN-ALCSRAPLETTDLHSLAGQILQNAEKYDCRK 334

Query: 344 YLTPKDIVEGSPNLNLAFVAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWIN 403
           YL P     G+P L+LAFVAH+F    G      +    E+   DA+   E R F  W+N
Sbjct: 335 YLPPA----GNPKLDLAFVAHLFNTHPGQEP-LEEEEKPEIEEFDAEGEFEARVFTFWLN 389

Query: 404 SLGTATYVNNVFEDVRNGWVLLEVLDKV-SPGSVSWKQATKPPIK----MPFRKVENCNQ 458
           SL  +  + N+F D+R+  +LL+ L K   P +V+ K   K P        F+  EN N 
Sbjct: 390 SLDVSPEITNLFGDLRDQLILLQALSKKLMPMTVTHKLVKKQPASGIEENRFKAFENENY 449

Query: 459 VVKIGKELNFSLVNVAGNDIVQGNKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTD 518
            V +G    FSLV + G +I+ G  +L L  +WQ++R         L+    G  ++D+D
Sbjct: 450 AVDLGITEGFSLVGIKGLEILDGI-RLKLTLVWQVLRSNTALFNHVLK--KDGCGLSDSD 506

Query: 519 ILNWANRKVKKANRTSQIESFKDKNLSN-GIFFLELLSAVEPRVVNWSLVTKGETEEDKK 577
           +  W      K ++   I SF D   S  G+F+L++L  +   +V++ LVT+G TE D  
Sbjct: 507 LCAWLGSLGLKGDKEEGIRSFGDPAGSVSGVFYLDVLKGIHSELVDYDLVTRGFTEFDDI 566

Query: 578 LNA-TYIIS--VARKLGCSIFLLPEDIMEVNQKM-ILILTASIM 617
            +A +  IS  + R LG  I  LPEDI  V  ++ +L    S+M
Sbjct: 567 ADARSLAISSKILRSLGAIIKFLPEDINGVRPRLDVLTFIESLM 610

Length = 612
>gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain Back     alignment and domain information
>gnl|CDD|214479 smart00033, CH, Calponin homology domain Back     alignment and domain information
>gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain Back     alignment and domain information
>gnl|CDD|214479 smart00033, CH, Calponin homology domain Back     alignment and domain information
>gnl|CDD|214479 smart00033, CH, Calponin homology domain Back     alignment and domain information
>gnl|CDD|214479 smart00033, CH, Calponin homology domain Back     alignment and domain information
>gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain Back     alignment and domain information
>gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain Back     alignment and domain information
>gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>gnl|CDD|227401 COG5069, SAC6, Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|227401 COG5069, SAC6, Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 677
KOG0046627 consensus Ca2+-binding actin-bundling protein (fim 100.0
COG5069612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 100.0
KOG0517 2473 consensus Beta-spectrin [Cytoskeleton] 100.0
KOG0517 2473 consensus Beta-spectrin [Cytoskeleton] 100.0
COG5069612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 100.0
KOG0035 890 consensus Ca2+-binding actin-bundling protein (act 99.97
KOG0035 890 consensus Ca2+-binding actin-bundling protein (act 99.97
KOG0046627 consensus Ca2+-binding actin-bundling protein (fim 99.96
smart00033103 CH Calponin homology domain. Actin binding domains 99.65
KOG3631365 consensus Alpha-parvin and related focal adhesion 99.64
cd00014107 CH Calponin homology domain; actin-binding domain 99.62
PF00307108 CH: Calponin homology (CH) domain; InterPro: IPR00 99.62
smart00033103 CH Calponin homology domain. Actin binding domains 99.61
cd00014107 CH Calponin homology domain; actin-binding domain 99.58
PF00307108 CH: Calponin homology (CH) domain; InterPro: IPR00 99.57
KOG3631365 consensus Alpha-parvin and related focal adhesion 99.54
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.26
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.18
KOG2046193 consensus Calponin [Cytoskeleton] 99.13
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 99.12
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.0
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 99.0
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.97
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.94
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.94
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.93
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 98.89
PF1197185 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T 98.89
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.88
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.86
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.79
PTZ00183158 centrin; Provisional 98.76
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 98.72
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.69
PTZ00184149 calmodulin; Provisional 98.66
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.63
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.63
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.58
cd0005267 EH Eps15 homology domain; found in proteins implic 98.58
KOG2046193 consensus Calponin [Cytoskeleton] 98.57
PF1465866 EF-hand_9: EF-hand domain 98.55
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.55
COG5199178 SCP1 Calponin [Cytoskeleton] 98.46
PF1197185 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T 98.46
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 98.4
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.29
PLN02964644 phosphatidylserine decarboxylase 98.23
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 98.22
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.2
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 98.11
PTZ00183158 centrin; Provisional 98.06
PTZ00184149 calmodulin; Provisional 98.03
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 97.98
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 97.96
KOG0518 1113 consensus Actin-binding cytoskeleton protein, fila 97.9
COG5199178 SCP1 Calponin [Cytoskeleton] 97.9
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.83
KOG0518 1113 consensus Actin-binding cytoskeleton protein, fila 97.74
KOG0036463 consensus Predicted mitochondrial carrier protein 97.64
KOG2996 865 consensus Rho guanine nucleotide exchange factor V 97.62
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.6
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.59
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.49
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.47
PLN02964644 phosphatidylserine decarboxylase 97.47
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 97.45
PF06294158 DUF1042: Domain of Unknown Function (DUF1042); Int 97.35
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.35
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 97.3
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 97.23
KOG0038189 consensus Ca2+-binding kinase interacting protein 97.17
PF06294158 DUF1042: Domain of Unknown Function (DUF1042); Int 97.13
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 97.04
KOG0377631 consensus Protein serine/threonine phosphatase RDG 96.85
KOG0036463 consensus Predicted mitochondrial carrier protein 96.8
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 96.79
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 96.73
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 96.4
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.23
KOG2996 865 consensus Rho guanine nucleotide exchange factor V 96.11
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 95.87
KOG0516 1047 consensus Dystonin, GAS (Growth-arrest-specific pr 95.83
PRK12309391 transaldolase/EF-hand domain-containing protein; P 95.77
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 95.55
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 95.51
KOG0516 1047 consensus Dystonin, GAS (Growth-arrest-specific pr 95.19
KOG4065144 consensus Uncharacterized conserved protein [Funct 94.55
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 94.04
KOG2128 1401 consensus Ras GTPase-activating protein family - I 94.01
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 93.42
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 92.85
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 92.4
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 92.21
KOG4251362 consensus Calcium binding protein [General functio 91.68
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 89.83
KOG1955737 consensus Ral-GTPase effector RALBP1 [Intracellula 89.32
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 89.25
COG5261 1054 IQG1 Protein involved in regulation of cellular mo 88.6
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 88.44
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 87.62
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 86.78
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 85.49
KOG3000295 consensus Microtubule-binding protein involved in 85.42
KOG3000 295 consensus Microtubule-binding protein involved in 84.39
KOG2243 5019 consensus Ca2+ release channel (ryanodine receptor 83.99
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 83.43
KOG4666412 consensus Predicted phosphate acyltransferase, con 83.19
PF0872669 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr 82.39
KOG3866442 consensus DNA-binding protein of the nucleobindin 82.04
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-134  Score=1054.65  Aligned_cols=617  Identities=64%  Similarity=1.019  Sum_probs=596.1

Q ss_pred             cccccchhhhccCCHHHHHHHHHHhhhhcCCCCceehhhHHHHHHhhhhcCCCCcHHHHHHHHHhhcCCCCCcccHHHHH
Q 005777            6 GVLVSDPWLQSQFTQVELRTLKSKFISTRSQSGRVTVGDLPPLFAKLKAFSEMFKEDEIKAIMGESHTNMEDEVDFESYL   85 (677)
Q Consensus         6 ~~~~~~~~~~~~~t~~e~~~l~~~F~~~D~~~G~I~~~eL~~~l~~~~~lg~~~t~~ei~~~l~~~d~d~~g~I~f~eF~   85 (677)
                      ||+|+|||++++||++|+++|+++|..+|.++|+|+..||..+|.+.+........+|+++++.+.+.|.+|+|+||+|+
T Consensus         1 ~~~v~~~~~~~~~tq~El~~l~~kF~~~d~~~G~v~~~~l~~~f~k~~~~~g~~~~eei~~~l~~~~~~~~g~v~fe~f~   80 (627)
T KOG0046|consen    1 GVLVSDPWLQSQLTQEELRELKEKFNKLDDQKGYVTVYELPDAFKKAKLPLGYFVREEIKEILGEVGVDADGRVEFEEFV   80 (627)
T ss_pred             CccccchhhcccccHHHHHHHHHHHHhhcCCCCeeehHHhHHHHHHhcccccchhHHHHHHHHhccCCCcCCccCHHHHH
Confidence            68999999999999999999999999999999999999999999984444445679999999999999999999999999


Q ss_pred             HHHHHHHhhhhhhcC-CCCCCcchhhhhhccccccCCHHHHHHHHHHHHhhhCCCCCcccccCCCCchhHHHHHhhcHHH
Q 005777           86 RAYLNLQARAAAKSG-GSKNSSSFLKAATTTVHHAINESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVL  164 (677)
Q Consensus        86 ~~~~~l~~~~~~~~~-~~~~~~~~~~~~t~~~~~~~~~~q~~~~~~wIN~~L~~~~~~~~~~p~~~~~~dl~~dl~DGv~  164 (677)
                      +++.++++.+.++.+ +.+++++|++.++++++|+|+++|+.+|+.|||++|+.+|+|+|++|++|..++||+.++||++
T Consensus        81 ~~~~~l~s~~~~k~~~g~~~~~~~~~~sst~~~Hti~eeEk~~fv~hIN~~L~~Dpdl~~~lPinp~t~~lf~~vkDGvl  160 (627)
T KOG0046|consen   81 GIFLNLKSKDIAKIGEGIKAASGTLKGSSTGTQHTINEEEKRAFVNHINSYLEGDPDLKHLLPINPNTNDLFDLVKDGVL  160 (627)
T ss_pred             HHHHhhhhhhhhhhcCCcccccceeecccccceeeecHHHHHHHHHHHHHHhcCCcchhhcCCCCCchHHHHHHhcccee
Confidence            999999999887765 6889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCCcccccccccCCCChHHHHHHHHHHHHHHHHcCceeeccCCcccccCchHHHHHHHHHHHHHHHhhccc
Q 005777          165 LCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLADLN  244 (677)
Q Consensus       165 L~~Lie~l~~~~i~~~~i~~~~~~~~~~~~eNv~~~L~~~k~~G~~~~~i~~~di~~g~~~~iL~Liw~li~~~~~~~i~  244 (677)
                      ||+|||...|+|||+|.||+++.+++|++.||+++||+.+++.||.+|||+++||.+|++++|||||||||+++++.+|+
T Consensus       161 LcKlIN~svPdTIDERaiN~kk~Lnp~~~~EN~~l~lnSAkAiGc~VvNIga~Dl~eGrphLVLGLiwQiIkiglladi~  240 (627)
T KOG0046|consen  161 LCKLINLSVPDTIDERAINTKKKLNPFERNENLNLALNSAKAIGCTVVNIGAQDLAEGRPHLVLGLIWQIIKIGLLADIN  240 (627)
T ss_pred             eehhhcccCCCchhhhhhccCCcCChhhhccchhhHHhhcccccceEEecCchhhhcCCceeeHHHHHHHHHHHHhhhcc
Confidence            99999999999999999998878999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCcccccccCCCchhhhhhCCCcHHHHHHHHHHHhhhcCCcccccCCCCCccchHHHHHHHHhhCCCCCCCCCCCCCC
Q 005777          245 LKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDGEAYAHLLNALAPEHCSPATFDTKD  324 (677)
Q Consensus       245 ~~~~p~l~~l~~~~e~~~~~~~~s~~~~LL~Wvn~~l~~~~~~~~V~nFs~d~~DG~al~~Ll~~~~P~~~~~~~l~~~~  324 (677)
                      ++.+|++++|+.++|++++++++|||++||||+|+||+++||.++++||++|++||.+|.+|++.++|+.++...+..++
T Consensus       241 l~~~p~L~~Ll~d~e~lEelm~L~PEkiLLrW~N~HL~kag~~k~~~nFs~DikD~eaY~~LLnqlap~~~~~~~l~~~d  320 (627)
T KOG0046|consen  241 LKKNPQLVRLLEDGETLEELMRLPPEKILLRWMNYHLKKAGWKKTVTNFSSDIKDSEAYTHLLNQLAPEHCSPAPLQETD  320 (627)
T ss_pred             cccCHHHHHHHhCCccHHHHhcCCHHHHHHHHHHHHHHhcccceehhhhhhhhccHHHHHHHHHHhccccCCccccccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhCCCccccCccccccCCCcchHHHHHHHHHhhcCCCCCccchhhhhhcchhHHhHHhHHHHHHHHHh
Q 005777          325 PTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLAFVAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINS  404 (677)
Q Consensus       325 ~~~~~~~a~~~ae~lgi~~~l~peDi~~~~~~~~l~~va~l~~~~~gl~~~~~~~~~~~~~~~~~~~~~q~~~f~~WiN~  404 (677)
                      ..+|++.+++.|+++||.++++|.|++.|+|+++++|||++|+++||++.+.+.. .++++..++.+++++|+|+.|+|+
T Consensus       321 ~l~RA~~vLq~Aekl~Cr~~ltp~dvV~G~~kLNLAFVA~lFn~~pgL~~~~~~~-~~e~~~~~~~~~reer~fr~WmNS  399 (627)
T KOG0046|consen  321 DLERAELVLQQAEKLDCRRYLTPTDVVAGNPKLNLAFVANLFNTHPGLEKPENEE-IAEMMTEDEEESREERTFRLWMNS  399 (627)
T ss_pred             hHhHHHHHHHHHHhcCCccccCHHHHhcCCchhhHHHHHHhcccCCCCCCccccc-hhcccchhHhHHHHHHHHHHHHHh
Confidence            9999999999999999999999999999999999999999999999999887543 488999999999999999999999


Q ss_pred             hCCCCcchhHHHHhhhHHHHHHHHHHhCCCccccccccCC--CCCchhHHHHHHHHHHHHHHhhccccccccccccccCh
Q 005777          405 LGTATYVNNVFEDVRNGWVLLEVLDKVSPGSVSWKQATKP--PIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQGN  482 (677)
Q Consensus       405 ~~~~~~v~dl~~dl~DG~~L~~lle~l~~~~v~~k~~~~~--~~~~~~~~ieN~~~~l~~~k~~g~~~~~i~~~div~g~  482 (677)
                      ++..++|+++|+|++||++|.+++++++|+.|+|++++||  |.+++++++||||++++.++++++++|||.+.||+|||
T Consensus       400 lgv~p~vn~~f~Dl~dglVllq~~dki~pg~Vnwk~vnKp~~~~~~~~kklENcNyav~lGk~~~FSLVgi~G~DI~dGN  479 (627)
T KOG0046|consen  400 LGVNPYVNNLFEDLRDGLVLLQLYDKVSPGSVNWKHVNKPPSPLKMPFKKVENCNYAVKLGKQLKFSLVGIAGQDIVDGN  479 (627)
T ss_pred             cCCcHHHHHHHHhhhhhhHHHHHHHHccCCccchhhccCCCCcccccHHHhhcchHHHHHHhhcceeeeccccccccccc
Confidence            9999999999999999999999999999999999999998  66778999999999999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHHHhhhcccCCCCCCCCHHHHHHHHHHHhhhcCCccccccCCCCCCCcHHHHHHHHhhhCCCce
Q 005777          483 KKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNWANRKVKKANRTSQIESFKDKNLSNGIFFLELLSAVEPRVV  562 (677)
Q Consensus       483 ~kliL~LlW~lir~~~~~~~~~l~~~~~~~~~~~~~LL~W~~~~~~~~~~~~~i~~f~d~s~~dG~al~aLi~~~~P~~i  562 (677)
                      +++||||+|||||+++++++.+++.+  |+.+++++++.|+|++++..|+...|.+|.|++.+||++++.||+++.|+.|
T Consensus       480 k~LtLAlvWQLMR~ytL~vL~~l~~~--~~~~tD~dIv~WaN~klk~~Gk~s~IrSFkD~siS~g~~vLDLidaI~P~~V  557 (627)
T KOG0046|consen  480 KTLTLALVWQLMRRYTLQVLKSLRSG--GKDITDSDIVNWANRKLKKAGKKSQIRSFKDKSISDGLFVLDLLDAIKPGVV  557 (627)
T ss_pred             hHhHHHHHHHHHHHHHHHHHHHHhhc--CCCCcHHHHHHHHHHHHHhcCCccccccccCcccccCcchHHHHhhcCcCcc
Confidence            99999999999999999999988765  5579999999999999999999999999999999999999999999999999


Q ss_pred             eccccCCCCChHhHHhhHHHHHHHHHHcCCCCcCCccccccCCccHHHHHHHHHHHHhhcCCC
Q 005777          563 NWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPEDIMEVNQKMILILTASIMYWSLQQQS  625 (677)
Q Consensus       563 ~~~~~~~~~~~~~~~~n~~~a~~~A~~lGi~~~l~~eDi~~~d~k~i~tyls~l~~~~~~~~~  625 (677)
                      ||+.++.++|++++..|++||+++|||+||..++.||||+++.+|||||+++++|++..++..
T Consensus       558 n~~LV~~G~t~EdK~~NAkYaIS~ARKiGa~IyaLPEDIvEV~pKMvltvfA~lM~~~~~~~~  620 (627)
T KOG0046|consen  558 NYSLVTSGNTDEEKLLNAKYAISVARKLGASIYALPEDIVEVNPKMVLTVFASLMAWSLQRQS  620 (627)
T ss_pred             chhhccCCCChhhhhhcchhhHhHHHhhCceEEeccHHHhhhchhhhHHHHHHHHHhcccccc
Confidence            999999999999999999999999999999999999999999999999999999999988765

>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0517 consensus Beta-spectrin [Cytoskeleton] Back     alignment and domain information
>KOG0517 consensus Beta-spectrin [Cytoskeleton] Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>smart00033 CH Calponin homology domain Back     alignment and domain information
>KOG3631 consensus Alpha-parvin and related focal adhesion proteins [Cytoskeleton] Back     alignment and domain information
>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] Back     alignment and domain information
>smart00033 CH Calponin homology domain Back     alignment and domain information
>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] Back     alignment and domain information
>KOG3631 consensus Alpha-parvin and related focal adhesion proteins [Cytoskeleton] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2046 consensus Calponin [Cytoskeleton] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG2046 consensus Calponin [Cytoskeleton] Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>COG5199 SCP1 Calponin [Cytoskeleton] Back     alignment and domain information
>PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0518 consensus Actin-binding cytoskeleton protein, filamin [Cytoskeleton] Back     alignment and domain information
>COG5199 SCP1 Calponin [Cytoskeleton] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG0518 consensus Actin-binding cytoskeleton protein, filamin [Cytoskeleton] Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2996 consensus Rho guanine nucleotide exchange factor VAV3 [Signal transduction mechanisms] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PF06294 DUF1042: Domain of Unknown Function (DUF1042); InterPro: IPR010441 This is a family of proteins of unknown function Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>PF06294 DUF1042: Domain of Unknown Function (DUF1042); InterPro: IPR010441 This is a family of proteins of unknown function Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG2996 consensus Rho guanine nucleotide exchange factor VAV3 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0516 consensus Dystonin, GAS (Growth-arrest-specific protein), and related proteins [Cytoskeleton] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0516 consensus Dystonin, GAS (Growth-arrest-specific protein), and related proteins [Cytoskeleton] Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>COG5261 IQG1 Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3000 consensus Microtubule-binding protein involved in cell cycle control [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG3000 consensus Microtubule-binding protein involved in cell cycle control [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes Back     alignment and domain information
>KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
1pxy_A506 Crystal Structure Of The Actin-Crosslinking Core Of 0.0
1rt8_A513 Crystal Structure Of The Actin-Crosslinking Core Of 1e-125
3byh_B231 Model Of Actin-Fimbrin Abd2 Complex Length = 231 1e-108
1aoa_A275 N-Terminal Actin-Crosslinking Domain From Human Fim 2e-65
1aoa_A275 N-Terminal Actin-Crosslinking Domain From Human Fim 3e-09
1wjo_A124 Solution Structure Of The Forth Ch Domain From Huma 1e-20
2d85_A124 Solution Structure Of The Fourth Ch Domain From Hum 8e-19
3f7p_A296 Crystal Structure Of A Complex Between Integrin Bet 2e-09
1qag_A226 Actin Binding Region Of The Dystrophin Homologue Ut 7e-09
1dxx_A246 N-Terminal Actin-Binding Domain Of Human Dystrophin 1e-08
1sh5_A245 Crystal Structure Of Actin-Binding Domain Of Mouse 2e-08
1mb8_A243 Crystal Structure Of The Actin Binding Domain Of Pl 2e-08
1tjt_A250 X-Ray Structure Of The Human Alpha-Actinin Isoform 3e-08
1wku_A254 High Resolution Structure Of The Human Alpha-Actini 3e-08
1sjj_A 863 Cryo-Em Structure Of Chicken Gizzard Smooth Muscle 2e-07
2eyi_A234 Crystal Structure Of The Actin-Binding Domain Of Hu 5e-07
2r0o_A237 Crystal Structure Of The Actin-Binding Domain Of Hu 3e-06
3lue_K109 Model Of Alpha-Actinin Ch1 Bound To F-Actin Length 8e-06
2wa7_A245 Structure Of The M202v Mutant Of Human Filamin B Ac 2e-04
2wa5_A245 Crystal Structure Of Human Filamin B Actin Binding 3e-04
4b7l_A347 Crystal Structure Of Human Filamin B Actin Binding 3e-04
3hoc_A272 Structure Of The Actin-Binding Domain Of Human Fila 5e-04
3hop_A272 Structure Of The Actin-Binding Domain Of Human Fila 5e-04
3fer_A262 Crystal Structure Of N-Terminal Actin-Binding Domai 6e-04
2wfn_A278 Filamin A Actin Binding Domain Length = 278 6e-04
>pdb|1PXY|A Chain A, Crystal Structure Of The Actin-Crosslinking Core Of Arabidopsis Fimbrin Length = 506 Back     alignment and structure 
Iteration: 1

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/500 (78%), Positives = 447/500 (89%), Gaps = 1/500 (0%)
Query: 122 ESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDERA 181
           +SEK  +V HIN +LG+DPFL ++LP+DP +N L++L KDGVLLCKLINVAVPGTIDERA
Sbjct: 6   QSEKGPFVQHINRYLGDDPFLKQFLPLDPHSNQLYELVKDGVLLCKLINVAVPGTIDERA 65
Query: 182 INTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLA 241
           INTKRVLNPWERNENHTLCLNSAKA+GC+VVNIGTQDL EGRPHL+LGLISQ+IKIQLLA
Sbjct: 66  INTKRVLNPWERNENHTLCLNSAKAVGCSVVNIGTQDLAEGRPHLVLGLISQLIKIQLLA 125
Query: 242 DLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDGE 301
           DLNLKKTPQLVEL++D++DVEELL LPPEKVLLKWMNFHLKK GY+K V+NFS+DLKD +
Sbjct: 126 DLNLKKTPQLVELLEDSDDVEELLRLPPEKVLLKWMNFHLKKGGYKKTVSNFSADLKDAQ 185
Query: 302 AYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLAF 361
           AYA LLN LAPEHC PAT D KDP ERA  V+  AE+M+CKRYLT ++IVEGS  LNLAF
Sbjct: 186 AYAFLLNVLAPEHCDPATLDAKDPLERAELVLSHAERMNCKRYLTAEEIVEGSSTLNLAF 245
Query: 362 VAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRNG 421
           VA IF  RNGL+ D  K +FAEMMT+D +T R+ERC+RLWINSLG  +YVNNVFEDVRNG
Sbjct: 246 VAQIFHERNGLNKDG-KYAFAEMMTEDVETCRDERCYRLWINSLGIDSYVNNVFEDVRNG 304
Query: 422 WVLLEVLDKVSPGSVSWKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQG 481
           W+LLEVLDKVSP SV+WK A+KPPIKMPFRKVENCNQV+KIGK+L FSLVNVAGNDIVQG
Sbjct: 305 WILLEVLDKVSPSSVNWKHASKPPIKMPFRKVENCNQVIKIGKQLKFSLVNVAGNDIVQG 364
Query: 482 NKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNWANRKVKKANRTSQIESFKD 541
           NKKLIL  LWQLMRF MLQLLK+LR+ + GKE+TD DIL+WANRKV+   R  QIESFKD
Sbjct: 365 NKKLILGLLWQLMRFHMLQLLKSLRSRTLGKEMTDADILSWANRKVRTMGRKLQIESFKD 424
Query: 542 KNLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPEDI 601
           K+LS+G+FFL LL AVEPRVVNW+LVTKGET+++K+LNATYI+SVARKLGCS+FLLPEDI
Sbjct: 425 KSLSSGLFFLNLLWAVEPRVVNWNLVTKGETDDEKRLNATYIVSVARKLGCSVFLLPEDI 484
Query: 602 MEVNQKMILILTASIMYWSL 621
           +EVNQKMILILTASIMYWSL
Sbjct: 485 VEVNQKMILILTASIMYWSL 504
>pdb|1RT8|A Chain A, Crystal Structure Of The Actin-Crosslinking Core Of Schizosaccharomyces Pombe Fimbrin Length = 513 Back     alignment and structure
>pdb|3BYH|B Chain B, Model Of Actin-Fimbrin Abd2 Complex Length = 231 Back     alignment and structure
>pdb|1AOA|A Chain A, N-Terminal Actin-Crosslinking Domain From Human Fimbrin Length = 275 Back     alignment and structure
>pdb|1AOA|A Chain A, N-Terminal Actin-Crosslinking Domain From Human Fimbrin Length = 275 Back     alignment and structure
>pdb|1WJO|A Chain A, Solution Structure Of The Forth Ch Domain From Human Plastin 3 T-Isoform Length = 124 Back     alignment and structure
>pdb|2D85|A Chain A, Solution Structure Of The Fourth Ch Domain From Human L- Plastin Length = 124 Back     alignment and structure
>pdb|3F7P|A Chain A, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 296 Back     alignment and structure
>pdb|1QAG|A Chain A, Actin Binding Region Of The Dystrophin Homologue Utrophin Length = 226 Back     alignment and structure
>pdb|1DXX|A Chain A, N-Terminal Actin-Binding Domain Of Human Dystrophin Length = 246 Back     alignment and structure
>pdb|1SH5|A Chain A, Crystal Structure Of Actin-Binding Domain Of Mouse Plectin Length = 245 Back     alignment and structure
>pdb|1MB8|A Chain A, Crystal Structure Of The Actin Binding Domain Of Plectin Length = 243 Back     alignment and structure
>pdb|1TJT|A Chain A, X-Ray Structure Of The Human Alpha-Actinin Isoform 3 At 2.2a Resolution Length = 250 Back     alignment and structure
>pdb|1WKU|A Chain A, High Resolution Structure Of The Human Alpha-Actinin Isoform 3 Length = 254 Back     alignment and structure
>pdb|1SJJ|A Chain A, Cryo-Em Structure Of Chicken Gizzard Smooth Muscle Alpha- Actinin Length = 863 Back     alignment and structure
>pdb|2EYI|A Chain A, Crystal Structure Of The Actin-Binding Domain Of Human Alpha-Actinin 1 At 1.7 Angstrom Resolution Length = 234 Back     alignment and structure
>pdb|2R0O|A Chain A, Crystal Structure Of The Actin-Binding Domain Of Human Alpha-Actinin-4 Mutant(K255e) Length = 237 Back     alignment and structure
>pdb|3LUE|K Chain K, Model Of Alpha-Actinin Ch1 Bound To F-Actin Length = 109 Back     alignment and structure
>pdb|2WA7|A Chain A, Structure Of The M202v Mutant Of Human Filamin B Actin Binding Domain At 1.85 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|2WA5|A Chain A, Crystal Structure Of Human Filamin B Actin Binding Domain At 1.9 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|4B7L|A Chain A, Crystal Structure Of Human Filamin B Actin Binding Domain With 1st Filamin Repeat Length = 347 Back     alignment and structure
>pdb|3HOC|A Chain A, Structure Of The Actin-Binding Domain Of Human Filamin A Mutant E254k Length = 272 Back     alignment and structure
>pdb|3HOP|A Chain A, Structure Of The Actin-Binding Domain Of Human Filamin A Length = 272 Back     alignment and structure
>pdb|3FER|A Chain A, Crystal Structure Of N-Terminal Actin-Binding Domain From Human Filamin B (Tandem Ch-Domains). Northeast Structural Genomics Consortium Target Hr5571a. Length = 262 Back     alignment and structure
>pdb|2WFN|A Chain A, Filamin A Actin Binding Domain Length = 278 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
1pxy_A506 Fimbrin-like protein; calponin homology, F-actin-b 1e-177
1rt8_A513 Fimbrin; filamentous actin binding domain (ABD), c 1e-164
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 3e-31
1rt8_A513 Fimbrin; filamentous actin binding domain (ABD), c 9e-31
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 9e-84
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 1e-34
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 6e-19
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 5e-56
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 6e-23
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 1e-13
3hoc_A272 Filamin-A; calponin homology domain, actin binding 1e-50
3hoc_A272 Filamin-A; calponin homology domain, actin binding 3e-41
3hoc_A272 Filamin-A; calponin homology domain, actin binding 2e-13
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 7e-49
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 1e-15
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 2e-07
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 2e-04
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 5e-48
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 1e-17
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 2e-09
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 9e-30
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 2e-18
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 2e-08
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 2e-29
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 3e-17
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 1e-27
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 4e-16
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 1e-10
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 3e-06
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 1e-19
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 5e-13
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 1e-07
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 3e-17
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 1e-10
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 5e-09
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 3e-05
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 8e-15
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 7e-11
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1wyl_A116 NEDD9 interacting protein with calponin homology a 4e-09
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 1e-07
1ujo_A144 Transgelin; CH domain, actin binding, structural g 2e-07
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 4e-07
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 6e-07
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 1e-06
1bhd_A118 Utrophin; calponin homology, actin binding, struct 1e-06
2d88_A121 Protein mical-3; all alpha, calponin homology doma 1e-06
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 1e-06
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 5e-06
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 6e-06
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 4e-05
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 6e-05
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 7e-05
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 2e-04
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 6e-04
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
 Score =  513 bits (1321), Expect = e-177
 Identities = 391/502 (77%), Positives = 448/502 (89%), Gaps = 1/502 (0%)

Query: 122 ESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDERA 181
           +SEK  +V HIN +LG+DPFL ++LP+DP +N L++L KDGVLLCKLINVAVPGTIDERA
Sbjct: 6   QSEKGPFVQHINRYLGDDPFLKQFLPLDPHSNQLYELVKDGVLLCKLINVAVPGTIDERA 65

Query: 182 INTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLA 241
           INTKRVLNPWERNENHTLCLNSAKA+GC+VVNIGTQDL EGRPHL+LGLISQ+IKIQLLA
Sbjct: 66  INTKRVLNPWERNENHTLCLNSAKAVGCSVVNIGTQDLAEGRPHLVLGLISQLIKIQLLA 125

Query: 242 DLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDGE 301
           DLNLKKTPQLVEL++D++DVEELL LPPEKVLLKWMNFHLKK GY+K V+NFS+DLKD +
Sbjct: 126 DLNLKKTPQLVELLEDSDDVEELLRLPPEKVLLKWMNFHLKKGGYKKTVSNFSADLKDAQ 185

Query: 302 AYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLAF 361
           AYA LLN LAPEHC PAT D KDP ERA  V+  AE+M+CKRYLT ++IVEGS  LNLAF
Sbjct: 186 AYAFLLNVLAPEHCDPATLDAKDPLERAELVLSHAERMNCKRYLTAEEIVEGSSTLNLAF 245

Query: 362 VAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRNG 421
           VA IF  RNGL+ D    +FAEMMT+D +T R+ERC+RLWINSLG  +YVNNVFEDVRNG
Sbjct: 246 VAQIFHERNGLNKDGKY-AFAEMMTEDVETCRDERCYRLWINSLGIDSYVNNVFEDVRNG 304

Query: 422 WVLLEVLDKVSPGSVSWKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQG 481
           W+LLEVLDKVSP SV+WK A+KPPIKMPFRKVENCNQV+KIGK+L FSLVNVAGNDIVQG
Sbjct: 305 WILLEVLDKVSPSSVNWKHASKPPIKMPFRKVENCNQVIKIGKQLKFSLVNVAGNDIVQG 364

Query: 482 NKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNWANRKVKKANRTSQIESFKD 541
           NKKLIL  LWQLMRF MLQLLK+LR+ + GKE+TD DIL+WANRKV+   R  QIESFKD
Sbjct: 365 NKKLILGLLWQLMRFHMLQLLKSLRSRTLGKEMTDADILSWANRKVRTMGRKLQIESFKD 424

Query: 542 KNLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPEDI 601
           K+LS+G+FFL LL AVEPRVVNW+LVTKGET+++K+LNATYI+SVARKLGCS+FLLPEDI
Sbjct: 425 KSLSSGLFFLNLLWAVEPRVVNWNLVTKGETDDEKRLNATYIVSVARKLGCSVFLLPEDI 484

Query: 602 MEVNQKMILILTASIMYWSLQQ 623
           +EVNQKMILILTASIMYWSLQ+
Sbjct: 485 VEVNQKMILILTASIMYWSLQR 506
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Length = 275 Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Length = 275 Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Length = 275 Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Length = 245 Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Length = 245 Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Length = 245 Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A 2wfn_A Length = 272 Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A 2wfn_A Length = 272 Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A 2wfn_A Length = 272 Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Length = 124 Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Length = 124 Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Length = 124 Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Length = 124 Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Length = 246 Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Length = 246 Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Length = 246 Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Length = 245 Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Length = 245 Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Length = 245 Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Length = 296 Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Length = 296 Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Length = 254 Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Length = 254 Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Length = 254 Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Length = 131 Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Length = 131 Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Length = 131 Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Length = 131 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Length = 116 Back     alignment and structure
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Length = 109 Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Length = 144 Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Length = 128 Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Length = 108 Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Length = 118 Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Length = 121 Back     alignment and structure
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Length = 190 Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Length = 193 Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 203 Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 159 Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 136 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query677
1pxy_A506 Fimbrin-like protein; calponin homology, F-actin-b 100.0
1rt8_A513 Fimbrin; filamentous actin binding domain (ABD), c 100.0
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 100.0
4b7l_A347 Filamin-B; structural protein, FR 1 filamin hinge 100.0
3hoc_A272 Filamin-A; calponin homology domain, actin binding 100.0
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 100.0
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 100.0
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 100.0
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 100.0
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 100.0
3hoc_A272 Filamin-A; calponin homology domain, actin binding 100.0
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 100.0
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 100.0
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 100.0
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 100.0
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 100.0
4b7l_A347 Filamin-B; structural protein, FR 1 filamin hinge 100.0
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 100.0
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 100.0
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 100.0
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 100.0
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 100.0
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 99.95
1wyl_A116 NEDD9 interacting protein with calponin homology a 99.95
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 99.95
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 99.95
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 99.95
1bhd_A118 Utrophin; calponin homology, actin binding, struct 99.94
2d88_A121 Protein mical-3; all alpha, calponin homology doma 99.94
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 99.94
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 99.94
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 99.93
1wyl_A116 NEDD9 interacting protein with calponin homology a 99.93
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 99.93
1bhd_A118 Utrophin; calponin homology, actin binding, struct 99.92
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 99.92
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 99.92
2d88_A121 Protein mical-3; all alpha, calponin homology doma 99.92
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 99.92
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 99.91
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 99.9
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 99.86
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 99.59
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 99.55
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 99.49
1ujo_A144 Transgelin; CH domain, actin binding, structural g 99.49
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 99.48
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 99.47
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 99.39
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.37
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 99.35
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 99.34
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 99.32
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 99.27
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.25
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.24
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 99.23
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.22
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.21
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.2
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.2
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 99.18
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.17
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.16
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.15
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.15
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.13
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.12
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.11
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.11
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 99.11
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.1
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 99.1
1c07_A95 Protein (epidermal growth factor receptor pathway 99.09
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.07
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.07
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.06
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.04
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.04
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.04
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.04
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 99.03
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.03
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.03
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.02
3fwb_A161 Cell division control protein 31; gene gating, com 99.02
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.02
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.01
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.01
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.99
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.99
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.98
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.98
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.98
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.98
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.98
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.97
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.97
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.97
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.96
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 98.95
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.95
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.95
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.94
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.94
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.94
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.93
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.93
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.92
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.91
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 98.91
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.91
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.91
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.91
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.9
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.9
1ujo_A144 Transgelin; CH domain, actin binding, structural g 98.9
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.9
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.89
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.89
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.88
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 98.88
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.87
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.87
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.87
3li6_A66 Calcium-binding protein; calcium signaling protein 98.87
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 98.86
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.86
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.86
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.85
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.85
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.85
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.85
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.85
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.83
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.82
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.82
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 98.81
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.81
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.8
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.8
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.8
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.8
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.79
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.79
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.79
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.78
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.78
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.78
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.77
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.77
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.77
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.76
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.75
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.75
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.74
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.74
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.74
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.73
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.73
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.72
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.72
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.72
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.72
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.71
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.7
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.69
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.68
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.68
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.67
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.66
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.65
2qjz_A123 Microtubule-associated protein RP/EB family member 98.64
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.64
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.64
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.64
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.64
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.62
3fwb_A161 Cell division control protein 31; gene gating, com 98.62
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.62
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.6
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.6
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.6
1wyo_A159 Protein EB3, microtubule-associated protein RP/EB 98.59
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.59
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.58
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.57
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.57
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.57
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.57
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.57
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.56
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.56
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.55
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.55
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.55
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.54
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.54
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.53
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.53
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.53
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.53
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.53
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.53
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.52
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.52
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.52
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.52
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.51
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.51
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.5
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.5
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.5
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.49
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.49
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.49
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.49
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.48
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.48
1y1x_A191 Leishmania major homolog of programmed cell death 98.48
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.48
1y1x_A191 Leishmania major homolog of programmed cell death 98.47
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.46
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.46
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.45
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.45
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.44
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.44
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.44
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.44
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.44
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.43
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 98.43
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.42
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.42
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.42
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.42
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.4
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.4
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.4
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.39
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.37
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.37
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.37
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.36
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.35
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.35
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.34
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.33
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.32
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.32
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.32
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.29
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.28
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.28
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.27
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.26
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.25
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.24
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.21
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.2
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.19
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.19
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.19
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.18
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.18
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.17
2qjz_A123 Microtubule-associated protein RP/EB family member 98.17
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.17
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.16
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 98.15
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.15
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.14
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.13
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.12
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.12
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.11
1wyo_A159 Protein EB3, microtubule-associated protein RP/EB 98.11
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.11
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.09
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.09
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.09
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.08
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.07
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.07
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.06
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.06
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.05
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.03
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.03
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.03
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.02
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.02
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 97.99
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 97.99
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 97.96
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 97.96
2ee7_A127 Sperm flagellar protein 1; all alpha protein, CH d 97.92
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 97.92
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 97.9
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 97.9
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 97.9
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 97.82
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 97.76
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 97.72
2ee7_A127 Sperm flagellar protein 1; all alpha protein, CH d 97.7
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.65
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 97.64
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 97.58
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.53
2r8u_A268 Microtubule-associated protein RP/EB family member 97.37
4abo_I145 MAL3, microtubule integrity protein MAL3; structur 97.31
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 97.03
3a4u_B143 Multiple coagulation factor deficiency protein 2; 96.99
2r8u_A268 Microtubule-associated protein RP/EB family member 96.96
2qjx_A127 Protein BIM1; calponin homology domain, protein bi 96.93
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 96.92
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 96.87
4abo_I145 MAL3, microtubule integrity protein MAL3; structur 96.85
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 96.84
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 96.83
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 96.8
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 96.68
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 96.55
2qjx_A127 Protein BIM1; calponin homology domain, protein bi 96.5
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 96.44
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 96.4
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 96.39
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 96.38
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 96.17
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 95.77
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 95.67
1nub_A229 Basement membrane protein BM-40; extracellular mod 95.33
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 95.05
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 95.04
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 94.61
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 93.21
1wix_A164 HOOK homolog 1, RSGI RUH-026; structural genomics, 92.64
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 92.26
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 90.41
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 89.81
2jrf_A184 Tubulin polymerization-promoting protein family me 89.5
1wix_A164 HOOK homolog 1, RSGI RUH-026; structural genomics, 87.88
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 87.87
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 87.44
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 84.3
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 84.14
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 83.5
3li6_A66 Calcium-binding protein; calcium signaling protein 82.82
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 80.75
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 80.47
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
Probab=100.00  E-value=1.1e-108  Score=925.99  Aligned_cols=505  Identities=77%  Similarity=1.254  Sum_probs=448.0

Q ss_pred             ccCCHHHHHHHHHHHHhhhCCCCCcccccCCCCchhHHHHHhhcHHHHHHHHHHHcCCCcccccccccCCCChHHHHHHH
Q 005777          118 HAINESEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDERAINTKRVLNPWERNENH  197 (677)
Q Consensus       118 ~~~~~~q~~~~~~wIN~~L~~~~~~~~~~p~~~~~~dl~~dl~DGv~L~~Lie~l~~~~i~~~~i~~~~~~~~~~~~eNv  197 (677)
                      ..|+++|+++|++|||++|++++++++++|+++.+.||++||+||++||+|+|.++|++++++++++++..++++++||+
T Consensus         2 ~~~~~~q~~~f~~WIN~~L~~~~~~~~~l~~~~~v~~l~~dL~DGv~L~~Lin~l~~~~i~~~~in~~~~~~~~~~~eNi   81 (506)
T 1pxy_A            2 SPGIQSEKGPFVQHINRYLGDDPFLKQFLPLDPHSNQLYELVKDGVLLCKLINVAVPGTIDERAINTKRVLNPWERNENH   81 (506)
T ss_dssp             -----CTHHHHHHHHHHHHTTCTTTTTTCSCCTTSSHHHHHSTTSHHHHHHHHHHSTTSSCGGGSCCCSSCCHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHhccCccccccCCCCCchhHHHHHhcchHHHHHHHHHHcCCCCCccccCccccccHHHHHHHH
Confidence            45889999999999999999999999999999999999999999999999999999999999999987666799999999


Q ss_pred             HHHHHHHHHcCceeeccCCcccccCchHHHHHHHHHHHHHHHhhccccccCcccccccCCCchhhhhhCCCcHHHHHHHH
Q 005777          198 TLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWM  277 (677)
Q Consensus       198 ~~~L~~~k~~G~~~~~i~~~di~~g~~~~iL~Liw~li~~~~~~~i~~~~~p~l~~l~~~~e~~~~~~~~s~~~~LL~Wv  277 (677)
                      +.||++++..||++++|+++||+||+.++||||+||||++|+++.++++.+|++.++.+++++++++...+|+++||+||
T Consensus        82 ~~~L~~~k~~g~~~~~i~~~Dl~dg~~~liLgLiw~li~~~~l~~i~~~~~p~l~~l~~~~e~~~~~~~~~~~~~LL~W~  161 (506)
T 1pxy_A           82 TLCLNSAKAVGCSVVNIGTQDLAEGRPHLVLGLISQLIKIQLLADLNLKKTPQLVELLEDSDDVEELLRLPPEKVLLKWM  161 (506)
T ss_dssp             HHHHHHHHHTTCCCTTCCHHHHHHTCHHHHHHHHHHHHHHHHHSSSSSCC-----------------CCSCHHHHHHHHH
T ss_pred             HHHHHHHHHhCCCcCCCCHHHHhcCChHHHHHHHHHHHHHHHHHhhhhccCHHHHHhhcCCcchhhhhcCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999988888888888888999999999999


Q ss_pred             HHHhhhcCCcccccCCCCCccchHHHHHHHHhhCCCCCCCCCCCCCCHHHHHHHHHHHHHhCCCccccCccccccCCCcc
Q 005777          278 NFHLKKAGYEKQVTNFSSDLKDGEAYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNL  357 (677)
Q Consensus       278 n~~l~~~~~~~~V~nFs~d~~DG~al~~Ll~~~~P~~~~~~~l~~~~~~~~~~~a~~~ae~lgi~~~l~peDi~~~~~~~  357 (677)
                      |+|++++||+++|+||++||+||++||+|+|+++|+.++++.+.+.+..+|++.||+.|+++|||++++|+||++++|++
T Consensus       162 n~~l~~~g~~~~v~nFs~s~~DG~a~~~Ll~~~~P~~i~~~~l~~~~~~~n~~~a~~~a~~lGi~~~l~peDi~~~~~k~  241 (506)
T 1pxy_A          162 NFHLKKGGYKKTVSNFSADLKDAQAYAFLLNVLAPEHCDPATLDAKDPLERAELVLSHAERMNCKRYLTAEEIVEGSSTL  241 (506)
T ss_dssp             HHHHHHTTCCSCCCCSSTTTTTSHHHHHHHHHHCGGGCCGGGGGCCSHHHHHHHHHHHHHHTTCCCCCCHHHHHTTCHHH
T ss_pred             HHHHHhcCCCccCccccccccchHHHHHHHHHhCccccccccCCcCCHHHHHHHHHHHHHHcCCCCcCCHHHHhcCChhH
Confidence            99999889888999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHhhcCCCCCccchhhhhhcchhHHhHHhHHHHHHHHHhhCCCCcchhHHHHhhhHHHHHHHHHHhCCCccc
Q 005777          358 NLAFVAHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRNGWVLLEVLDKVSPGSVS  437 (677)
Q Consensus       358 ~l~~va~l~~~~~gl~~~~~~~~~~~~~~~~~~~~~q~~~f~~WiN~~~~~~~v~dl~~dl~DG~~L~~lle~l~~~~v~  437 (677)
                      +|+||++||++||++.++.+ ..+.+++.+++|+.+|+++|++|||+++.+..|+||++||+||++||+|+|+|+|++++
T Consensus       242 v~tyva~l~~~~~~~~~~~~-~~~~~~~~~~~~~~~q~ktf~~WiN~~~~~~~v~dl~~Dl~DG~~L~~Lle~l~~~~~~  320 (506)
T 1pxy_A          242 NLAFVAQIFHERNGLNKDGK-YAFAEMMTEDVETCRDERCYRLWINSLGIDSYVNNVFEDVRNGWILLEVLDKVSPSSVN  320 (506)
T ss_dssp             HHHHHHHHHHHCCCCC--------------CCHHHHHHHHHHHHHTTTTCSSCCSCHHHHTTTSHHHHHHHHHHSTTCCC
T ss_pred             HHHHHHHHhhhcCCCCCccc-cchhhhhhhhhHHHHHHHHHHHHHHhcCCCCCcccHHHHHHhHHHHHHHHHHHcCCccc
Confidence            99999999999999987653 56778888999999999999999999998889999999999999999999999999999


Q ss_pred             cccccCCCCCchhHHHHHHHHHHHHHHhhccccccccccccccChhhhHHHHHHHHHHHHHHHHhhhcccCCCCCCCCHH
Q 005777          438 WKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQGNKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDT  517 (677)
Q Consensus       438 ~k~~~~~~~~~~~~~ieN~~~~l~~~k~~g~~~~~i~~~div~g~~kliL~LlW~lir~~~~~~~~~l~~~~~~~~~~~~  517 (677)
                      |+.+++||+++|+|++|||++||+|+++.|+++++|+|+||++||+|+||||+|+||||++.+++..++.+..|+.++++
T Consensus       321 ~~~~~~~~~~~r~~~leNv~~aL~~~k~~~v~l~~I~~~dIvdg~~kl~L~Liw~lir~~i~~~~~~l~~~~~~~~~~~~  400 (506)
T 1pxy_A          321 WKHASKPPIKMPFRKVENCNQVIKIGKQLKFSLVNVAGNDIVQGNKKLILGLLWQLMRFHMLQLLKSLRSRTLGKEMTDA  400 (506)
T ss_dssp             GGGCCCSSCCCHHHHHHHHHHHHHHHHHTTCCCCSCCHHHHHTTCHHHHHHHHHHHHHHHHHHHHHTTCC-----CCCHH
T ss_pred             cccccCCccccHHHHHHHHHHHHHHHHHcCCcccCCCHHHHhcCCHHHHHHHHHHHHHHhhHHHHHHhhcccccccccHH
Confidence            99999988789999999999999999999999999999999999999999999999999999887766655567788899


Q ss_pred             HHHHHHHHHhhhcCCccccccCCCCCCCcHHHHHHHHhhhCCCceeccccCCCCChHhHHhhHHHHHHHHHHcCCCCcCC
Q 005777          518 DILNWANRKVKKANRTSQIESFKDKNLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLL  597 (677)
Q Consensus       518 ~LL~W~~~~~~~~~~~~~i~~f~d~s~~dG~al~aLi~~~~P~~i~~~~~~~~~~~~~~~~n~~~a~~~A~~lGi~~~l~  597 (677)
                      .||+|||+++++|+++++|+||+|+||+||+|||||||+|+|+++||+.+.++.+++++.+|+++||++|+++|||++++
T Consensus       401 ~LL~W~~~~~~~~~~~~~i~nF~d~s~~dG~a~~aLi~~~~P~li~~~~l~~~~s~~~~~~N~~~a~~~a~~lGi~~~l~  480 (506)
T 1pxy_A          401 DILSWANRKVRTMGRKLQIESFKDKSLSSGLFFLNLLWAVEPRVVNWNLVTKGETDDEKRLNATYIVSVARKLGCSVFLL  480 (506)
T ss_dssp             HHHHHHHHHHHTTTCCCCCSSTTCGGGGGCHHHHHHHHHHCGGGCCTTSCCCSCSHHHHHHHHHHHHHHHHHHTCCCCCC
T ss_pred             HHHHHHHHHhhhcCCccccCCCCcccccchHHHHHHHHhhCCCeeehhhcccCCCchhHHHHHHHHHHHHHHcCCCCcCC
Confidence            99999999999876679999998779999999999999999999999999987777788999999999999999999999


Q ss_pred             ccccccCCccHHHHHHHHHHHHhhcC
Q 005777          598 PEDIMEVNQKMILILTASIMYWSLQQ  623 (677)
Q Consensus       598 ~eDi~~~d~k~i~tyls~l~~~~~~~  623 (677)
                      ||||+++|+|+||||+++||+++.++
T Consensus       481 peDi~~~d~ksi~tyv~~l~~~~~~~  506 (506)
T 1pxy_A          481 PEDIVEVNQKMILILTASIMYWSLQR  506 (506)
T ss_dssp             HHHHHTTCHHHHHHHHHHHHHHHTTC
T ss_pred             HHHccCCChhHHHHHHHHHHHHHhhC
Confidence            99999999999999999999998763
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Back     alignment and structure
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Back     alignment and structure
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Back     alignment and structure
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2ee7_A Sperm flagellar protein 1; all alpha protein, CH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2ee7_A Sperm flagellar protein 1; all alpha protein, CH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2r8u_A Microtubule-associated protein RP/EB family member 1; cytoskeleton, acetylation, cell cycle, cell division, cytoplasm, mitosis, phosphorylation; 1.35A {Homo sapiens} SCOP: a.40.1.1 PDB: 1vka_A 1txq_B 1wu9_A 2hkq_A 2hl5_A 3tq7_A 3gjo_A 1yib_A 1yig_A Back     alignment and structure
>4abo_I MAL3, microtubule integrity protein MAL3; structural protein, cytoskeleton, GTPase, END binding; HET: GTP GSP; 8.60A {Schizosaccharomyces pombe} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2r8u_A Microtubule-associated protein RP/EB family member 1; cytoskeleton, acetylation, cell cycle, cell division, cytoplasm, mitosis, phosphorylation; 1.35A {Homo sapiens} SCOP: a.40.1.1 PDB: 1vka_A 1txq_B 1wu9_A 2hkq_A 2hl5_A 3tq7_A 3gjo_A 1yib_A 1yig_A Back     alignment and structure
>2qjx_A Protein BIM1; calponin homology domain, protein binding; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>4abo_I MAL3, microtubule integrity protein MAL3; structural protein, cytoskeleton, GTPase, END binding; HET: GTP GSP; 8.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2qjx_A Protein BIM1; calponin homology domain, protein binding; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>1wix_A HOOK homolog 1, RSGI RUH-026; structural genomics, mouse cDNA, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.40.3.1 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wix_A HOOK homolog 1, RSGI RUH-026; structural genomics, mouse cDNA, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.40.3.1 Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 677
d1pxya_500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 0.0
d1pxya_500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 2e-24
d1rt8a_505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 1e-156
d1rt8a_505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 2e-28
d1rt8a_505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 8e-21
d1aoaa1131 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-cros 5e-32
d1aoaa1131 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-cros 4e-23
d1aoaa1131 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-cros 6e-13
d1aoaa1131 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-cros 6e-05
d1wjoa_124 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 6e-31
d1wjoa_124 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 2e-21
d1wjoa_124 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 2e-16
d1wjoa_124 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 1e-11
d1aoaa2116 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-cros 6e-29
d1aoaa2116 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-cros 8e-16
d1aoaa2116 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-cros 4e-13
d1aoaa2116 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-cros 1e-08
d1sh5a1120 a.40.1.1 (A:8-127) Actin binding domain of plectin 7e-23
d1sh5a1120 a.40.1.1 (A:8-127) Actin binding domain of plectin 3e-19
d1sh5a1120 a.40.1.1 (A:8-127) Actin binding domain of plectin 1e-14
d1sh5a1120 a.40.1.1 (A:8-127) Actin binding domain of plectin 1e-04
d1dxxa1111 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens 7e-22
d1dxxa1111 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens 4e-15
d1dxxa1111 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens 6e-15
d1dxxa1111 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens 6e-07
d1bhda_108 a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxI 1e-20
d1bhda_108 a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxI 4e-05
d1dxxa2127 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapie 7e-19
d1sh5a2110 a.40.1.1 (A:128-237) Actin binding domain of plect 1e-18
d1sh5a2110 a.40.1.1 (A:128-237) Actin binding domain of plect 2e-06
d1bkra_108 a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) 7e-17
d1p2xa_159 a.40.1.1 (A:) Ras GTPase-activating-like protein r 4e-16
d1p2xa_159 a.40.1.1 (A:) Ras GTPase-activating-like protein r 2e-14
d1p2xa_159 a.40.1.1 (A:) Ras GTPase-activating-like protein r 6e-05
d1ujoa_144 a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [Ta 7e-14
d1ujoa_144 a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [Ta 0.003
d1h67a_108 a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [T 3e-07
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure

class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Fimbrin (Plastin), actin-crosslinking domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  531 bits (1368), Expect = 0.0
 Identities = 392/501 (78%), Positives = 448/501 (89%), Gaps = 1/501 (0%)

Query: 123 SEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDERAI 182
           SEK  +V HIN +LG+DPFL ++LP+DP +N L++L KDGVLLCKLINVAVPGTIDERAI
Sbjct: 1   SEKGPFVQHINRYLGDDPFLKQFLPLDPHSNQLYELVKDGVLLCKLINVAVPGTIDERAI 60

Query: 183 NTKRVLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLAD 242
           NTKRVLNPWERNENHTLCLNSAKA+GC+VVNIGTQDL EGRPHL+LGLISQ+IKIQLLAD
Sbjct: 61  NTKRVLNPWERNENHTLCLNSAKAVGCSVVNIGTQDLAEGRPHLVLGLISQLIKIQLLAD 120

Query: 243 LNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLKKAGYEKQVTNFSSDLKDGEA 302
           LNLKKTPQLVEL++D++DVEELL LPPEKVLLKWMNFHLKK GY+K V+NFS+DLKD +A
Sbjct: 121 LNLKKTPQLVELLEDSDDVEELLRLPPEKVLLKWMNFHLKKGGYKKTVSNFSADLKDAQA 180

Query: 303 YAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLAFV 362
           YA LLN LAPEHC PAT D KDP ERA  V+  AE+M+CKRYLT ++IVEGS  LNLAFV
Sbjct: 181 YAFLLNVLAPEHCDPATLDAKDPLERAELVLSHAERMNCKRYLTAEEIVEGSSTLNLAFV 240

Query: 363 AHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRNGW 422
           A IF  RNGL+ D  K +FAEMMT+D +T R+ERC+RLWINSLG  +YVNNVFEDVRNGW
Sbjct: 241 AQIFHERNGLNKD-GKYAFAEMMTEDVETCRDERCYRLWINSLGIDSYVNNVFEDVRNGW 299

Query: 423 VLLEVLDKVSPGSVSWKQATKPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQGN 482
           +LLEVLDKVSP SV+WK A+KPPIKMPFRKVENCNQV+KIGK+L FSLVNVAGNDIVQGN
Sbjct: 300 ILLEVLDKVSPSSVNWKHASKPPIKMPFRKVENCNQVIKIGKQLKFSLVNVAGNDIVQGN 359

Query: 483 KKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNWANRKVKKANRTSQIESFKDK 542
           KKLIL  LWQLMRF MLQLLK+LR+ + GKE+TD DIL+WANRKV+   R  QIESFKDK
Sbjct: 360 KKLILGLLWQLMRFHMLQLLKSLRSRTLGKEMTDADILSWANRKVRTMGRKLQIESFKDK 419

Query: 543 NLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPEDIM 602
           +LS+G+FFL LL AVEPRVVNW+LVTKGET+++K+LNATYI+SVARKLGCS+FLLPEDI+
Sbjct: 420 SLSSGLFFLNLLWAVEPRVVNWNLVTKGETDDEKRLNATYIVSVARKLGCSVFLLPEDIV 479

Query: 603 EVNQKMILILTASIMYWSLQQ 623
           EVNQKMILILTASIMYWSLQ+
Sbjct: 480 EVNQKMILILTASIMYWSLQR 500
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 131 Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 131 Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 131 Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 131 Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 159 Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 159 Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 159 Back     information, alignment and structure
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Length = 144 Back     information, alignment and structure
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Length = 144 Back     information, alignment and structure
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 108 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query677
d1pxya_500 Fimbrin (Plastin), actin-crosslinking domain {Thal 100.0
d1rt8a_505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 100.0
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 100.0
d1rt8a_ 505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 100.0
d1aoaa1131 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.96
d1sh5a2110 Actin binding domain of plectin {Human (Homo sapie 99.94
d1bkra_108 beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1bhda_108 Utrophin {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1dxxa2127 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1aoaa1131 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.92
d1sh5a1120 Actin binding domain of plectin {Human (Homo sapie 99.92
d1sh5a2110 Actin binding domain of plectin {Human (Homo sapie 99.91
d1dxxa2127 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1bkra_108 beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1dxxa1111 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1dxxa1111 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1bhda_108 Utrophin {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1sh5a1120 Actin binding domain of plectin {Human (Homo sapie 99.89
d1wjoa_124 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.86
d1aoaa2116 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.83
d1wjoa_124 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.76
d1aoaa2116 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.76
d1p2xa_159 Ras GTPase-activating-like protein rng2 {Fission y 99.75
d1p2xa_159 Ras GTPase-activating-like protein rng2 {Fission y 99.71
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.5
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.48
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.46
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.45
d1ujoa_144 Transgelin {Mouse (Mus musculus) [TaxId: 10090]} 99.43
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.38
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.37
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.36
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.32
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.26
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.25
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.25
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.24
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.22
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.17
d1h67a_108 Calponin {Chicken (Gallus gallus) [TaxId: 9031]} 99.17
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.08
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.07
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.06
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.01
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.0
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.0
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.99
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.99
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.98
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.95
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.91
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.91
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.9
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.89
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.88
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.84
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.83
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.82
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.82
d1h67a_108 Calponin {Chicken (Gallus gallus) [TaxId: 9031]} 98.81
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.8
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.8
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.78
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.77
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.77
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.76
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.75
d1ujoa_144 Transgelin {Mouse (Mus musculus) [TaxId: 10090]} 98.74
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.74
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.74
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.73
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.72
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.71
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.69
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.68
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.67
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.62
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.61
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.61
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.61
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.59
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.57
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.56
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.56
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.54
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.53
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.52
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.51
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.51
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.49
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.47
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.44
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.43
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.41
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.35
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.35
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.34
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.34
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.3
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.29
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.28
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.27
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.27
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.27
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.25
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.21
d2qjza1120 Microtubule-associated protein eb1, N-terminal mic 98.19
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.19
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.19
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.17
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.12
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.1
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.09
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.06
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.06
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.06
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.04
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.04
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 97.98
d2qjza1120 Microtubule-associated protein eb1, N-terminal mic 97.92
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 97.87
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 97.86
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.85
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.81
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.78
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 97.73
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.73
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 97.68
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.66
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 97.65
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 97.61
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 97.58
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 97.44
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 97.44
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.38
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.32
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 97.32
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 97.25
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 96.79
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 96.42
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 96.15
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 95.96
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 95.86
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 95.43
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 95.26
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 94.58
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 94.31
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 93.19
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 92.53
d1wixa_164 Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId 92.35
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 91.62
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 90.3
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 89.47
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 88.74
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 87.25
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 86.64
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 85.95
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 85.43
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 84.2
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 82.47
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 82.33
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 82.15
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 82.02
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 81.84
d1wixa_164 Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId 81.31
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 80.17
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Fimbrin (Plastin), actin-crosslinking domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=2.5e-108  Score=915.41  Aligned_cols=500  Identities=78%  Similarity=1.270  Sum_probs=444.3

Q ss_pred             HHHHHHHHHHHhhhCCCCCcccccCCCCchhHHHHHhhcHHHHHHHHHHHcCCCcccccccccCCCChHHHHHHHHHHHH
Q 005777          123 SEKASYVAHINSFLGEDPFLSKYLPIDPSTNALFDLAKDGVLLCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLN  202 (677)
Q Consensus       123 ~q~~~~~~wIN~~L~~~~~~~~~~p~~~~~~dl~~dl~DGv~L~~Lie~l~~~~i~~~~i~~~~~~~~~~~~eNv~~~L~  202 (677)
                      .|+++|++|||++|++++.+++++|+++.++||++||+||++||+|+|+++|++++++.++++++.+++|++||++.||+
T Consensus         1 ~qk~tft~WiN~~L~~~~~~~~~lpi~~~v~dL~~dl~DG~~L~~Lle~ls~~~l~~~~~~~~~~~~r~~~~eN~~~aL~   80 (500)
T d1pxya_           1 SEKGPFVQHINRYLGDDPFLKQFLPLDPHSNQLYELVKDGVLLCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLN   80 (500)
T ss_dssp             CTHHHHHHHHHHHHTTCTTTTTTCSCCTTSSHHHHHSTTSHHHHHHHHHHSTTSSCGGGSCCCSSCCHHHHHHHHHHHHH
T ss_pred             CcHhHHHHHHHHHhccCccccccCCCCCcHHHHHHHhhhHHHHHHHHHHHcCCccchhhhcCCCCccHHHHHHHHHHHHH
Confidence            38999999999999999999999999999999999999999999999999999999999988878899999999999999


Q ss_pred             HHHHcCceeeccCCcccccCchHHHHHHHHHHHHHHHhhccccccCcccccccCCCchhhhhhCCCcHHHHHHHHHHHhh
Q 005777          203 SAKAIGCTVVNIGTQDLVEGRPHLLLGLISQIIKIQLLADLNLKKTPQLVELVDDNNDVEELLGLPPEKVLLKWMNFHLK  282 (677)
Q Consensus       203 ~~k~~G~~~~~i~~~di~~g~~~~iL~Liw~li~~~~~~~i~~~~~p~l~~l~~~~e~~~~~~~~s~~~~LL~Wvn~~l~  282 (677)
                      |+++.||++++|+++||++|++++||||+|+||++|+++.++++.+|++.++...+++.+++..++|+++||+|||+|++
T Consensus        81 ~~k~~gi~lvnI~~~dIvdGn~~liLgLlW~ii~~~~i~~i~~~~~~~~~~~~~~~~~~~~~~~~s~~~~LL~W~n~~l~  160 (500)
T d1pxya_          81 SAKAVGCSVVNIGTQDLAEGRPHLVLGLISQLIKIQLLADLNLKKTPQLVELLEDSDDVEELLRLPPEKVLLKWMNFHLK  160 (500)
T ss_dssp             HHHHTTCCCTTCCHHHHHHTCHHHHHHHHHHHHHHHHHSSSSSCC-----------------CCSCHHHHHHHHHHHHHH
T ss_pred             HHHHcCCEEeccChhhhhcCCHHHHHHHHHHHHHHHHHhhhccccCcchhccccCCccchhhccCCHHHHHHHHHHHhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             hcCCcccccCCCCCccchHHHHHHHHhhCCCCCCCCCCCCCCHHHHHHHHHHHHHhCCCccccCccccccCCCcchHHHH
Q 005777          283 KAGYEKQVTNFSSDLKDGEAYAHLLNALAPEHCSPATFDTKDPTERASKVIEQAEKMDCKRYLTPKDIVEGSPNLNLAFV  362 (677)
Q Consensus       283 ~~~~~~~V~nFs~d~~DG~al~~Ll~~~~P~~~~~~~l~~~~~~~~~~~a~~~ae~lgi~~~l~peDi~~~~~~~~l~~v  362 (677)
                      ..++.++|+||++||+||++||+|+|+++|+.++++.+...+..+|++.||+.|++||||++++|+||++++|+++|+||
T Consensus       161 ~~~~~~~v~nf~~d~~dG~~~~~Ll~~~~P~~~~~~~~~~~~~~~~~~~a~~~a~~lgip~~l~peDI~~~~~k~~l~~v  240 (500)
T d1pxya_         161 KGGYKKTVSNFSADLKDAQAYAFLLNVLAPEHCDPATLDAKDPLERAELVLSHAERMNCKRYLTAEEIVEGSSTLNLAFV  240 (500)
T ss_dssp             HTTCCSCCCCSSTTTTTSHHHHHHHHHHCGGGCCGGGGGCCSHHHHHHHHHHHHHHTTCCCCCCHHHHHTTCHHHHHHHH
T ss_pred             ccCCCceeecCcCCchhHHHHHHHHHHHCCCccChhhcCcCCHHHHHHHHHHHHHHhCCCccCCHHHhcCCcHHHHHHHH
Confidence            88888899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhcCCCCCccchhhhhhcchhHHhHHhHHHHHHHHHhhCCCCcchhHHHHhhhHHHHHHHHHHhCCCcccccccc
Q 005777          363 AHIFQHRNGLSMDSNKISFAEMMTDDAQTSREERCFRLWINSLGTATYVNNVFEDVRNGWVLLEVLDKVSPGSVSWKQAT  442 (677)
Q Consensus       363 a~l~~~~~gl~~~~~~~~~~~~~~~~~~~~~q~~~f~~WiN~~~~~~~v~dl~~dl~DG~~L~~lle~l~~~~v~~k~~~  442 (677)
                      |+||+++|++.+... ....+...++.++.+|+++|++|||+++.+++|+||++||+||++|++|+|+++|+.++|+..+
T Consensus       241 a~lf~~~p~~~~~~~-~~~~~~~~e~~~~~~~~ktf~~WiNs~~~~~~V~dL~~dl~DG~~L~~Lle~l~~~~~~~~~~~  319 (500)
T d1pxya_         241 AQIFHERNGLNKDGK-YAFAEMMTEDVETCRDERCYRLWINSLGIDSYVNNVFEDVRNGWILLEVLDKVSPSSVNWKHAS  319 (500)
T ss_dssp             HHHHHHCCCCC--------------CCHHHHHHHHHHHHHTTTTCSSCCSCHHHHTTTSHHHHHHHHHHSTTCCCGGGCC
T ss_pred             HHHHHhccccccccc-hhhhhhhhhhhhhhhhHHHHHHHHhccCCCCCcchHHHHHhhhHHHHHHHHHhcCCCCChhhcC
Confidence            999999999988664 3345556678889999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCchhHHHHHHHHHHHHHHhhccccccccccccccChhhhHHHHHHHHHHHHHHHHhhhcccCCCCCCCCHHHHHHH
Q 005777          443 KPPIKMPFRKVENCNQVVKIGKELNFSLVNVAGNDIVQGNKKLILAFLWQLMRFTMLQLLKNLRTHSQGKEITDTDILNW  522 (677)
Q Consensus       443 ~~~~~~~~~~ieN~~~~l~~~k~~g~~~~~i~~~div~g~~kliL~LlW~lir~~~~~~~~~l~~~~~~~~~~~~~LL~W  522 (677)
                      +||.++++++++||++|++++++.|++++||+|+||++|++++||||+|+||+++..+..........++..+++.||.|
T Consensus       320 ~~~~~~~~~ki~N~~~al~~~~~~gi~l~~I~~~DI~dG~~k~iLgLlW~Li~~~~i~~~~~~~~~~~~~~~~~~~LL~W  399 (500)
T d1pxya_         320 KPPIKMPFRKVENCNQVIKIGKQLKFSLVNVAGNDIVQGNKKLILGLLWQLMRFHMLQLLKSLRSRTLGKEMTDADILSW  399 (500)
T ss_dssp             CSSCCCHHHHHHHHHHHHHHHHHTTCCCCSCCHHHHHTTCHHHHHHHHHHHHHHHHHHHHHTTCC-----CCCHHHHHHH
T ss_pred             CCcccchHHHHHHHHHHHHHHHHcCCccCCCChHHhhccchhhHHHHHHHHHHHHHHHHHHhhhcccchhhhHHHHHHHH
Confidence            88888999999999999999999999999999999999999999999999997776665544433333445678999999


Q ss_pred             HHHHhhhcCCccccccCCCCCCCcHHHHHHHHhhhCCCceeccccCCCCChHhHHhhHHHHHHHHHHcCCCCcCCccccc
Q 005777          523 ANRKVKKANRTSQIESFKDKNLSNGIFFLELLSAVEPRVVNWSLVTKGETEEDKKLNATYIISVARKLGCSIFLLPEDIM  602 (677)
Q Consensus       523 ~~~~~~~~~~~~~i~~f~d~s~~dG~al~aLi~~~~P~~i~~~~~~~~~~~~~~~~n~~~a~~~A~~lGi~~~l~~eDi~  602 (677)
                      ||+++..|++++.|+||+|+||+||+|||+|||+|+|++|||+.+.++.+.++.+.|+++||++|++||||++++|||++
T Consensus       400 ~~~~~~~~~~~~~I~nF~~~s~~dG~a~~~Li~~~~P~~id~~~~~~~~~~~~~~~N~~~a~~~a~~lGip~ll~peDv~  479 (500)
T d1pxya_         400 ANRKVRTMGRKLQIESFKDKSLSSGLFFLNLLWAVEPRVVNWNLVTKGETDDEKRLNATYIVSVARKLGCSVFLLPEDIV  479 (500)
T ss_dssp             HHHHHHTTTCCCCCSSTTCGGGGGCHHHHHHHHHHCGGGCCTTSCCCSCSHHHHHHHHHHHHHHHHHHTCCCCCCHHHHH
T ss_pred             HHHHHHhcCCCCccCcCCCCCccccHHHHHHHHhhCCCccCHhhcCCCCCchHHHHHHHHHHHHHHHcCCCccCCHHHCC
Confidence            99999999888999999757999999999999999999999999998888788899999999999999999999999999


Q ss_pred             cCCccHHHHHHHHHHHHhhcC
Q 005777          603 EVNQKMILILTASIMYWSLQQ  623 (677)
Q Consensus       603 ~~d~k~i~tyls~l~~~~~~~  623 (677)
                      +||+|+||||+|+||+|..++
T Consensus       480 ~~deksv~tyvs~l~~~~l~~  500 (500)
T d1pxya_         480 EVNQKMILILTASIMYWSLQR  500 (500)
T ss_dssp             TTCHHHHHHHHHHHHHHHTTC
T ss_pred             CCCcchhHHHHHHHHHHHhcC
Confidence            999999999999999998764
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qjza1 a.40.1.1 (A:13-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qjza1 a.40.1.1 (A:13-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wixa_ a.40.3.1 (A:) Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wixa_ a.40.3.1 (A:) Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure