Citrus Sinensis ID: 005824

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-----
MARKEGVLGIGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKNQLAMNPTNTVFDAKRLIGRRFSDVSVQEDIKLWPFKVIAGPNDKPMIAVKYKGGEKKYAAEDISSMVLAKMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEPTAAAIAYGLHRKASSEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFIQEFKRKKKKDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFSSVITRARFEELNMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNINPDEAVAYGAAVQAAVLSGNRSDKVEDTVVLDVNSKYNSSLEPKTTTSFAAQDLPSRAGHKTHRAHDLQLKNHKILSECNGCKRPAFGLMYRCELCNFNLHIPCMFIDRKPAAKHEFFGNSTFKSLPKLPGICSTRDCRDCNKHCHACARPADGFVYHCEEKGRNLHPCCFNLPRKLAIGSVEFVLSDKELSQECIWCESKRLQGSASDNWGWSYVSKCNNYHCHAFCSTEMLLENWKSSEEKSKDSTYYSLVPNSLKLPVKSQLKRNKGRGNKYLMIAKGFFQILVSIFIGDPTTLLASLILGLVMN
ccccccccEEEEEccccccEEEEEEccEEEEEcccccccccccEEEEccccccccHHHHHcccccccccccccccccccccccHHHHcccccccEEEEEccccccEEEEEEccEEEcccccHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccccccEEEEEEEcccccEEEEEEEEEccEEEEEEEccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccccccccccEEEccccccccEEEEEEcccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccEEEEccccEEEEEEHHHHHHHHHHccccccccccEEEEEccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcc
ccccccccEEEEEccccEEEEEEEEccEEEEcccccccccEEccEEEccccEEEcHHHHccccccHHHEEccHHHccccccccHHHHHHHHHcccEEEEEEccEEEEEEEEccEEEEEcHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHcccccccccEEEEEEEEEccccEEEEEEEEEccEccEEEEEEEccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEccEEEEEEEEHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHccEEEEEcHHHHcHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccHHHHHEEEEEccccccccccccccccccEEcccccHcHHccccccccccccEEEEEcccccccEEEEEEEccEcccccccccEEEEcHcccccccccEEEEcccccccEEEEEEEEEcccccEEEEEEEccccEEEEccccccccccccccccEEEEEEEEEEEccHHHcccEEEEEccccccccccccccEEEEccccccccccccHHHHHHcccccccccccccEEEEcccccccccHHHHHHccccccHHHHHHHHHHHHEEEEEcccHHHHHHHHHHHHHcc
markegvlgigidlgttYSCVGVWQHNRVEIIandqgnrttpsyvaftkkerfagnaaknqlamnptntvfdakrligrrfsdvsvqediklwpfkviagpndkpmIAVKykggekkyaAEDISSMVLAKMREIAKAYLgsnvknavvtvpayftdsqrqATKDAGAMAGLNVLKIISEPTAAAIAYGLhrkassekNVLIFDlgggtfdvSLLTIGKGIFKvkatagdthlggedfdnRMVNHFIQEFKRkkkkdisgsprAVQRLTTACERAKrtlsstsqttIEIDslyegidfssVITRARFEELNMDLFRKCIKHVDMClrngkmdksrvDDVVIVGGSARIPKVQQLLQEFFngkrlcqninpdEAVAYGAAVQAAVLsgnrsdkveDTVVLDVNSkynsslepktttsfaaqdlpsraghkthrahdlqlknhkilsecngckrpafgLMYRCElcnfnlhipcmfidrkpaakheffgnstfkslpklpgicstrdcrdcnkhchacarpadgfvyhceekgrnlhpccfnlprklaigSVEFVLSDKELSQECiwceskrlqgsasdnwgwsyvskcnnyhchafcSTEMLLENWksseekskdstyyslvpnslklpvksqlkrnkgrgnkYLMIAKGFFQILVSIFIGDPTTLLASLILGLVMN
markegvlgigidlgTTYSCVGVWQHNRVeiiandqgnrtTPSYVAFTKKERFAgnaaknqlamnptntVFDAKRLIGRRfsdvsvqediklwpfkviagpndkPMIAVKYKGGEKKYAAEDISSMVLAKMREIAKAylgsnvknaVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEPTAAAIAYGLHRKASSEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDThlggedfdnrMVNHFIQEfkrkkkkdisgspravqRLTTacerakrtlsstsqttieidslyegidFSSVITRARFEELNMDLFRKCIKHVDMClrngkmdksrVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNINPDEAVAYGAAVQAAVLsgnrsdkvEDTVVLDVNSkynsslepktttsfaaqdlpsrAGHKThrahdlqlknhkilSECNGCKRPAFGLMYRCELCNFNLHIPCMFIDRKPAAKHEFFgnstfkslpklpGICSTRDCRDCNKHCHACARPADGFVYHCEEKGRNLHPCCFNLPRKLAIGSVEFVLSDKELSQECIWCESKRLQGSASDNWGWSYVSKCNNYHCHAFCSTEMLLENWKSSEEKSKDstyyslvpnslklpvksqlkrnkGRGNKYLMIAKGFFQILVSIFIGDPTTLLASLILGLVMN
MARKEGVLGIGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKNQLAMNPTNTVFDAKRLIGRRFSDVSVQEDIKLWPFKVIAGPNDKPMIAVKYKGGEKKYAAEDISSMVLAKMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEPTAAAIAYGLHRKASSEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFIQEFKRKKKKDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFSSVITRARFEELNMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNINPDEavaygaavqaavLSGNRSDKVEDTVVLDVNSKYNSSLEPKTTTSFAAQDLPSRAGHKTHRAHDLQLKNHKILSECNGCKRPAFGLMYRCELCNFNLHIPCMFIDRKPAAKHEFFGNSTFKSLPKLPGICSTRDCRDCNKHCHACARPADGFVYHCEEKGRNLHPCCFNLPRKLAIGSVEFVLSDKELSQECIWCESKRLQGSASDNWGWSYVSKCNNYHCHAFCSTEMLLENWKSSEEKSKDSTYYSLVPNSLKLPVKSQLKRNKGRGNKYLMIAKGFFQILVSIFIGDPTTLLASLILGLVMN
*****GVLGIGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKNQLAMNPTNTVFDAKRLIGRRFSDVSVQEDIKLWPFKVIAGPNDKPMIAVKYKGGEKKYAAEDISSMVLAKMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEPTAAAIAYGLHRKASSEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFIQEF**********************************TTIEIDSLYEGIDFSSVITRARFEELNMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNINPDEAVAYGAAVQAAVLSGN****VEDTVVLD***********************************LQLKNHKILSECNGCKRPAFGLMYRCELCNFNLHIPCMFIDRKPAAKHEFFGNSTFKSLPKLPGICSTRDCRDCNKHCHACARPADGFVYHCEEKGRNLHPCCFNLPRKLAIGSVEFVLSDKELSQECIWCESKRLQGSASDNWGWSYVSKCNNYHCHAFCSTEMLLENW************YSLV*****************RGNKYLMIAKGFFQILVSIFIGDPTTLLASLILGLV**
*****GV***GIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKNQLAMNPTNTVFDAKRLIGRRFSDVSVQEDIKLWPFKVIAGPNDKPMIAVKYKGGEKKYAAEDISSMVLAKMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEPTAAAIAYGLHRKASSEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFIQEFKRKKKKDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFSSVITRARFEELNMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNINPDEAVAYGAAVQAAVLSGNRSDKVEDTVVLDVNSKYNSSLEPKTTTSFAAQDLPSRAGHKTHRAHDLQLKNHKILSECNGCKRPAFGLMYRCELCNFNLHIPCMFIDRKPAAKHEFFGNSTFKSLPKLPGICSTRDCRDCNKHCHACARPADGFVYHCEEKGRNLHPCCFNLPRKLAIGSVEFVLSDKELSQECIWCESKRLQGSASDNWGWSYVSKCNNYHCHAFCSTEML*******************************************MIAKGFFQILVSIFIGDPTTLLASLILGLVMN
MARKEGVLGIGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKNQLAMNPTNTVFDAKRLIGRRFSDVSVQEDIKLWPFKVIAGPNDKPMIAVKYKGGEKKYAAEDISSMVLAKMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEPTAAAIAYGLHRKASSEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFIQEF***************QRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFSSVITRARFEELNMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNINPDEAVAYGAAVQAAVLSGNRSDKVEDTVVLDVNSKYNSSLEPKTTTSFAAQDLP**********HDLQLKNHKILSECNGCKRPAFGLMYRCELCNFNLHIPCMFIDRKPAAKHEFFGNSTFKSLPKLPGICSTRDCRDCNKHCHACARPADGFVYHCEEKGRNLHPCCFNLPRKLAIGSVEFVLSDKELSQECIWCESKRLQGSASDNWGWSYVSKCNNYHCHAFCSTEMLLENW***********YYSLVPNSLKLPVKSQLKRNKGRGNKYLMIAKGFFQILVSIFIGDPTTLLASLILGLVMN
*****GVLGIGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKNQLAMNPTNTVFDAKRLIGRRFSDVSVQEDIKLWPFKVIAGPNDKPMIAVKYKGGEKKYAAEDISSMVLAKMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEPTAAAIAYGLHRKASSEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFIQEFKRKKKKDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFSSVITRARFEELNMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNINPDEAVAYGAAVQAAVLSGNRSDKVEDTVVLDVNSKYNSSLEPKTTTSFAAQDLPSRAGHKTHRAHDLQLKNHKILSECNGCKRPAFGLMYRCELCNFNLHIPCMFIDRKPAAKHEFFGNSTFKSLPKLPGICSTRDCRDCNKHCHACARPADGFVYHCEEKGRNLHPCCFNLPRKLAIGSVEFVLSDKELSQECIWCESKRLQGSASDNWGWSYVSKCNNYHCHAFCSTEMLLENWKS*****KDSTYYSLVPNSLKLPVKSQLKRNKGRGNKYLMIAKGFFQILVSIFIGDPTTLLASLILGLVMN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARKEGVLGIGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKNQLAMNPTNTVFDAKRLIGRRFSDVSVQEDIKLWPFKVIAGPNDKPMIAVKYKGGEKKYAAEDISSMVLAKMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEPTAAAIAYGLHRKASSEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFIQEFKRKKKKDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFSSVITRARFEELNMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNINPDEAVAYGAAVQAAVLSGNRSDKVEDTVVLDVNSKYNSSLEPKTTTSFAAQDLPSRAGHKTHRAHDLQLKNHKILSECNGCKRPAFGLMYRCELCNFNLHIPCMFIDRKPAAKHEFFGNSTFKSLPKLPGICSTRDCRDCNKHCHACARPADGFVYHCEEKGRNLHPCCFNLPRKLAIGSVEFVLSDKELSQECIWCESKRLQGSASDNWGWSYVSKCNNYHCHAFCSTEMLLENWKSSEEKSKDSTYYSLVPNSLKLPVKSQLKRNKGRGNKYLMIAKGFFQILVSIFIGDPTTLLASLILGLVMN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query675 2.2.26 [Sep-21-2011]
P09189651 Heat shock cognate 70 kDa N/A no 0.592 0.614 0.808 0.0
P22953651 Probable mediator of RNA yes no 0.579 0.600 0.809 0.0
P27322644 Heat shock cognate 70 kDa N/A no 0.592 0.621 0.793 0.0
Q9LHA8650 Probable mediator of RNA no no 0.592 0.615 0.788 0.0
P24629650 Heat shock cognate 70 kDa N/A no 0.592 0.615 0.786 0.0
O65719649 Heat shock 70 kDa protein no no 0.592 0.616 0.776 0.0
P22954653 Probable mediator of RNA no no 0.592 0.612 0.781 0.0
Q9C7X7617 Heat shock 70 kDa protein no no 0.592 0.648 0.788 0.0
P26413645 Heat shock 70 kDa protein no no 0.591 0.618 0.781 0.0
P29357653 Chloroplast envelope memb N/A no 0.592 0.612 0.778 0.0
>sp|P09189|HSP7C_PETHY Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1 Back     alignment and function desciption
 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/402 (80%), Positives = 361/402 (89%), Gaps = 2/402 (0%)

Query: 1   MARKEGVLGIGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKN 60
           MA K     IGIDLGTTYSCVGVWQH+RVEIIANDQGNRTTPSYV FT  ER  G+AAKN
Sbjct: 1   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN 60

Query: 61  QLAMNPTNTVFDAKRLIGRRFSDVSVQEDIKLWPFKVIAGPNDKPMIAVKYKGGEKKYAA 120
           Q+AMNP NTVFDAKRLIGRRFSD SVQ DIKLWPFKVI GP DKPMI V YKG EK++AA
Sbjct: 61  QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKQFAA 120

Query: 121 EDISSMVLAKMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEP 180
           E+ISSMVL KM+EIA+AYLG+ +KNAVVTVPAYF DSQRQATKDAG +AGLNV++II+EP
Sbjct: 121 EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP 180

Query: 181 TAAAIAYGLHRKASS--EKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFD 238
           TAAAIAYGL +KASS  EKNVLIFDLGGGTFDVSLLTI +GIF+VKATAGDTHLGGEDFD
Sbjct: 181 TAAAIAYGLDKKASSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240

Query: 239 NRMVNHFIQEFKRKKKKDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFS 298
           NRMVNHF+QEFKRK KKDISG+PRA++RL TACERAKRTLSST+QTTIEIDSLYEGIDF 
Sbjct: 241 NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY 300

Query: 299 SVITRARFEELNMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFF 358
           S ITRARFEELNMDLFRKC++ V+ CLR+ KMDKS V DVV+VGGS RIPKVQQLLQ+FF
Sbjct: 301 STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFF 360

Query: 359 NGKRLCQNINPDEAVAYGAAVQAAVLSGNRSDKVEDTVVLDV 400
           NGK LC++INPDEAVAYGAAVQAA+LSG  ++KV+D ++LDV
Sbjct: 361 NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDV 402

Petunia hybrida (taxid: 4102)
>sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 Back     alignment and function description
>sp|P27322|HSP72_SOLLC Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHA8|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1 Back     alignment and function description
>sp|P24629|HSP71_SOLLC Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1 Back     alignment and function description
>sp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSP70-3 PE=1 SV=1 Back     alignment and function description
>sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 Back     alignment and function description
>sp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=1 SV=1 Back     alignment and function description
>sp|P26413|HSP70_SOYBN Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1 Back     alignment and function description
>sp|P29357|HSP7E_SPIOL Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query675
414879778648 TPA: hypothetical protein ZEAMMB73_64856 0.591 0.615 0.813 0.0
242054931648 hypothetical protein SORBIDRAFT_03g03936 0.591 0.615 0.810 0.0
225440324649 PREDICTED: heat shock cognate 70 kDa pro 0.592 0.616 0.810 0.0
115486793649 Os11g0703900 [Oryza sativa Japonica Grou 0.592 0.616 0.808 0.0
115464309646 Os05g0460000 [Oryza sativa Japonica Grou 0.591 0.617 0.808 0.0
255575054649 heat shock protein, putative [Ricinus co 0.592 0.616 0.808 0.0
308081377648 uncharacterized protein LOC100501536 [Ze 0.591 0.615 0.808 0.0
242090773649 hypothetical protein SORBIDRAFT_09g02258 0.591 0.614 0.805 0.0
115440955648 Os01g0840100 [Oryza sativa Japonica Grou 0.591 0.615 0.810 0.0
242083856649 hypothetical protein SORBIDRAFT_08g01875 0.592 0.616 0.808 0.0
>gi|414879778|tpg|DAA56909.1| TPA: hypothetical protein ZEAMMB73_648566 [Zea mays] Back     alignment and taxonomy information
 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/402 (81%), Positives = 365/402 (90%), Gaps = 3/402 (0%)

Query: 1   MARKEGVLGIGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKN 60
           MA+ EG   IGIDLGTTYSCVGVWQH+RVEIIANDQGNRTTPSYVAFT  ER  G+AAKN
Sbjct: 1   MAKGEGP-AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 59

Query: 61  QLAMNPTNTVFDAKRLIGRRFSDVSVQEDIKLWPFKVIAGPNDKPMIAVKYKGGEKKYAA 120
           Q+AMNPTNTVFDAKRLIGRRFSD SVQ D+KLWPFKVI GP DKPMI V YKG EK++AA
Sbjct: 60  QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVSYKGEEKQFAA 119

Query: 121 EDISSMVLAKMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEP 180
           E+ISSMVL KM+EIA+AYLGS +KNAVVTVPAYF DSQRQATKDAG +AGLNV++II+EP
Sbjct: 120 EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP 179

Query: 181 TAAAIAYGLHRKASS--EKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFD 238
           TAAAIAYGL +KASS  EKNVLIFDLGGGTFDVSLLTI +GIF+VKATAGDTHLGGEDFD
Sbjct: 180 TAAAIAYGLDKKASSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 239

Query: 239 NRMVNHFIQEFKRKKKKDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFS 298
           NRMVNHF+QEFKRK KKDISG+PRA++RL TACERAKRTLSST+QTTIEIDSL+EGIDF 
Sbjct: 240 NRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFY 299

Query: 299 SVITRARFEELNMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFF 358
           S ITRARFEELNMDLFRKC++ V+ CLR+ KMDKS V DVV+VGGS RIPKVQQLLQ+FF
Sbjct: 300 STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFF 359

Query: 359 NGKRLCQNINPDEAVAYGAAVQAAVLSGNRSDKVEDTVVLDV 400
           NGK LC++INPDEAVAYGAAVQAA+LSG  ++KV+D ++LDV
Sbjct: 360 NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDV 401

Source: Zea mays

Species: Zea mays

Genus: Zea

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|242054931|ref|XP_002456611.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor] gi|241928586|gb|EES01731.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|225440324|ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|115486793|ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group] gi|62733235|gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza sativa Japonica Group] gi|77552703|gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza sativa Japonica Group] gi|113645762|dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115464309|ref|NP_001055754.1| Os05g0460000 [Oryza sativa Japonica Group] gi|47900318|gb|AAT39165.1| putative hsp70 [Oryza sativa Japonica Group] gi|113579305|dbj|BAF17668.1| Os05g0460000 [Oryza sativa Japonica Group] gi|215769174|dbj|BAH01403.1| unnamed protein product [Oryza sativa Japonica Group] gi|222631852|gb|EEE63984.1| hypothetical protein OsJ_18811 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|255575054|ref|XP_002528432.1| heat shock protein, putative [Ricinus communis] gi|223532108|gb|EEF33915.1| heat shock protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|308081377|ref|NP_001183165.1| uncharacterized protein LOC100501536 [Zea mays] gi|238009750|gb|ACR35910.1| unknown [Zea mays] gi|413951984|gb|AFW84633.1| heat shock protein1 [Zea mays] Back     alignment and taxonomy information
>gi|242090773|ref|XP_002441219.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor] gi|241946504|gb|EES19649.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|115440955|ref|NP_001044757.1| Os01g0840100 [Oryza sativa Japonica Group] gi|15623835|dbj|BAB67894.1| putative HSP70 [Oryza sativa Japonica Group] gi|21104622|dbj|BAB93214.1| putative HSP70 [Oryza sativa Japonica Group] gi|113534288|dbj|BAF06671.1| Os01g0840100 [Oryza sativa Japonica Group] gi|125572585|gb|EAZ14100.1| hypothetical protein OsJ_04024 [Oryza sativa Japonica Group] gi|215769289|dbj|BAH01518.1| unnamed protein product [Oryza sativa Japonica Group] gi|306416013|gb|ADM86881.1| 70kDa heat shock protein [Oryza sativa Japonica Group] gi|313575779|gb|ADR66969.1| 70 kDa heat shock protein [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242083856|ref|XP_002442353.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor] gi|241943046|gb|EES16191.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query675
TAIR|locus:2181833651 HSC70-1 "heat shock cognate pr 0.579 0.600 0.783 3.1e-163
TAIR|locus:2101222650 HSP70 "heat shock protein 70" 0.591 0.613 0.764 3.1e-161
TAIR|locus:2010713617 ERD2 "EARLY-RESPONSIVE TO DEHY 0.591 0.646 0.764 2.8e-160
TAIR|locus:2074984649 AT3G09440 [Arabidopsis thalian 0.591 0.614 0.751 3.6e-160
TAIR|locus:2181818653 Hsp70-2 [Arabidopsis thaliana 0.591 0.611 0.756 1.6e-159
TAIR|locus:2200462646 Hsp70b "heat shock protein 70B 0.579 0.605 0.720 8.5e-152
UNIPROTKB|Q5NVM9646 HSPA8 "Heat shock cognate 71 k 0.574 0.600 0.704 4.1e-147
UNIPROTKB|F1NRW7647 HSPA8 "Heat shock cognate 71 k 0.574 0.599 0.704 6.7e-147
UNIPROTKB|F1NWP3646 HSPA8 "Heat shock cognate 71 k 0.574 0.600 0.704 6.7e-147
UNIPROTKB|P19120650 HSPA8 "Heat shock cognate 71 k 0.574 0.596 0.702 1.1e-146
TAIR|locus:2181833 HSC70-1 "heat shock cognate protein 70-1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1589 (564.4 bits), Expect = 3.1e-163, P = 3.1e-163
 Identities = 308/393 (78%), Positives = 347/393 (88%)

Query:    10 IGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKNQLAMNPTNT 69
             IGIDLGTTYSCVGVWQH+RVEIIANDQGNRTTPSYVAFT  ER  G+AAKNQ+AMNP NT
Sbjct:    10 IGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPVNT 69

Query:    70 VFDAKRLIGRRFSDVSVQEDIKLWPFKVIAGPNDKPMIAVKYKGGEKKYAAEDISSMVLA 129
             VFDAKRLIGRRFSD SVQ D+KLWPFK+ AGP DKPMI V+YKG EK++AAE+ISSMVL 
Sbjct:    70 VFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAAEEISSMVLI 129

Query:   130 KMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEPTAAAIAYGL 189
             KMREIA+AYLG  +KNAVVTVPAYF DSQRQATKDAG +AGLNV++II+EPTAAAIAYGL
Sbjct:   130 KMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGL 189

Query:   190 HRKASS--EKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFIQ 247
              +KA+S  EKNVLIFDLGGGTFDVSLLTI +GIF+VKATAGDTHLGGEDFDNRMVNHF+Q
Sbjct:   190 DKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQ 249

Query:   248 EFKRKKKKDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFSSVITRARFE 307
             EFKRK KKDI+G+PRA++RL T+CERAKRTLSST+QTTIEIDSLYEGIDF S ITRARFE
Sbjct:   250 EFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFE 309

Query:   308 ELNMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNI 367
             ELNMDLFRKC++ V+ CLR+ KMDKS V DVV+VGGS RIPKVQQLLQ+FFNGK LC++I
Sbjct:   310 ELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSI 369

Query:   368 NPDEXXXXXXXXXXXXLSGNRSDKVEDTVVLDV 400
             NPDE            LSG  ++KV+D ++LDV
Sbjct:   370 NPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDV 402
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0005829 "cytosol" evidence=IDA;RCA;TAS
GO:0006457 "protein folding" evidence=TAS
GO:0009408 "response to heat" evidence=IEP;IMP
GO:0005634 "nucleus" evidence=IDA
GO:0009409 "response to cold" evidence=IEP
GO:0009507 "chloroplast" evidence=IDA
GO:0005730 "nucleolus" evidence=IDA
GO:0009615 "response to virus" evidence=IEP
GO:0022626 "cytosolic ribosome" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0042742 "defense response to bacterium" evidence=IMP
GO:0050832 "defense response to fungus" evidence=IMP
GO:0048046 "apoplast" evidence=IDA
GO:0002020 "protease binding" evidence=IPI
GO:0009506 "plasmodesma" evidence=IDA
GO:0010187 "negative regulation of seed germination" evidence=IMP
GO:0090332 "stomatal closure" evidence=IMP
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
TAIR|locus:2101222 HSP70 "heat shock protein 70" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010713 ERD2 "EARLY-RESPONSIVE TO DEHYDRATION 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074984 AT3G09440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181818 Hsp70-2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200462 Hsp70b "heat shock protein 70B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5NVM9 HSPA8 "Heat shock cognate 71 kDa protein" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRW7 HSPA8 "Heat shock cognate 71 kDa protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWP3 HSPA8 "Heat shock cognate 71 kDa protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P19120 HSPA8 "Heat shock cognate 71 kDa protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P29843HSP7A_DROMENo assigned EC number0.71610.57770.6084yesno
O73885HSP7C_CHICKNo assigned EC number0.72080.57620.6021yesno
P63018HSP7C_RATNo assigned EC number0.72840.57620.6021yesno
P63017HSP7C_MOUSENo assigned EC number0.72840.57620.6021yesno
Q5NVM9HSP7C_PONABNo assigned EC number0.73090.57620.6021yesno
P22953MD37E_ARATHNo assigned EC number0.80910.57920.6006yesno
P09446HSP7A_CAEELNo assigned EC number0.71680.58070.6125yesno
P36415HS7C1_DICDINo assigned EC number0.72370.57920.6109yesno
Q90473HSP7C_DANRENo assigned EC number0.71170.57920.6024yesno
P19378HSP7C_CRIGRNo assigned EC number0.72580.57620.6021yesno
A2Q0Z1HSP7C_HORSENo assigned EC number0.72840.57620.6021yesno
O59855HSP72_SCHPONo assigned EC number0.72120.57770.6027yesno
P11142HSP7C_HUMANNo assigned EC number0.72840.57620.6021yesno
P19120HSP7C_BOVINNo assigned EC number0.72840.57620.5984yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query675
cd10233376 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding 0.0
PTZ00009653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 0.0
cd10241374 cd10241, HSPA5-like_NBD, Nucleotide-binding domain 0.0
pfam00012598 pfam00012, HSP70, Hsp70 protein 0.0
cd10170369 cd10170, HSP70_NBD, Nucleotide-binding domain of t 0.0
PRK00290627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 1e-176
cd10234376 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d 1e-167
COG0443579 COG0443, DnaK, Molecular chaperone [Posttranslatio 1e-162
TIGR02350595 TIGR02350, prok_dnaK, chaperone protein DnaK 1e-159
cd11733377 cd11733, HSPA9-like_NBD, Nucleotide-binding domain 1e-156
cd11734373 cd11734, Ssq1_like_NBD, Nucleotide-binding domain 1e-143
CHL00094621 CHL00094, dnaK, heat shock protein 70 1e-142
PRK13411653 PRK13411, PRK13411, molecular chaperone DnaK; Prov 1e-139
cd10228381 cd10228, HSPA4_like_NDB, Nucleotide-binding domain 1e-135
PRK13410668 PRK13410, PRK13410, molecular chaperone DnaK; Prov 1e-133
PTZ00400663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; 1e-130
PLN03184673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 1e-125
cd10235339 cd10235, HscC_like_NBD, Nucleotide-binding domain 1e-120
cd10238375 cd10238, HSPA14-like_NBD, Nucleotide-binding domai 1e-116
cd10237417 cd10237, HSPA13-like_NBD, Nucleotide-binding domai 1e-112
PRK05183616 PRK05183, hscA, chaperone protein HscA; Provisiona 1e-112
PTZ00186657 PTZ00186, PTZ00186, heat shock 70 kDa precursor pr 1e-112
cd10236355 cd10236, HscA_like_NBD, Nucleotide-binding domain 1e-112
TIGR01991599 TIGR01991, HscA, Fe-S protein assembly chaperone H 1e-109
cd10230388 cd10230, HYOU1-like_NBD, Nucleotide-binding domain 1e-103
cd10232386 cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma 3e-97
cd11732377 cd11732, HSP105-110_like_NBD, Nucleotide-binding d 1e-85
cd11739383 cd11739, HSPH1_NBD, Nucleotide-binding domain of H 3e-83
cd11737383 cd11737, HSPA4_NBD, Nucleotide-binding domain of H 6e-83
cd11738383 cd11738, HSPA4L_NBD, Nucleotide-binding domain of 3e-77
PRK01433595 PRK01433, hscA, chaperone protein HscA; Provisiona 3e-56
cd10231415 cd10231, YegD_like, Escherichia coli YegD, a putat 9e-33
cd10229404 cd10229, HSPA12_like_NBD, Nucleotide-binding domai 7e-21
cd10225320 cd10225, MreB_like, MreB and similar proteins 7e-17
TIGR00904333 TIGR00904, mreB, cell shape determining protein, M 3e-11
PRK13930335 PRK13930, PRK13930, rod shape-determining protein 3e-10
pfam06723327 pfam06723, MreB_Mbl, MreB/Mbl protein 6e-10
cd10227312 cd10227, ParM_like, Plasmid segregation protein Pa 3e-09
TIGR02529239 TIGR02529, EutJ, ethanolamine utilization protein 2e-08
COG1077342 COG1077, MreB, Actin-like ATPase involved in cell 7e-08
PRK13928336 PRK13928, PRK13928, rod shape-determining protein 8e-08
PRK13929335 PRK13929, PRK13929, rod-share determining protein 9e-08
COG4820277 COG4820, EutJ, Ethanolamine utilization protein, p 3e-07
PRK11678450 PRK11678, PRK11678, putative chaperone; Provisiona 3e-05
COG0849418 COG0849, ftsA, Cell division ATPase FtsA [Cell div 3e-05
PRK13927334 PRK13927, PRK13927, rod shape-determining protein 5e-05
cd00012185 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- 6e-05
PRK15080267 PRK15080, PRK15080, ethanolamine utilization prote 1e-04
cd07809487 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 2e-04
TIGR01312481 TIGR01312, XylB, D-xylulose kinase 3e-04
cd11736468 cd11736, HSPA12B_like_NBD, Nucleotide-binding doma 4e-04
pfam0764930 pfam07649, C1_3, C1-like domain 5e-04
pfam01968285 pfam01968, Hydantoinase_A, Hydantoinase/oxoprolina 0.003
>gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins Back     alignment and domain information 
 Score =  764 bits (1975), Expect = 0.0
 Identities = 282/376 (75%), Positives = 326/376 (86%), Gaps = 1/376 (0%)

Query: 10  IGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKNQLAMNPTNT 69
           IGIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFT  ER  G+AAKNQ+AMNPTNT
Sbjct: 2   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNT 61

Query: 70  VFDAKRLIGRRFSDVSVQEDIKLWPFKVIAGPNDKPMIAVKYKGGEKKYAAEDISSMVLA 129
           VFDAKRLIGR+FSD  VQ D+K WPFKV+ G    P+I V+YKG  K +  E+ISSMVL 
Sbjct: 62  VFDAKRLIGRKFSDPVVQSDMKHWPFKVVNGGGKPPII-VEYKGETKTFYPEEISSMVLT 120

Query: 130 KMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEPTAAAIAYGL 189
           KM+EIA+AYLG  V NAV+TVPAYF DSQRQATKDAG +AGLNVL+II+EPTAAAIAYGL
Sbjct: 121 KMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGL 180

Query: 190 HRKASSEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFIQEF 249
            +K   E+NVLIFDLGGGTFDVSLLTI  GIF+VKATAGDTHLGGEDFDNR+VNHF+QEF
Sbjct: 181 DKKGGGERNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVQEF 240

Query: 250 KRKKKKDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFSSVITRARFEEL 309
           KRK KKDISG+ RA++RL TACERAKRTLSS++Q +IEIDSL+EGIDF + ITRARFEEL
Sbjct: 241 KRKHKKDISGNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEEL 300

Query: 310 NMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNINP 369
             DLFR  ++ V+  LR+ K+DKS++ D+V+VGGS RIPKVQ+LLQ+FFNGK L ++INP
Sbjct: 301 CADLFRGTLEPVEKVLRDAKLDKSQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINP 360

Query: 370 DEAVAYGAAVQAAVLS 385
           DEAVAYGAAVQAA+LS
Sbjct: 361 DEAVAYGAAVQAAILS 376

This subfamily includes human HSPA1A (70-kDa heat shock protein 1A, also known as HSP72; HSPA1; HSP70I; HSPA1B; HSP70-1; HSP70-1A), HSPA1B (70-kDa heat shock protein 1B, also known as HSPA1A; HSP70-2; HSP70-1B), and HSPA1L (70-kDa heat shock protein 1-like, also known as HSP70T; hum70t; HSP70-1L; HSP70-HOM). The genes for these three HSPA1 proteins map in close proximity on the major histocompatibility complex (MHC) class III region on chromosome 6, 6p21.3. This subfamily also includes human HSPA8 (heat shock 70kDa protein 8, also known as LAP1; HSC54; HSC70; HSC71; HSP71; HSP73; NIP71; HSPA10; the HSPA8 gene maps to 11q24.1), human HSPA2 (70-kDa heat shock protein 2, also known as HSP70-2; HSP70-3, the HSPA2 gene maps to 14q24.1), human HSPA6 (also known as heat shock 70kDa protein 6 (HSP70B') gi 94717614, the HSPA6 gene maps to 1q23.3), human HSPA7 (heat shock 70kDa protein 7 , also known as HSP70B; the HSPA7 gene maps to 1q23.3) and Saccharmoyces cerevisiae Stress-Seventy subfamily B/Ssb1p. This subfamily belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Associations of polymorphisms within the MHC-III HSP70 gene locus with longevity, systemic lupus erythematosus, Meniere's disease, noise-induced hearing loss, high-altitude pulmonary edema, and coronary heart disease, have been found. HSPA2 is involved in cancer cell survival, is required for maturation of male gametophytes, and is linked to male infertility. The induction of HSPA6 is a biomarker of cellular stress. HSPA8 participates in the folding and trafficking of client proteins to different subcellular compartments, and in the signal transduction and apoptosis process; it has been shown to protect cardiomyocytes against oxidative stress partly through an interaction with alpha-enolase. S. cerevisiae Ssb1p, is part of the ribosome-associated complex (RAC), it acts as a chaperone for nascent polypeptides, and is important for translation fidelity; Ssb1p is also a [PSI+] prion-curing factor. Length = 376
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family Back     alignment and domain information
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins Back     alignment and domain information
>gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins Back     alignment and domain information
>gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins Back     alignment and domain information
>gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins Back     alignment and domain information
>gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins Back     alignment and domain information
>gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins Back     alignment and domain information
>gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins Back     alignment and domain information
>gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins Back     alignment and domain information
>gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins Back     alignment and domain information
>gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins Back     alignment and domain information
>gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 Back     alignment and domain information
>gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 Back     alignment and domain information
>gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L Back     alignment and domain information
>gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins Back     alignment and domain information
>gnl|CDD|212671 cd10229, HSPA12_like_NBD, Nucleotide-binding domain of HSPA12A, HSPA12B and similar proteins Back     alignment and domain information
>gnl|CDD|212668 cd10225, MreB_like, MreB and similar proteins Back     alignment and domain information
>gnl|CDD|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>gnl|CDD|237564 PRK13930, PRK13930, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein Back     alignment and domain information
>gnl|CDD|212669 cd10227, ParM_like, Plasmid segregation protein ParM and similar proteins Back     alignment and domain information
>gnl|CDD|213718 TIGR02529, EutJ, ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>gnl|CDD|224003 COG1077, MreB, Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237563 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>gnl|CDD|184403 PRK13929, PRK13929, rod-share determining protein MreBH; Provisional Back     alignment and domain information
>gnl|CDD|227157 COG4820, EutJ, Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236954 PRK11678, PRK11678, putative chaperone; Provisional Back     alignment and domain information
>gnl|CDD|223918 COG0849, ftsA, Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237562 PRK13927, PRK13927, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily Back     alignment and domain information
>gnl|CDD|237904 PRK15080, PRK15080, ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>gnl|CDD|198375 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 1; members of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|233354 TIGR01312, XylB, D-xylulose kinase Back     alignment and domain information
>gnl|CDD|212686 cd11736, HSPA12B_like_NBD, Nucleotide-binding domain of HSPA12B and similar proteins Back     alignment and domain information
>gnl|CDD|219497 pfam07649, C1_3, C1-like domain Back     alignment and domain information
>gnl|CDD|216816 pfam01968, Hydantoinase_A, Hydantoinase/oxoprolinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 675
KOG0100663 consensus Molecular chaperones GRP78/BiP/KAR2, HSP 100.0
PTZ00009653 heat shock 70 kDa protein; Provisional 100.0
PTZ00186657 heat shock 70 kDa precursor protein; Provisional 100.0
PTZ00400663 DnaK-type molecular chaperone; Provisional 100.0
PRK13410668 molecular chaperone DnaK; Provisional 100.0
PRK13411653 molecular chaperone DnaK; Provisional 100.0
PRK00290627 dnaK molecular chaperone DnaK; Provisional 100.0
PLN03184673 chloroplast Hsp70; Provisional 100.0
TIGR02350595 prok_dnaK chaperone protein DnaK. Members of this 100.0
CHL00094621 dnaK heat shock protein 70 100.0
TIGR01991599 HscA Fe-S protein assembly chaperone HscA. The Hea 100.0
PRK05183616 hscA chaperone protein HscA; Provisional 100.0
PF00012602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 100.0
KOG0101620 consensus Molecular chaperones HSP70/HSC70, HSP70 100.0
KOG0102640 consensus Molecular chaperones mortalin/PBP74/GRP7 100.0
COG0443579 DnaK Molecular chaperone [Posttranslational modifi 100.0
KOG0103727 consensus Molecular chaperones HSP105/HSP110/SSE1, 100.0
PRK01433595 hscA chaperone protein HscA; Provisional 100.0
KOG0104 902 consensus Molecular chaperones GRP170/SIL1, HSP70 100.0
PRK11678450 putative chaperone; Provisional 100.0
PRK13928336 rod shape-determining protein Mbl; Provisional 100.0
PRK13929335 rod-share determining protein MreBH; Provisional 100.0
PRK13927334 rod shape-determining protein MreB; Provisional 100.0
TIGR00904333 mreB cell shape determining protein, MreB/Mrl fami 100.0
PRK13930335 rod shape-determining protein MreB; Provisional 100.0
PF06723326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 100.0
COG1077342 MreB Actin-like ATPase involved in cell morphogene 99.97
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 99.97
PRK15080267 ethanolamine utilization protein EutJ; Provisional 99.96
PRK09472420 ftsA cell division protein FtsA; Reviewed 99.92
TIGR01174371 ftsA cell division protein FtsA. This bacterial ce 99.92
COG0849418 ftsA Cell division ATPase FtsA [Cell division and 99.9
cd00012371 ACTIN Actin; An ubiquitous protein involved in the 99.72
COG4820277 EutJ Ethanolamine utilization protein, possible ch 99.71
PRK13917344 plasmid segregation protein ParM; Provisional 99.71
smart00268373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 99.69
PTZ00280414 Actin-related protein 3; Provisional 99.65
TIGR03739320 PRTRC_D PRTRC system protein D. A novel genetic sy 99.58
PTZ00004378 actin-2; Provisional 99.57
PF00022393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 99.56
PTZ00452375 actin; Provisional 99.56
TIGR01175348 pilM type IV pilus assembly protein PilM. This pro 99.55
PF11104340 PilM_2: Type IV pilus assembly protein PilM;; PDB: 99.54
PTZ00281376 actin; Provisional 99.51
PTZ00466380 actin-like protein; Provisional 99.49
PF06406318 StbA: StbA protein; InterPro: IPR009440 This entry 99.44
COG4972354 PilM Tfp pilus assembly protein, ATPase PilM [Cell 99.34
KOG0679426 consensus Actin-related protein - Arp4p/Act3p [Cyt 99.24
COG5277444 Actin and related proteins [Cytoskeleton] 99.2
TIGR00241248 CoA_E_activ CoA-substrate-specific enzyme activase 99.06
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s 98.98
PRK10719475 eutA reactivating factor for ethanolamine ammonia 98.92
TIGR03286404 methan_mark_15 putative methanogenesis marker prot 98.83
COG1924396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HS 98.82
KOG0676372 consensus Actin and related proteins [Cytoskeleton 98.73
TIGR02261262 benz_CoA_red_D benzoyl-CoA reductase, bcr type, su 98.72
TIGR02259432 benz_CoA_red_A benzoyl-CoA reductase, bcr type, su 98.67
PF075201002 SrfB: Virulence factor SrfB; InterPro: IPR009216 T 98.62
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 98.51
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 98.49
KOG0677389 consensus Actin-related protein Arp2/3 complex, su 98.49
PF0310730 C1_2: C1 domain; InterPro: IPR004146 This short do 98.45
PF08841332 DDR: Diol dehydratase reactivase ATPase-like domai 98.41
PRK13317277 pantothenate kinase; Provisional 98.39
PF0310730 C1_2: C1 domain; InterPro: IPR004146 This short do 98.13
cd0234043 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre 98.11
PF06277473 EutA: Ethanolamine utilisation protein EutA; Inter 97.95
KOG0680400 consensus Actin-related protein - Arp6p [Cytoskele 97.87
COG44571014 SrfB Uncharacterized protein conserved in bacteria 97.82
PF01869271 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; In 97.7
TIGR00555279 panK_eukar pantothenate kinase, eukaryotic/staphyl 97.69
KOG0797618 consensus Actin-related protein [Cytoskeleton] 97.69
cd0233945 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger pre 97.66
PRK11031496 guanosine pentaphosphate phosphohydrolase; Provisi 97.52
cd0234043 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre 97.42
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 97.26
cd0224946 ZZ Zinc finger, ZZ type. Zinc finger present in dy 97.22
cd0234445 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present 97.17
PF14574412 DUF4445: Domain of unknown function (DUF4445); PDB 97.17
PRK10854513 exopolyphosphatase; Provisional 97.16
cd0234148 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present 97.09
KOG0696 683 consensus Serine/threonine protein kinase [Signal 96.98
cd0234243 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger pre 96.97
COG4819473 EutA Ethanolamine utilization protein, possible ch 96.92
PF02782198 FGGY_C: FGGY family of carbohydrate kinases, C-ter 96.77
PF0013053 C1_1: Phorbol esters/diacylglycerol binding domain 96.72
cd0233849 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger pre 96.63
cd0234549 ZZ_dah Zinc finger, ZZ type. Zinc finger present i 96.61
PF14450120 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B 96.55
PF13941457 MutL: MutL protein 96.53
cd0233449 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger pr 96.52
cd0233549 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present 96.52
cd0224946 ZZ Zinc finger, ZZ type. Zinc finger present in dy 96.52
cd0233945 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger pre 96.5
cd0234148 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present 96.47
TIGR00744318 ROK_glcA_fam ROK family protein (putative glucokin 96.35
KOG0681645 consensus Actin-related protein - Arp5p [Cytoskele 96.25
PF0056946 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc 96.14
cd0234348 ZZ_EF Zinc finger, ZZ type. Zinc finger present in 96.13
smart00842187 FtsA Cell division protein FtsA. FtsA is essential 96.13
TIGR03706300 exo_poly_only exopolyphosphatase. It appears that 96.04
PRK09557301 fructokinase; Reviewed 96.02
COG0248492 GppA Exopolyphosphatase [Nucleotide transport and 96.01
PRK13318258 pantothenate kinase; Reviewed 95.96
TIGR01315541 5C_CHO_kinase FGGY-family pentulose kinase. This m 95.87
PRK15027484 xylulokinase; Provisional 95.85
PLN02669556 xylulokinase 95.84
cd0233549 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present 95.78
smart0029144 ZnF_ZZ Zinc-binding domain, present in Dystrophin, 95.76
KOG0678415 consensus Actin-related protein Arp2/3 complex, su 95.74
cd0233741 ZZ_CBP Zinc finger, ZZ type. Zinc finger present i 95.62
KOG4582278 consensus Uncharacterized conserved protein, conta 95.57
PRK03011358 butyrate kinase; Provisional 95.39
PRK05082291 N-acetylmannosamine kinase; Provisional 95.3
COG1069544 AraB Ribulose kinase [Energy production and conver 95.29
PRK13321256 pantothenate kinase; Reviewed 95.19
smart0029144 ZnF_ZZ Zinc-binding domain, present in Dystrophin, 95.17
PRK04123548 ribulokinase; Provisional 95.16
PRK00047498 glpK glycerol kinase; Provisional 95.13
PTZ00294504 glycerol kinase-like protein; Provisional 95.12
KOG0681645 consensus Actin-related protein - Arp5p [Cytoskele 95.12
PRK00976326 hypothetical protein; Provisional 95.09
PF0013053 C1_1: Phorbol esters/diacylglycerol binding domain 95.07
TIGR01312481 XylB D-xylulose kinase. D-xylulose kinase (XylB) g 94.97
TIGR01234536 L-ribulokinase L-ribulokinase. This enzyme catalyz 94.96
cd0234243 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger pre 94.93
PRK13310303 N-acetyl-D-glucosamine kinase; Provisional 94.9
TIGR01311493 glycerol_kin glycerol kinase. This model describes 94.87
TIGR02628465 fuculo_kin_coli L-fuculokinase. Members of this fa 94.8
PRK10331470 L-fuculokinase; Provisional 94.76
TIGR01314505 gntK_FGGY gluconate kinase, FGGY type. Gluconate i 94.69
KOG1280 381 consensus Uncharacterized conserved protein contai 94.68
cd0002950 C1 Protein kinase C conserved region 1 (C1) . Cyst 94.67
cd0234445 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present 94.57
smart0010949 C1 Protein kinase C conserved region 1 (C1) domain 94.56
KOG2517516 consensus Ribulose kinase and related carbohydrate 94.51
TIGR02627454 rhamnulo_kin rhamnulokinase. This model describes 94.47
PLN02295512 glycerol kinase 94.46
TIGR00671243 baf pantothenate kinase, type III. This model desc 94.45
cd0233849 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger pre 94.34
PF01968290 Hydantoinase_A: Hydantoinase/oxoprolinase; InterPr 94.25
cd0234549 ZZ_dah Zinc finger, ZZ type. Zinc finger present i 94.12
PRK10939520 autoinducer-2 (AI-2) kinase; Provisional 94.08
KOG0954 893 consensus PHD finger protein [General function pre 94.06
COG3426358 Butyrate kinase [Energy production and conversion] 94.03
KOG2531545 consensus Sugar (pentulose and hexulose) kinases [ 93.94
PTZ00288405 glucokinase 1; Provisional 93.88
PF0056946 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc 93.87
PRK10640471 rhaB rhamnulokinase; Provisional 93.81
PRK12408336 glucokinase; Provisional 93.63
COG1521251 Pantothenate kinase type III (Bvg accessory factor 93.46
PF02541285 Ppx-GppA: Ppx/GppA phosphatase family; InterPro: I 93.41
KOG0957 707 consensus PHD finger protein [General function pre 93.37
cd0234348 ZZ_EF Zinc finger, ZZ type. Zinc finger present in 93.26
PRK09585365 anmK anhydro-N-acetylmuramic acid kinase; Reviewed 93.13
PLN02666 1275 5-oxoprolinase 92.86
COG1070502 XylB Sugar (pentulose and hexulose) kinases [Carbo 92.85
cd0233449 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger pr 92.76
cd0233741 ZZ_CBP Zinc finger, ZZ type. Zinc finger present i 92.47
PRK09698302 D-allose kinase; Provisional 92.36
KOG1280 381 consensus Uncharacterized conserved protein contai 92.27
COG1548330 Predicted transcriptional regulator/sugar kinase [ 92.23
cd0002950 C1 Protein kinase C conserved region 1 (C1) . Cyst 91.9
PF07318343 DUF1464: Protein of unknown function (DUF1464); In 91.16
KOG0956 900 consensus PHD finger protein AF10 [General functio 90.91
TIGR03123318 one_C_unchar_1 probable H4MPT-linked C1 transfer p 90.86
PRK00292316 glk glucokinase; Provisional 90.67
smart0010949 C1 Protein kinase C conserved region 1 (C1) domain 90.57
PF03702364 UPF0075: Uncharacterised protein family (UPF0075); 90.26
COG2377371 Predicted molecular chaperone distantly related to 90.13
PRK14878323 UGMP family protein; Provisional 89.97
cd0233645 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present 89.76
PRK09605535 bifunctional UGMP family protein/serine/threonine 89.18
COG4020332 Uncharacterized protein conserved in archaea [Func 88.75
PF14450120 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B 88.73
PRK14101638 bifunctional glucokinase/RpiR family transcription 88.19
KOG1169 634 consensus Diacylglycerol kinase [Lipid transport a 87.71
TIGR00329305 gcp_kae1 metallohydrolase, glycoprotease/Kae1 fami 87.03
PRK09604332 UGMP family protein; Validated 85.76
TIGR03722322 arch_KAE1 universal archaeal protein Kae1. This fa 85.64
PLN02920398 pantothenate kinase 1 85.44
KOG0694 694 consensus Serine/threonine protein kinase [Signal 85.04
KOG2807378 consensus RNA polymerase II transcription initiati 84.82
COG0554499 GlpK Glycerol kinase [Energy production and conver 84.56
KOG0956 900 consensus PHD finger protein AF10 [General functio 84.41
KOG4582278 consensus Uncharacterized conserved protein, conta 84.39
COG2971301 Predicted N-acetylglucosamine kinase [Carbohydrate 84.39
PF08735254 DUF1786: Putative pyruvate format-lyase activating 84.31
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 84.1
KOG1169 634 consensus Diacylglycerol kinase [Lipid transport a 83.75
TIGR03723314 bact_gcp putative glycoprotease GCP. This model re 83.49
TIGR03281326 methan_mark_12 putative methanogenesis marker prot 82.31
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 82.12
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 82.05
COG1940314 NagC Transcriptional regulator/sugar kinase [Trans 81.69
KOG0696 683 consensus Serine/threonine protein kinase [Signal 81.66
COG5141 669 PHD zinc finger-containing protein [General functi 81.13
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 81.08
PTZ00340345 O-sialoglycoprotein endopeptidase-like protein; Pr 80.97
TIGR01319463 glmL_fam conserved hypothetical protein. This smal 80.37
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 80.35
>KOG0100 consensus Molecular chaperones GRP78/BiP/KAR2, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=6e-76  Score=576.16  Aligned_cols=404  Identities=64%  Similarity=0.989  Sum_probs=389.8

Q ss_pred             cEEEEecccccEEEEEEECCeEEEEecCCCCcccceEEEEeCCceeecHHHHHHhhhCcCchhhcchhhhCCCCCChhhh
Q 005824            8 LGIGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKNQLAMNPTNTVFDAKRLIGRRFSDVSVQ   87 (675)
Q Consensus         8 ~viGID~GTt~s~va~~~~g~~~~l~~~~g~~~~PS~v~~~~~~~~~G~~A~~~~~~~~~~~~~~~k~~lg~~~~~~~v~   87 (675)
                      .+||||+||||++++++++|.++++.|.+|+|.+||.|+|.++++++|+.|..+...||++++++.||++|+.++++.++
T Consensus        37 tvigIdLGTTYsCVgV~kNgrvEIiANdQGNRItPSyVaFt~derLiGdAAKNQ~~~NPenTiFD~KRLIGr~~~d~~vq  116 (663)
T KOG0100|consen   37 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDDERLIGDAAKNQLTSNPENTIFDAKRLIGRKFNDKSVQ  116 (663)
T ss_pred             eEEEEecCCceeeEEEEeCCeEEEEecCCCCccccceeeeccchhhhhhHhhcccccCcccceechHHHhCcccCChhhh
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcccCCeEEEeCCCCCceEEEEEc-CceeeeeHHHHHHHHHHHHHHHHHHHhCCCCCcEEEEeCCCCCHHHHHHHHHHH
Q 005824           88 EDIKLWPFKVIAGPNDKPMIAVKYK-GGEKKYAAEDISSMVLAKMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAG  166 (675)
Q Consensus        88 ~~~~~~~~~~~~~~~~~~~~~v~~~-~~~~~~~~~~l~~~~L~~l~~~a~~~~~~~~~~~vitvP~~~~~~~r~~l~~a~  166 (675)
                      ++++.+||+++ +.++++.++++.. +..+.++|+++.+|+|..+++.|+.+++..+.+.|+|||+||++.||++.++|-
T Consensus       117 ~Dik~~Pfkvv-~k~~kp~i~v~v~~g~~K~FtPeEiSaMiL~KMKe~AEayLGkkv~~AVvTvPAYFNDAQrQATKDAG  195 (663)
T KOG0100|consen  117 KDIKFLPFKVV-NKDGKPYIQVKVGGGETKVFTPEEISAMILTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAG  195 (663)
T ss_pred             hhhhcCceEEE-cCCCCccEEEEccCCcccccCHHHHHHHHHHHHHHHHHHHhCCcccceEEecchhcchHHHhhhcccc
Confidence            99999999998 8899999999987 447889999999999999999999999999999999999999999999999999


Q ss_pred             HHcCCceeEeeChhHHHHHHhccccCCCCCceEEEEEeCCCcEEEEEEEEeCCEEEEEEEcCCCCCcHHHHHHHHHHHHH
Q 005824          167 AMAGLNVLKIISEPTAAAIAYGLHRKASSEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFI  246 (675)
Q Consensus       167 ~~Agl~~v~li~Ep~Aaa~~~~~~~~~~~~~~vlvvDiGggT~dvsv~~~~~~~~~~l~~~~~~~~GG~~id~~i~~~l~  246 (675)
                      ..|||+++++|+||+|||++|+++... .+.++||+|+||||||+|++.+.++.|+++++.++..+||.+||+++++++.
T Consensus       196 tIAgLnV~RIiNePTaAAIAYGLDKk~-gEknilVfDLGGGTFDVSlLtIdnGVFeVlaTnGDThLGGEDFD~rvm~~fi  274 (663)
T KOG0100|consen  196 TIAGLNVVRIINEPTAAAIAYGLDKKD-GEKNILVFDLGGGTFDVSLLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFI  274 (663)
T ss_pred             eeccceEEEeecCccHHHHHhcccccC-CcceEEEEEcCCceEEEEEEEEcCceEEEEecCCCcccCccchHHHHHHHHH
Confidence            999999999999999999999998774 6789999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhccCCCCCCHHHHHHHHHHHHHHHHHccCCCceEEEEecccCCceeEEEEeHHHHHHHHHHHHHHHHHHHHHHHH
Q 005824          247 QEFKRKKKKDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFSSVITRARFEELNMDLFRKCIKHVDMCLR  326 (675)
Q Consensus       247 ~~~~~~~~~~~~~~~~~~~~l~~~~e~~K~~ls~~~~~~~~i~~~~~~~~~~~~itr~~~~~~~~~~~~~i~~~i~~~l~  326 (675)
                      +-|+++.+.+++.+.++..+|++++|++|+.||++.+..+.|+++++|.|++..+||..||++-.+++..++..++++|+
T Consensus       275 klykkK~gkDv~kdnkA~~KLrRe~EkAKRaLSsqhq~riEIeS~fdG~DfSEtLtRAkFEElNmDLFr~TlkPv~kvl~  354 (663)
T KOG0100|consen  275 KLYKKKHGKDVRKDNKAVQKLRREVEKAKRALSSQHQVRIEIESLFDGVDFSETLTRAKFEELNMDLFRKTLKPVQKVLE  354 (663)
T ss_pred             HHHhhhcCCccchhhHHHHHHHHHHHHHHhhhccccceEEeeeeccccccccchhhhhHHHHhhhHHHHHhhHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCccEEEEecCCcChHHHHHHHHHhcCCCcccccCCchhhHHhHHHHHHHHHcCCCCCCccceEEEEeccCCCC
Q 005824          327 NGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNINPDEAVAYGAAVQAAVLSGNRSDKVEDTVVLDVNSKYNS  406 (675)
Q Consensus       327 ~~~~~~~~i~~VvLvGG~s~~p~l~~~l~~~~~~~~v~~~~~p~~ava~Gaa~~a~~l~~~~~~~~~~~~~~d~~p~~~~  406 (675)
                      ++++...+|+.|+|+||++|+|.+|+.|++.|.|++.....||++|||.|||.+|..++|.  ....++++.|++|++.|
T Consensus       355 Ds~lkKsdideiVLVGGsTrIPKvQqllk~fF~GKepskGinPdEAVAYGAAVQaGvlsGe--e~t~divLLDv~pLtlG  432 (663)
T KOG0100|consen  355 DSDLKKSDIDEIVLVGGSTRIPKVQQLLKDFFNGKEPSKGINPDEAVAYGAAVQAGVLSGE--EDTGDIVLLDVNPLTLG  432 (663)
T ss_pred             hcCcccccCceEEEecCcccChhHHHHHHHHhCCCCccCCCChHHHHHhhhhhhhcccccc--cCcCcEEEEeeccccce
Confidence            9999999999999999999999999999999999999999999999999999999999995  56789999999999988


Q ss_pred             C---------CCcCCccc
Q 005824          407 S---------LEPKTTTS  415 (675)
Q Consensus       407 ~---------~~~~~~~~  415 (675)
                      .         .+||||..
T Consensus       433 IETvGGVMTklI~RNTvi  450 (663)
T KOG0100|consen  433 IETVGGVMTKLIPRNTVI  450 (663)
T ss_pred             eeeecceeeccccCCccc
Confidence            4         36666553

>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>KOG0101 consensus Molecular chaperones HSP70/HSC70, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0102 consensus Molecular chaperones mortalin/PBP74/GRP75, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0103 consensus Molecular chaperones HSP105/HSP110/SSE1, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>KOG0104 consensus Molecular chaperones GRP170/SIL1, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13917 plasmid segregation protein ParM; Provisional Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>TIGR03739 PRTRC_D PRTRC system protein D Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information
>PTZ00452 actin; Provisional Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM Back     alignment and domain information
>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>PF06406 StbA: StbA protein; InterPro: IPR009440 This entry represents bacterial plasmid segregation proteins ParM and StbA [] Back     alignment and domain information
>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0679 consensus Actin-related protein - Arp4p/Act3p [Cytoskeleton] Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>KOG0676 consensus Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D Back     alignment and domain information
>TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A Back     alignment and domain information
>PF07520 SrfB: Virulence factor SrfB; InterPro: IPR009216 This entry represents proteins of unknown function Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>KOG0677 consensus Actin-related protein Arp2/3 complex, subunit Arp2 [Cytoskeleton] Back     alignment and domain information
>PF03107 C1_2: C1 domain; InterPro: IPR004146 This short domain is rich in cysteines and histidines Back     alignment and domain information
>PF08841 DDR: Diol dehydratase reactivase ATPase-like domain; InterPro: IPR009191 Diol dehydratase (propanediol dehydratase) and glycerol dehydratase undergo concomitant, irreversible inactivation by glycerol during catalysis [, ] Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>PF03107 C1_2: C1 domain; InterPro: IPR004146 This short domain is rich in cysteines and histidines Back     alignment and domain information
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type Back     alignment and domain information
>PF06277 EutA: Ethanolamine utilisation protein EutA; InterPro: IPR009377 Proteins in this entry are EutA ethanolamine utilization proteins, reactivating factors for ethanolamine ammonia lyase, encoded by the ethanolamine utilization eut operon Back     alignment and domain information
>KOG0680 consensus Actin-related protein - Arp6p [Cytoskeleton] Back     alignment and domain information
>COG4457 SrfB Uncharacterized protein conserved in bacteria, putative virulence factor [Function unknown] Back     alignment and domain information
>PF01869 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; InterPro: IPR002731 This domain is found in the BadF (O07462 from SWISSPROT) and BadG (O07463 from SWISSPROT) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis Back     alignment and domain information
>TIGR00555 panK_eukar pantothenate kinase, eukaryotic/staphyloccocal type Back     alignment and domain information
>KOG0797 consensus Actin-related protein [Cytoskeleton] Back     alignment and domain information
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type Back     alignment and domain information
>PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional Back     alignment and domain information
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd02249 ZZ Zinc finger, ZZ type Back     alignment and domain information
>cd02344 ZZ_HERC2 Zinc finger, ZZ type Back     alignment and domain information
>PF14574 DUF4445: Domain of unknown function (DUF4445); PDB: 3ZYY_X Back     alignment and domain information
>PRK10854 exopolyphosphatase; Provisional Back     alignment and domain information
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type Back     alignment and domain information
>COG4819 EutA Ethanolamine utilization protein, possible chaperonin protecting lyase from inhibition [Amino acid transport and metabolism] Back     alignment and domain information
>PF02782 FGGY_C: FGGY family of carbohydrate kinases, C-terminal domain; InterPro: IPR018485 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related Back     alignment and domain information
>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger Back     alignment and domain information
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type Back     alignment and domain information
>cd02345 ZZ_dah Zinc finger, ZZ type Back     alignment and domain information
>PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T Back     alignment and domain information
>PF13941 MutL: MutL protein Back     alignment and domain information
>cd02334 ZZ_dystrophin Zinc finger, ZZ type Back     alignment and domain information
>cd02335 ZZ_ADA2 Zinc finger, ZZ type Back     alignment and domain information
>cd02249 ZZ Zinc finger, ZZ type Back     alignment and domain information
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type Back     alignment and domain information
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type Back     alignment and domain information
>TIGR00744 ROK_glcA_fam ROK family protein (putative glucokinase) Back     alignment and domain information
>KOG0681 consensus Actin-related protein - Arp5p [Cytoskeleton] Back     alignment and domain information
>PF00569 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd02343 ZZ_EF Zinc finger, ZZ type Back     alignment and domain information
>smart00842 FtsA Cell division protein FtsA Back     alignment and domain information
>TIGR03706 exo_poly_only exopolyphosphatase Back     alignment and domain information
>PRK09557 fructokinase; Reviewed Back     alignment and domain information
>COG0248 GppA Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13318 pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase Back     alignment and domain information
>PRK15027 xylulokinase; Provisional Back     alignment and domain information
>PLN02669 xylulokinase Back     alignment and domain information
>cd02335 ZZ_ADA2 Zinc finger, ZZ type Back     alignment and domain information
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein Back     alignment and domain information
>KOG0678 consensus Actin-related protein Arp2/3 complex, subunit Arp3 [Cytoskeleton] Back     alignment and domain information
>cd02337 ZZ_CBP Zinc finger, ZZ type Back     alignment and domain information
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>PRK03011 butyrate kinase; Provisional Back     alignment and domain information
>PRK05082 N-acetylmannosamine kinase; Provisional Back     alignment and domain information
>COG1069 AraB Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>PRK13321 pantothenate kinase; Reviewed Back     alignment and domain information
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>PTZ00294 glycerol kinase-like protein; Provisional Back     alignment and domain information
>KOG0681 consensus Actin-related protein - Arp5p [Cytoskeleton] Back     alignment and domain information
>PRK00976 hypothetical protein; Provisional Back     alignment and domain information
>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger Back     alignment and domain information
>TIGR01312 XylB D-xylulose kinase Back     alignment and domain information
>TIGR01234 L-ribulokinase L-ribulokinase Back     alignment and domain information
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type Back     alignment and domain information
>PRK13310 N-acetyl-D-glucosamine kinase; Provisional Back     alignment and domain information
>TIGR01311 glycerol_kin glycerol kinase Back     alignment and domain information
>TIGR02628 fuculo_kin_coli L-fuculokinase Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>TIGR01314 gntK_FGGY gluconate kinase, FGGY type Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>cd00029 C1 Protein kinase C conserved region 1 (C1) Back     alignment and domain information
>cd02344 ZZ_HERC2 Zinc finger, ZZ type Back     alignment and domain information
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains) Back     alignment and domain information
>KOG2517 consensus Ribulose kinase and related carbohydrate kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02627 rhamnulo_kin rhamnulokinase Back     alignment and domain information
>PLN02295 glycerol kinase Back     alignment and domain information
>TIGR00671 baf pantothenate kinase, type III Back     alignment and domain information
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type Back     alignment and domain information
>PF01968 Hydantoinase_A: Hydantoinase/oxoprolinase; InterPro: IPR002821 This family includes the enzymes hydantoinase and oxoprolinase (3 Back     alignment and domain information
>cd02345 ZZ_dah Zinc finger, ZZ type Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>COG3426 Butyrate kinase [Energy production and conversion] Back     alignment and domain information
>KOG2531 consensus Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00288 glucokinase 1; Provisional Back     alignment and domain information
>PF00569 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK10640 rhaB rhamnulokinase; Provisional Back     alignment and domain information
>PRK12408 glucokinase; Provisional Back     alignment and domain information
>COG1521 Pantothenate kinase type III (Bvg accessory factor family protein) [Transcription] Back     alignment and domain information
>PF02541 Ppx-GppA: Ppx/GppA phosphatase family; InterPro: IPR003695 Exopolyphosphate phosphatase (Ppx) 3 Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>cd02343 ZZ_EF Zinc finger, ZZ type Back     alignment and domain information
>PRK09585 anmK anhydro-N-acetylmuramic acid kinase; Reviewed Back     alignment and domain information
>PLN02666 5-oxoprolinase Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02334 ZZ_dystrophin Zinc finger, ZZ type Back     alignment and domain information
>cd02337 ZZ_CBP Zinc finger, ZZ type Back     alignment and domain information
>PRK09698 D-allose kinase; Provisional Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>COG1548 Predicted transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00029 C1 Protein kinase C conserved region 1 (C1) Back     alignment and domain information
>PF07318 DUF1464: Protein of unknown function (DUF1464); InterPro: IPR009927 This family consists of several hypothetical archaeal proteins of around 350 residues in length Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>TIGR03123 one_C_unchar_1 probable H4MPT-linked C1 transfer pathway protein Back     alignment and domain information
>PRK00292 glk glucokinase; Provisional Back     alignment and domain information
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains) Back     alignment and domain information
>PF03702 UPF0075: Uncharacterised protein family (UPF0075); InterPro: IPR005338 Anhydro-N-acetylmuramic acid kinase catalyzes the specific phosphorylation of 1,6-anhydro-N-acetylmuramic acid (anhMurNAc) with the simultaneous cleavage of the 1,6-anhydro ring, generating MurNAc-6-P Back     alignment and domain information
>COG2377 Predicted molecular chaperone distantly related to HSP70-fold metalloproteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14878 UGMP family protein; Provisional Back     alignment and domain information
>cd02336 ZZ_RSC8 Zinc finger, ZZ type Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>COG4020 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T Back     alignment and domain information
>PRK14101 bifunctional glucokinase/RpiR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG1169 consensus Diacylglycerol kinase [Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00329 gcp_kae1 metallohydrolase, glycoprotease/Kae1 family Back     alignment and domain information
>PRK09604 UGMP family protein; Validated Back     alignment and domain information
>TIGR03722 arch_KAE1 universal archaeal protein Kae1 Back     alignment and domain information
>PLN02920 pantothenate kinase 1 Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0554 GlpK Glycerol kinase [Energy production and conversion] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>COG2971 Predicted N-acetylglucosamine kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08735 DUF1786: Putative pyruvate format-lyase activating enzyme (DUF1786); InterPro: IPR014846 This family is annotated as pyruvate formate-lyase activating enzyme (1 Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>KOG1169 consensus Diacylglycerol kinase [Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03723 bact_gcp putative glycoprotease GCP Back     alignment and domain information
>TIGR03281 methan_mark_12 putative methanogenesis marker protein 12 Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG1940 NagC Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00340 O-sialoglycoprotein endopeptidase-like protein; Provisional Back     alignment and domain information
>TIGR01319 glmL_fam conserved hypothetical protein Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query675
1yuw_A554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 1e-164
3c7n_B554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 1e-164
2v7z_A543 Crystal Structure Of The 70-Kda Heat Shock Cognate 1e-163
2qw9_B394 Crystal Structure Of Bovine Hsc70 (1-394aa)in The A 1e-162
2qwn_A394 Crystal Structure Of Disulfide-Bond-Crosslinked Com 1e-161
1hpm_A386 How Potassium Affects The Activity Of The Molecular 1e-160
1ngb_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-160
1bup_A386 T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot 1e-160
1atr_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 1e-160
1ngd_A386 Structural Basis Of The 70-kilodalton Heat Shock Co 1e-160
1ngf_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-160
1ngh_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-160
1ngg_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-160
1ngc_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-160
1nge_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-160
1nga_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-159
1ba0_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 1e-159
1ats_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 1e-159
1ba1_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 1e-159
1hx1_A400 Crystal Structure Of A Bag Domain In Complex With T 1e-159
3cqx_A386 Chaperone Complex Length = 386 1e-159
3fzf_A381 Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP 1e-158
1kaz_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71e 1e-158
1kay_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71a 1e-158
1kax_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71m 1e-158
2bup_A381 T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 1e-158
1qqo_A378 E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-158
1qqm_A378 D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-156
2e8a_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 1e-156
2e88_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 1e-156
3a8y_A392 Crystal Structure Of The Complex Between The Bag5 B 1e-156
3jxu_A409 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-156
1qqn_A378 D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-156
3d2f_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 1e-155
1hjo_A380 Atpase Domain Of Human Heat Shock 70kda Protein 1 L 1e-155
1s3x_A382 The Crystal Structure Of The Human Hsp70 Atpase Dom 1e-155
3i33_A404 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-154
3gdq_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-154
3fe1_A403 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-153
3d2e_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70, 1e-153
3kvg_A400 Crystal Structure Of The N-Terminal Domain Of Hsp70 1e-151
4fsv_A387 Crystal Structure Of A Heat Shock 70kda Protein 2 ( 1e-150
3iuc_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-135
3ldl_A384 Crystal Structure Of Human Grp78 (70kda Heat Shock 1e-135
3gl1_A387 Crystal Structure Of Atpase Domain Of Ssb1 Chaperon 1e-134
3qfp_A390 Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D 1e-126
3qfu_A394 Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE 1e-126
2kho_A605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 5e-93
1dkg_D383 Crystal Structure Of The Nucleotide Exchange Factor 9e-91
4b9q_A605 Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L 7e-90
2v7y_A509 Crystal Structure Of The Molecular Chaperone Dnak F 5e-82
1xqs_C191 Crystal Structure Of The Hspbp1 Core Domain Complex 8e-74
3c7n_A668 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 5e-58
2qxl_A658 Crystal Structure Analysis Of Sse1, A Yeast Hsp110 5e-58
3d2f_A675 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 7e-58
3d2e_A675 Crystal Structure Of A Complex Of Sse1p And Hsp70, 1e-56
4gni_A409 Structure Of The Ssz1 Atpase Bound To Atp And Magne 1e-44
1jcf_A344 Mreb From Thermotoga Maritima, Trigonal Length = 34 8e-08
1jce_A344 Mreb From Thermotoga Maritima Length = 344 2e-07
>pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure 
Iteration: 1

 Score =  576 bits (1484), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 276/394 (70%), Positives = 325/394 (82%), Gaps = 5/394 (1%)
Query: 9   GIGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKNQLAMNPTN 68
            +GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFT  ER  G+AAKNQ+AMNPTN
Sbjct: 6   AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTN 65
Query: 69  TVFDAKRLIGRRFSDVSVQEDIKLWPFKVIAGPND--KPMIAVKYKGGEKKYAAEDISSM 126
           TVFDAKRLIGRRF D  VQ D+K WPF V+   ND  +P + V+YKG  K +  E++SSM
Sbjct: 66  TVFDAKRLIGRRFDDAVVQSDMKHWPFMVV---NDAGRPKVQVEYKGETKSFYPEEVSSM 122
Query: 127 VLAKMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEPTAAAIA 186
           VL KM+EIA+AYLG  V NAVVTVPAYF DSQRQATKDAG +AGLNVL+II+EPTAAAIA
Sbjct: 123 VLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIA 182
Query: 187 YGLHRKASSEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFI 246
           YGL +K  +E+NVLIFDLGGGTFDVS+LTI  GIF+VK+TAGDTHLGGEDFDNRMVNHFI
Sbjct: 183 YGLDKKVGAERNVLIFDLGGGTFDVSILTIAAGIFEVKSTAGDTHLGGEDFDNRMVNHFI 242
Query: 247 QEFKRKKKKDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFSSVITRARF 306
            EFKRK KKDIS + RAV+RL TACERAKRTLSS++Q +IEIDSLYEGIDF + ITRARF
Sbjct: 243 AEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARF 302
Query: 307 EELNMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQN 366
           EELN DLFR  +  V+  LR+ K+DKS++ D+V+VGGS RIPK+Q+LLQ+FFNGK L ++
Sbjct: 303 EELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKS 362
Query: 367 INPDEXXXXXXXXXXXXLSGNRSDKVEDTVVLDV 400
           INPDE            LSG++S+ V+D ++LDV
Sbjct: 363 INPDEAVAYGAAVQAAILSGDKSENVQDLLLLDV 396
>pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure
>pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 Back     alignment and structure
>pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 Back     alignment and structure
>pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 Back     alignment and structure
>pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 Back     alignment and structure
>pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 Back     alignment and structure
>pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 Back     alignment and structure
>pdb|3CQX|A Chain A, Chaperone Complex Length = 386 Back     alignment and structure
>pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 Back     alignment and structure
>pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 Back     alignment and structure
>pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 Back     alignment and structure
>pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 Back     alignment and structure
>pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 Back     alignment and structure
>pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 Back     alignment and structure
>pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 Back     alignment and structure
>pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 Back     alignment and structure
>pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 Back     alignment and structure
>pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 Back     alignment and structure
>pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 Back     alignment and structure
>pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 Back     alignment and structure
>pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 Back     alignment and structure
>pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 Back     alignment and structure
>pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 Back     alignment and structure
>pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 Back     alignment and structure
>pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 Back     alignment and structure
>pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 Back     alignment and structure
>pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure
>pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure
>pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 Back     alignment and structure
>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 Back     alignment and structure
>pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure
>pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 Back     alignment and structure
>pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure
>pdb|1XQS|C Chain C, Crystal Structure Of The Hspbp1 Core Domain Complexed With The Fragment Of Hsp70 Atpase Domain Length = 191 Back     alignment and structure
>pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 Back     alignment and structure
>pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 Back     alignment and structure
>pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 Back     alignment and structure
>pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 Back     alignment and structure
>pdb|4GNI|A Chain A, Structure Of The Ssz1 Atpase Bound To Atp And Magnesium Length = 409 Back     alignment and structure
>pdb|1JCF|A Chain A, Mreb From Thermotoga Maritima, Trigonal Length = 344 Back     alignment and structure
>pdb|1JCE|A Chain A, Mreb From Thermotoga Maritima Length = 344 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query675
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 0.0
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 0.0
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 0.0
3d2f_A675 Heat shock protein homolog SSE1; nucleotide exchan 0.0
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 1e-178
2kho_A605 Heat shock protein 70; molecular chaperone, HSP70, 1e-175
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 1e-159
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 4e-33
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 3e-26
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 3e-26
3js6_A355 Uncharacterized PARM protein; partition, segregati 1e-16
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 3e-14
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 7e-13
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 1e-08
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 7e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 2e-07
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 1e-06
2row_A84 RHO-associated protein kinase 2; ATP-binding, coil 9e-06
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 1e-04
1y8f_A66 UNC-13 homolog A, MUNC13-1; cysteine-rich domain, 4e-04
3cxl_A463 N-chimerin; SH2, RHO-GAP, structural genomics cons 4e-04
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Back     alignment and structure
 Score =  831 bits (2148), Expect = 0.0
 Identities = 285/392 (72%), Positives = 335/392 (85%), Gaps = 1/392 (0%)

Query: 10  IGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKNQLAMNPTNT 69
           +GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFT  ER  G+AAKNQ+AMNPTNT
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNT 66

Query: 70  VFDAKRLIGRRFSDVSVQEDIKLWPFKVIAGPNDKPMIAVKYKGGEKKYAAEDISSMVLA 129
           VFDAKRLIGRRF D  VQ D+K WPF V+     +P + V+YKG  K +  E++SSMVL 
Sbjct: 67  VFDAKRLIGRRFDDAVVQSDMKHWPFMVVND-AGRPKVQVEYKGETKSFYPEEVSSMVLT 125

Query: 130 KMREIAKAYLGSNVKNAVVTVPAYFTDSQRQATKDAGAMAGLNVLKIISEPTAAAIAYGL 189
           KM+EIA+AYLG  V NAVVTVPAYF DSQRQATKDAG +AGLNVL+II+EPTAAAIAYGL
Sbjct: 126 KMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGL 185

Query: 190 HRKASSEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFIQEF 249
            +K  +E+NVLIFDLGGGTFDVS+LTI  GIF+VK+TAGDTHLGGEDFDNRMVNHFI EF
Sbjct: 186 DKKVGAERNVLIFDLGGGTFDVSILTIAAGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEF 245

Query: 250 KRKKKKDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFSSVITRARFEEL 309
           KRK KKDIS + RAV+RL TACERAKRTLSS++Q +IEIDSLYEGIDF + ITRARFEEL
Sbjct: 246 KRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEEL 305

Query: 310 NMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNINP 369
           N DLFR  +  V+  LR+ K+DKS++ D+V+VGGS RIPK+Q+LLQ+FFNGK L ++INP
Sbjct: 306 NADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINP 365

Query: 370 DEAVAYGAAVQAAVLSGNRSDKVEDTVVLDVN 401
           DEAVAYGAAVQAA+LSG++S+ V+D ++LDV 
Sbjct: 366 DEAVAYGAAVQAAILSGDKSENVQDLLLLDVT 397
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Length = 272 Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Length = 346 Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Length = 320 Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Length = 355 Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Length = 329 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Length = 377 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Length = 419 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Length = 344 Back     alignment and structure
>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 84 Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Length = 515 Back     alignment and structure
>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Length = 66 Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query675
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 100.0
3d2f_A675 Heat shock protein homolog SSE1; nucleotide exchan 100.0
4b9q_A605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 100.0
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 100.0
2kho_A605 Heat shock protein 70; molecular chaperone, HSP70, 100.0
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 100.0
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 100.0
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 100.0
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 100.0
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 100.0
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 99.94
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 99.94
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 99.94
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 99.94
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 99.93
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 99.92
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 99.86
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 99.82
3js6_A355 Uncharacterized PARM protein; partition, segregati 99.76
4ehu_A276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 99.72
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 99.69
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 99.67
3qb0_A498 Actin-related protein 4; actin fold, ATP binding, 99.62
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 99.56
4fo0_A593 Actin-related protein 8; chromatin remodeling, nuc 99.49
2d0o_A610 DIOL dehydratase-reactivating factor large subunit 99.41
1nbw_A607 Glycerol dehydratase reactivase alpha subunit; mol 99.4
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 99.37
1hux_A270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 98.94
2ews_A287 Pantothenate kinase; PANK, structural genomics, st 98.52
4am6_A655 Actin-like protein ARP8; nuclear protein, chromati 97.91
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 97.67
3mdq_A315 Exopolyphosphatase; structural genomics, joint cen 97.49
2ivn_A330 O-sialoglycoprotein endopeptidase; UP1 keops compl 97.44
1t6c_A315 Exopolyphosphatase; alpha/beta protein, actin-like 97.41
4db3_A327 Glcnac kinase, N-acetyl-D-glucosamine kinase; stru 97.27
3vgl_A321 Glucokinase; ROK family, transferase; HET: BGC ANP 97.22
2i7n_A360 Pantothenate kinase 1; PANK, transferase; HET: ACO 97.2
3vov_A302 Glucokinase, hexokinase; ROK, sugar kinase, transf 97.16
2e2o_A299 Hexokinase; acetate and sugar kinases, HSP70, acti 97.11
3r8e_A321 Hypothetical sugar kinase; ribonuclease H-like mot 97.1
4htl_A297 Beta-glucoside kinase; structural genomics, sugar 97.05
2ch5_A347 NAGK protein; transferase, N-acetylglucosamine, gl 97.0
2fc7_A82 ZZZ3 protein; structure genomics, ZZ domain, struc 97.0
2fnf_X72 Putative RAS effector NORE1; zinc, signal transduc 96.97
3uej_A65 NPKC-delta, protein kinase C delta type; proteine 96.93
2enz_A65 NPKC-theta, protein kinase C theta type; zinc bind 96.93
3cer_A343 Possible exopolyphosphatase-like protein; NESG, BL 96.92
1u6z_A513 Exopolyphosphatase; alpha/beta protein, askha (ace 96.86
2db6_A74 SH3 and cysteine rich domain 3; STAC3, C1 domain, 96.84
2row_A84 RHO-associated protein kinase 2; ATP-binding, coil 96.8
2yuu_A83 NPKC-delta, protein kinase C delta type; metal bin 96.78
2dip_A98 Zinc finger SWIM domain-containing protein 2; ZZ d 96.77
1ptq_A50 Protein kinase C delta type; phosphotransferase; 1 96.77
1y8f_A66 UNC-13 homolog A, MUNC13-1; cysteine-rich domain, 96.76
2enn_A77 NPKC-theta, protein kinase C theta type; zinc bind 96.74
2gup_A292 ROK family protein; sugar kinase, streptococcus pn 96.72
2eli_A85 Protein kinase C alpha type; PKC-alpha, PKC-A, str 96.63
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 96.62
2qm1_A326 Glucokinase; alpha-beta structure, putative helix- 96.53
2ap1_A327 Putative regulator protein; zinc binding protein, 96.43
2e5r_A63 Dystrobrevin alpha; ZZ domain, structural genomics 96.41
1kbe_A49 Kinase suppressor of RAS; KSR, cysteine-rich domai 96.33
3l0q_A554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 96.19
1faq_A52 RAF-1; transferase, serine/threonine-protein kinas 96.12
1tot_A52 CREB-binding protein; zinc binding, CBP, TAZ2, tra 96.11
2aa4_A289 Mannac kinase, putative N-acetylmannosamine kinase 96.05
4bc3_A538 Xylulose kinase; transferase, glucuronate xyluloki 96.04
2itm_A484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 96.0
1z6r_A406 MLC protein; transcriptional repressor, ROK family 95.98
3ll3_A504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 95.91
2zf5_O497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 95.86
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 95.84
1rfh_A59 RAS association (ralgds/AF-6) domain family 5; zin 95.81
3hz6_A511 Xylulokinase; xylulose, structural genomic, chromo 95.8
1z05_A429 Transcriptional regulator, ROK family; structural 95.76
1kbe_A49 Kinase suppressor of RAS; KSR, cysteine-rich domai 95.59
3zyy_X631 Iron-sulfur cluster binding protein; iron-sulfur-b 95.58
2dip_A98 Zinc finger SWIM domain-containing protein 2; ZZ d 95.52
3g25_A501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 95.51
2hoe_A380 N-acetylglucosamine kinase; TM1224, structural gen 95.49
3jvp_A572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 95.44
2yhw_A343 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N 95.34
3h3n_X506 Glycerol kinase; ATP-binding, glycerol metabolism, 95.26
3ifr_A508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 95.26
2p3r_A510 Glycerol kinase; glycerol metabolism, allosteric r 95.24
4e1j_A520 Glycerol kinase; structural genomics, PSI-biology, 95.24
2dpn_A495 Glycerol kinase; thermus thermophilus HB8, structu 95.19
3ezw_A526 Glycerol kinase; glycerol metabolism, allosteric r 95.17
2d4w_A504 Glycerol kinase; alpha and beta protein, ribonucle 94.87
3eno_A334 Putative O-sialoglycoprotein endopeptidase; hydrol 94.86
2w40_A503 Glycerol kinase, putative; closed conformation, ma 94.66
1sz2_A332 Glucokinase, glucose kinase; ATP-dependent, glucos 94.65
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 94.65
1zc6_A305 Probable N-acetylglucosamine kinase; NESG, Q7NU07_ 94.56
1zbs_A291 Hypothetical protein PG1100; alpha-beta protein., 94.51
3htv_A310 D-allose kinase, allokinase; NP_418508.1, structur 94.46
2e5r_A63 Dystrobrevin alpha; ZZ domain, structural genomics 94.45
2h3g_X268 Biosynthetic protein; pantothenate kinase, anthrax 94.39
2fc7_A82 ZZZ3 protein; structure genomics, ZZ domain, struc 94.27
2uyt_A489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 94.11
4b6d_A61 RAC GTPase-activating protein 1; signaling protein 93.78
2eli_A85 Protein kinase C alpha type; PKC-alpha, PKC-A, str 93.15
2yuu_A83 NPKC-delta, protein kinase C delta type; metal bin 92.99
2enz_A65 NPKC-theta, protein kinase C theta type; zinc bind 92.86
3djc_A266 Type III pantothenate kinase; structural genomics, 92.84
3cet_A334 Conserved archaeal protein; Q6M145, MRR63, NESG, X 92.54
3uej_A65 NPKC-delta, protein kinase C delta type; proteine 92.47
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 92.36
2db6_A74 SH3 and cysteine rich domain 3; STAC3, C1 domain, 92.1
4b6d_A61 RAC GTPase-activating protein 1; signaling protein 92.09
1faq_A52 RAF-1; transferase, serine/threonine-protein kinas 92.01
1ptq_A50 Protein kinase C delta type; phosphotransferase; 1 91.95
2fnf_X72 Putative RAS effector NORE1; zinc, signal transduc 91.93
1tot_A52 CREB-binding protein; zinc binding, CBP, TAZ2, tra 91.86
2enn_A77 NPKC-theta, protein kinase C theta type; zinc bind 91.56
3bex_A249 Type III pantothenate kinase; actin-like fold, ATP 91.42
1y8f_A66 UNC-13 homolog A, MUNC13-1; cysteine-rich domain, 91.41
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 91.37
3hi0_A508 Putative exopolyphosphatase; 17739545, structural 91.04
2row_A84 RHO-associated protein kinase 2; ATP-binding, coil 91.02
1rfh_A59 RAS association (ralgds/AF-6) domain family 5; zin 90.94
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 90.66
3h6e_A482 Carbohydrate kinase, FGGY; novosphingobium aromati 90.66
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 90.62
1r79_A84 Diacylglycerol kinase, delta; C1 domain, cystein-r 90.16
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 89.3
3mcp_A366 Glucokinase; structural genomics, joint center for 88.62
3qbx_A371 Anhydro-N-acetylmuramic acid kinase; acetate and s 88.24
1woq_A267 Inorganic polyphosphate/ATP-glucomannokinase; tran 86.79
3o8m_A485 Hexokinase; rnaseh-like fold, glycolysis, glucose 86.07
2yhx_A457 Hexokinase B; transferase(phosphoryl,alcohol accep 86.03
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 85.51
3ven_A576 O-carbamoyltransferase TOBZ; antibiotic biosynthes 85.24
3cxl_A463 N-chimerin; SH2, RHO-GAP, structural genomics cons 85.05
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 84.95
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 84.12
3cqy_A370 Anhydro-N-acetylmuramic acid kinase; APC7501, SO_1 83.57
3epq_A302 Putative fructokinase; SCRK, ADP binding, PSI2, MC 82.47
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 80.02
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
Probab=100.00  E-value=6.3e-64  Score=558.62  Aligned_cols=404  Identities=71%  Similarity=1.088  Sum_probs=379.3

Q ss_pred             CCcCCCCcEEEEecccccEEEEEEECCeEEEEecCCCCcccceEEEEeCCceeecHHHHHHhhhCcCchhhcchhhhCCC
Q 005824            1 MARKEGVLGIGIDLGTTYSCVGVWQHNRVEIIANDQGNRTTPSYVAFTKKERFAGNAAKNQLAMNPTNTVFDAKRLIGRR   80 (675)
Q Consensus         1 M~~~~~~~viGID~GTt~s~va~~~~g~~~~l~~~~g~~~~PS~v~~~~~~~~~G~~A~~~~~~~~~~~~~~~k~~lg~~   80 (675)
                      |+|.   .+||||||||||++|++.+|.++++.+++|++++||+|+|.++++++|..|..+...+|+++++++|+|+|+.
T Consensus         1 M~m~---~~iGIDlGTt~s~va~~~~g~~~ii~n~~g~~~~PS~V~~~~~~~~vG~~A~~~~~~~p~~ti~~~KrllG~~   77 (554)
T 1yuw_A            1 MSKG---PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRR   77 (554)
T ss_dssp             CCSC---CCEEEEECSSEEEEEEECSSSEEECCCTTSCSEEECCEEECSSCEEETHHHHTTTTTCGGGEECCGGGTTTCC
T ss_pred             CCCC---CEEEEEeCcccEEEEEEECCEEEEEECCCCCeecceEEEEcCCcEEEcHHHHHhhhhChhhehHhhHHhcCCC
Confidence            7775   5799999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChhhhhhcccCCeEEEeCCCCCceEEEEEcCceeeeeHHHHHHHHHHHHHHHHHHHhCCCCCcEEEEeCCCCCHHHHH
Q 005824           81 FSDVSVQEDIKLWPFKVIAGPNDKPMIAVKYKGGEKKYAAEDISSMVLAKMREIAKAYLGSNVKNAVVTVPAYFTDSQRQ  160 (675)
Q Consensus        81 ~~~~~v~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~l~~~~L~~l~~~a~~~~~~~~~~~vitvP~~~~~~~r~  160 (675)
                      ++++.++..++.+||.+. +.++.+.+.+.+.+....++++++++++|++|++.++.+++.++.++|||||++|++.||+
T Consensus        78 ~~d~~v~~~~~~~p~~v~-~~~g~~~~~v~~~~~~~~~sp~ei~a~~L~~lk~~ae~~lg~~v~~~VitVPa~f~~~qr~  156 (554)
T 1yuw_A           78 FDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQ  156 (554)
T ss_dssp             SSCSHHHHHHTTCSSEEE-EETTEEEEEEEETTEEEEECHHHHHHHHHHHHHHHHHHHHSSCCCEEEEEECTTCCHHHHH
T ss_pred             CCcHHHHHHhhcCCeEEE-ecCCceEEEEEECCCceEEcHHHHHHHHHHHHHHHHHHHhCCCCCeEEEEECCCCCHHHHH
Confidence            999889998999999988 4578888888888878899999999999999999999999988999999999999999999


Q ss_pred             HHHHHHHHcCCceeEeeChhHHHHHHhccccCCCCCceEEEEEeCCCcEEEEEEEEeCCEEEEEEEcCCCCCcHHHHHHH
Q 005824          161 ATKDAGAMAGLNVLKIISEPTAAAIAYGLHRKASSEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNR  240 (675)
Q Consensus       161 ~l~~a~~~Agl~~v~li~Ep~Aaa~~~~~~~~~~~~~~vlvvDiGggT~dvsv~~~~~~~~~~l~~~~~~~~GG~~id~~  240 (675)
                      ++++|++.||++.+.+++||+|||++|+.+.....+..++|||+||||||++++++.++.++++++.++..+||++||+.
T Consensus       157 a~~~A~~~AGl~~~~li~EP~AAAlay~~~~~~~~~~~vlV~D~GgGT~Dvsv~~~~~g~~~v~a~~g~~~lGG~d~d~~  236 (554)
T 1yuw_A          157 ATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIAAGIFEVKSTAGDTHLGGEDFDNR  236 (554)
T ss_dssp             HHHHHHHTTTCEEEEEEEHHHHHHHHTTCSTTCSSCEEEEEEEECSSCEEEEEEEEETTEEEEEEEEEETTCSHHHHHHH
T ss_pred             HHHHHHHHcCCCeEEEeCcHHHHHHHHHhhccCCCCcEEEEEEcCCCeEEEEEEEEcCCcEEEEEEeCCCCCCHHHHHHH
Confidence            99999999999999999999999999988765445789999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhccCCCCCCHHHHHHHHHHHHHHHHHccCCCceEEEEecccCCceeEEEEeHHHHHHHHHHHHHHHHHH
Q 005824          241 MVNHFIQEFKRKKKKDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFSSVITRARFEELNMDLFRKCIKH  320 (675)
Q Consensus       241 i~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~e~~K~~ls~~~~~~~~i~~~~~~~~~~~~itr~~~~~~~~~~~~~i~~~  320 (675)
                      |++++.++|.++++.++..+++.+.+|+.+||++|+.|+......+.++.+.+|.++...|+|++|+++++++++++.+.
T Consensus       237 l~~~l~~~~~~~~~~~~~~~~~~~~~l~~~aE~~K~~ls~~~~~~i~i~~~~~g~~~~~~ltr~~~e~l~~~~~~~i~~~  316 (554)
T 1yuw_A          237 MVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDP  316 (554)
T ss_dssp             HHHHHHHHHHHHTSCCTTSCHHHHHHHHHHHHHHHHHHTTSSEEEEEETTCSSSCCEEEEEEHHHHHHHTHHHHHHTTHH
T ss_pred             HHHHHHHHHHHHhCCCcccCHHHHHHHHHHHHHHhhhcccCceEEEEEeeccCCceEEEEEEHHHHHHHHHHHHHHHHHH
Confidence            99999999999998888889999999999999999999999989999988888888999999999999999999999999


Q ss_pred             HHHHHHcCCCCCCCccEEEEecCCcChHHHHHHHHHhcCCCcccccCCchhhHHhHHHHHHHHHcCCCCCCccceEEEEe
Q 005824          321 VDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNINPDEAVAYGAAVQAAVLSGNRSDKVEDTVVLDV  400 (675)
Q Consensus       321 i~~~l~~~~~~~~~i~~VvLvGG~s~~p~l~~~l~~~~~~~~v~~~~~p~~ava~Gaa~~a~~l~~~~~~~~~~~~~~d~  400 (675)
                      ++++|+++++...+++.|+|+||+|++|+|++.|++.|++.++..+.||++|||.||+++++.++++..++++++.+.|+
T Consensus       317 i~~~L~~a~~~~~~i~~VvLvGG~srip~v~~~l~~~f~~~~v~~~~np~~aVA~Gaa~~a~~l~~~~~~~~~~~~~~dv  396 (554)
T 1yuw_A          317 VEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDV  396 (554)
T ss_dssp             HHHHHHHTTCCGGGCCEEEEESGGGGCHHHHHHHHHHTTTCCCBCCSCTTTHHHHHHHHHHHHTTSCCCCCTTSSCCCCB
T ss_pred             HHHHHHHcCCChhhCcEEEEECCcccChHHHHHHHHHcCCCccccCCCchhHHHHHHHHHHHHhcCCccccccceEEEEe
Confidence            99999999988889999999999999999999999999778888899999999999999999999876667889999999


Q ss_pred             ccCCCCCC
Q 005824          401 NSKYNSSL  408 (675)
Q Consensus       401 ~p~~~~~~  408 (675)
                      +|+++|..
T Consensus       397 ~p~slgi~  404 (554)
T 1yuw_A          397 TPLSLGIE  404 (554)
T ss_dssp             CSSCEEEE
T ss_pred             eeeEEEEE
Confidence            99998854
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A Back     alignment and structure
>1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 Back     alignment and structure
>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii} Back     alignment and structure
>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* Back     alignment and structure
>4db3_A Glcnac kinase, N-acetyl-D-glucosamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; 1.95A {Vibrio vulnificus} Back     alignment and structure
>3vgl_A Glucokinase; ROK family, transferase; HET: BGC ANP; 1.55A {Streptomyces griseus} PDB: 3vgk_A* 3vgm_A* Back     alignment and structure
>2i7n_A Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.90A {Homo sapiens} SCOP: c.55.1.14 c.55.1.14 PDB: 3smp_A* 3sms_A* 2i7p_A* 3mk6_A* Back     alignment and structure
>3vov_A Glucokinase, hexokinase; ROK, sugar kinase, transferase; 2.02A {Thermus thermophilus} Back     alignment and structure
>2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuc fold, sugar kinase, glucose, phosphoryl transfer, transferase; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Back     alignment and structure
>3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>4htl_A Beta-glucoside kinase; structural genomics, sugar kinase, ROK family, PSI-biology, center for structural genomics, MCSG, transferase; HET: MSE; 1.64A {Listeria monocytogenes} Back     alignment and structure
>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, RIBO H fold, sugar kinase/HSP70/actin superfamily, domain rotati conformation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* Back     alignment and structure
>2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} Back     alignment and structure
>3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A* Back     alignment and structure
>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3cer_A Possible exopolyphosphatase-like protein; NESG, BLR13, Q8G5J2, X-RAY, structure, structural genomics, PSI-2; 2.40A {Bifidobacterium longum NCC2705} Back     alignment and structure
>1u6z_A Exopolyphosphatase; alpha/beta protein, askha (acetate and sugar kinases, HSC70, superfamily; 1.90A {Escherichia coli} SCOP: a.211.1.5 c.55.1.8 c.55.1.8 PDB: 2flo_A* Back     alignment and structure
>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* Back     alignment and structure
>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Back     alignment and structure
>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2gup_A ROK family protein; sugar kinase, streptococcus pneumoniae TIGR4, AP sucrose, structural genomics, PSI; HET: SUC; 2.01A {Streptococcus pneumoniae} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis} Back     alignment and structure
>2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A Back     alignment and structure
>1tot_A CREB-binding protein; zinc binding, CBP, TAZ2, transferase; NMR {Mus musculus} SCOP: g.44.1.6 Back     alignment and structure
>2aa4_A Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Back     alignment and structure
>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>2yhw_A Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; transferase, sialic acid, mannac, ROK family; HET: BM3 2PE; 1.64A {Homo sapiens} PDB: 2yhy_A* 2yi1_A* 3eo3_A Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Back     alignment and structure
>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Back     alignment and structure
>1sz2_A Glucokinase, glucose kinase; ATP-dependent, glucose binding, transferase; HET: MSE BGC; 2.20A {Escherichia coli} SCOP: c.55.1.7 PDB: 1q18_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zc6_A Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, struc genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>1zbs_A Hypothetical protein PG1100; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.30A {Porphyromonas gingivalis} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>3htv_A D-allose kinase, allokinase; NP_418508.1, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Escherichia coli k-12} Back     alignment and structure
>2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2h3g_X Biosynthetic protein; pantothenate kinase, anthrax, type III pantothenate kinase, COAX, COAA, askha; 2.00A {Bacillus anthracis str} Back     alignment and structure
>2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Back     alignment and structure
>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens} Back     alignment and structure
>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3djc_A Type III pantothenate kinase; structural genomics, putative transfera 2, protein structure initiative; 2.40A {Legionella pneumophila subsp} Back     alignment and structure
>3cet_A Conserved archaeal protein; Q6M145, MRR63, NESG, XRAY, structure, structural genomics, PSI-2, protein structure initiative; 1.80A {Methanococcus maripaludis S2} PDB: 3c0b_A Back     alignment and structure
>3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens} Back     alignment and structure
>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A Back     alignment and structure
>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* Back     alignment and structure
>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} Back     alignment and structure
>1tot_A CREB-binding protein; zinc binding, CBP, TAZ2, transferase; NMR {Mus musculus} SCOP: g.44.1.6 Back     alignment and structure
>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3bex_A Type III pantothenate kinase; actin-like fold, ATP-binding, coenzyme A biosynthesis, cytoplasm, metal-binding, nucleotide-binding, potassium; HET: PAU; 1.51A {Thermotoga maritima} SCOP: c.55.1.13 c.55.1.13 PDB: 3bf1_A* 3bf3_A* 2gtd_A Back     alignment and structure
>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3hi0_A Putative exopolyphosphatase; 17739545, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1r79_A Diacylglycerol kinase, delta; C1 domain, cystein-rich zinc binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: g.49.1.1 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3mcp_A Glucokinase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, transferase; 3.00A {Parabacteroides distasonis} Back     alignment and structure
>3qbx_A Anhydro-N-acetylmuramic acid kinase; acetate and sugar kinases, HSP70, actin superfamily, anhydro-N-actetylmuramic acid binding; HET: AH0; 2.10A {Pseudomonas aeruginosa} PDB: 3qbw_A* Back     alignment and structure
>1woq_A Inorganic polyphosphate/ATP-glucomannokinase; transferase; HET: BGC; 1.80A {Arthrobacter SP} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* Back     alignment and structure
>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3ven_A O-carbamoyltransferase TOBZ; antibiotic biosynthesis, substrate assisted catalysis, subst channeling, adenylation; HET: TLA; 1.57A {Streptoalloteichus tenebrarius} PDB: 3veo_A 3ves_A* 3vet_A* 3vew_A* 3ver_A* 3vf4_A* 3vf2_A* 3vex_A* 3vez_A* Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3cqy_A Anhydro-N-acetylmuramic acid kinase; APC7501, SO_1313, structural genomics, PSI-2, shewanella one MR-1, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 675
d1bupa2193 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATP 1e-83
d1bupa1185 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas 4e-81
d1dkgd2198 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATP 4e-81
d1dkgd1183 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas 3e-78
d1jcea2196 c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre 2e-30
d1jcea1137 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB 3e-27
d2zgya2163 c.55.1.1 (A:158-320) Plasmid segregation protein P 5e-24
d2fsja1161 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 1e-22
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 9e-11
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 3e-06
d1e4ft2191 c.55.1.1 (T:200-390) Cell division protein FtsA {T 3e-08
d1huxa_259 c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase comp 9e-05
d1xa6a362 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain 0.003
d1faqa_52 g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 0.003
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 193 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  259 bits (664), Expect = 1e-83
 Identities = 144/191 (75%), Positives = 169/191 (88%)

Query: 195 SEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFIQEFKRKKK 254
           +E+NVLIFDLGGGTFDVS+LTI  GIF+VK+TAGDTHLGGEDFDNRMVNHFI EFKRK K
Sbjct: 3   AERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHK 62

Query: 255 KDISGSPRAVQRLTTACERAKRTLSSTSQTTIEIDSLYEGIDFSSVITRARFEELNMDLF 314
           KDIS + RAV+RL TACERAKRTLSS++Q +IEIDSLYEGIDF + ITRARFEELN DLF
Sbjct: 63  KDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLF 122

Query: 315 RKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLLQEFFNGKRLCQNINPDEAVA 374
           R  +  V+  LR+ K+DKS++ D+V+VGGS RIPK+Q+LLQ+FFNGK L ++INPDEAVA
Sbjct: 123 RGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVA 182

Query: 375 YGAAVQAAVLS 385
           YGAAVQAA+LS
Sbjct: 183 YGAAVQAAILS 193
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 198 Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196 Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 137 Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 161 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Length = 191 Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Length = 259 Back     information, alignment and structure
>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query675
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 100.0
d1dkgd2198 Heat shock protein 70kDa, ATPase fragment {Escheri 100.0
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 100.0
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 99.98
d1jcea2196 Prokaryotic actin homolog MreB {Thermotoga maritim 99.79
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 99.77
d1v5na_89 Pdi-like hypothetical protein At1g60420 {Thale cre 99.7
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 99.58
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 99.49
d1v5na_89 Pdi-like hypothetical protein At1g60420 {Thale cre 99.41
d2fsja1161 Hypothetical protein Ta0583 {Archaeon Thermoplasma 99.32
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 98.83
d2fxua2225 Actin {Cow (Bos taurus) [TaxId: 9913]} 98.3
d1k8ka2258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 98.23
d1nbwa3202 ATPase domain of the glycerol dehydratase reactiva 98.18
d2d0oa3203 Diol dehydratase-reactivating factor large subunit 98.09
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 97.88
d2fxua1140 Actin {Cow (Bos taurus) [TaxId: 9913]} 97.1
d2dipa185 Zinc finger ZZ-type-containing protein 2 {Human (H 97.06
d1tbna_66 Protein kinase c-gamma {Rat (Rattus rattus) [TaxId 96.83
d1xa6a362 Beta-chimaerin, middle domain {Human (Homo sapiens 96.8
d1ptqa_50 Protein kinase C-delta (PKCdelta) {Mouse (Mus musc 96.8
d1faqa_52 RAF-1 {Human (Homo sapiens) [TaxId: 9606]} 96.62
d2fc7a169 Zinc finger ZZ-type-containing protein 3, ZZZ3 {Hu 96.6
d1k8ka1158 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 96.56
d1kbea_49 Kinase suppressor of Ras, Ksr {Mouse (Mus musculus 96.4
d1r79a_84 Diacylglycerol kinase delta {Human (Homo sapiens) 96.27
d1tota152 CREB-binding protein, CBP {Mouse (Mus musculus) [T 96.21
d2fsja2164 Hypothetical protein Ta0583 {Archaeon Thermoplasma 96.2
d2i7na2212 Pantothenate kinase 1, PANK1 {Human (Homo sapiens) 96.13
d1e4ft1193 Cell division protein FtsA {Thermotoga maritima [T 95.98
d2p3ra2247 Glycerol kinase {Escherichia coli [TaxId: 562]} 95.61
d1zc6a1114 Probable N-acetylglucosamine kinase CV2896 {Chromo 95.43
d1r59o2235 Glycerol kinase {Enterococcus casseliflavus [TaxId 95.41
d2dipa185 Zinc finger ZZ-type-containing protein 2 {Human (H 95.28
d1tbna_66 Protein kinase c-gamma {Rat (Rattus rattus) [TaxId 95.13
d2fc7a169 Zinc finger ZZ-type-containing protein 3, ZZZ3 {Hu 95.12
d1t6ca2180 Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6 94.76
d1nbwa2239 ATPase domain of the glycerol dehydratase reactiva 94.38
d1sz2a1319 Glucokinase Glk {Escherichia coli [TaxId: 562]} 94.34
d1kbea_49 Kinase suppressor of Ras, Ksr {Mouse (Mus musculus 94.3
d1xa6a362 Beta-chimaerin, middle domain {Human (Homo sapiens 94.13
d1faqa_52 RAF-1 {Human (Homo sapiens) [TaxId: 9606]} 94.05
d2ch5a2117 N-acetylglucosamine kinase, NAGK {Human (Homo sapi 93.72
d1r79a_84 Diacylglycerol kinase delta {Human (Homo sapiens) 93.42
d1ptqa_50 Protein kinase C-delta (PKCdelta) {Mouse (Mus musc 93.28
d2ewsa1267 Type II pantothenate kinase, CoaW {Staphylococcus 92.76
d2zgya1157 Plasmid segregation protein ParM {Escherichia coli 92.48
d1tota152 CREB-binding protein, CBP {Mouse (Mus musculus) [T 91.03
d1q18a1110 Glucokinase Glk {Escherichia coli [TaxId: 562]} 90.97
d1u6za3177 Exopolyphosphatase Ppx {Escherichia coli [TaxId: 5 88.62
d2ap1a2117 Putative regulator protein YcfX {Salmonella typhim 88.46
d2hoea2169 N-acetylglucosamine kinase {Thermotoga maritima [T 85.3
d2aa4a2170 N-acetylmannosamine kinase NanK {Escherichia coli 83.83
d2gupa2175 Hypothetical protein SP2142 {Streptococcus pneumon 82.76
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 82.75
d2ap1a1186 Putative regulator protein YcfX {Salmonella typhim 82.18
d1z05a2197 Transcriptional regulator VC2007 {Vibrio cholerae 82.03
d2p3ra1252 Glycerol kinase {Escherichia coli [TaxId: 562]} 81.26
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=4.5e-34  Score=272.48  Aligned_cols=191  Identities=75%  Similarity=1.150  Sum_probs=182.8

Q ss_pred             CCceEEEEEeCCCcEEEEEEEEeCCEEEEEEEcCCCCCcHHHHHHHHHHHHHHHHHhhccCCCCCCHHHHHHHHHHHHHH
Q 005824          195 SEKNVLIFDLGGGTFDVSLLTIGKGIFKVKATAGDTHLGGEDFDNRMVNHFIQEFKRKKKKDISGSPRAVQRLTTACERA  274 (675)
Q Consensus       195 ~~~~vlvvDiGggT~dvsv~~~~~~~~~~l~~~~~~~~GG~~id~~i~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~e~~  274 (675)
                      .+.+|||+|+||||+|++++++.++.++++++.++..+||++||++|++++.++|.++++.++..+++.+.+|+.++|++
T Consensus         3 ~e~~VlV~D~GggT~Dvsv~~~~~~~~~v~~~~g~~~lGG~~~D~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~e~~   82 (193)
T d1bupa2           3 AERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERA   82 (193)
T ss_dssp             SCEEEEEEEECSSCEEEEEEEEETTEEEEEEEEEETTCSHHHHHHHHHHHHHHHHHHHHSCCCTTCHHHHHHHHHHHHHH
T ss_pred             CCcEEEEEEeCCCeEEEEEEEEeCCEEEEEEecCCCCcchhHHHHHHHHHHHHHHHHHhCCCCccCHHHHHHHHHHHHHH
Confidence            46789999999999999999999999999999998999999999999999999999999988999999999999999999


Q ss_pred             HHHccCCCceEEEEecccCCceeEEEEeHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCccEEEEecCCcChHHHHHHH
Q 005824          275 KRTLSSTSQTTIEIDSLYEGIDFSSVITRARFEELNMDLFRKCIKHVDMCLRNGKMDKSRVDDVVIVGGSARIPKVQQLL  354 (675)
Q Consensus       275 K~~ls~~~~~~~~i~~~~~~~~~~~~itr~~~~~~~~~~~~~i~~~i~~~l~~~~~~~~~i~~VvLvGG~s~~p~l~~~l  354 (675)
                      |+.|+.+.++.+.++.+..+.+....|+|++|+++++|+++++.+.++++|++++....+|+.|+|+||+|++|+|++.|
T Consensus        83 K~~ls~~~~~~~~~~~~~~~~~~~~~itr~~~e~~~~~~~~~~~~~i~~~l~~~~~~~~~i~~V~lvGG~sr~p~v~~~i  162 (193)
T d1bupa2          83 KRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLL  162 (193)
T ss_dssp             HHHHTTSSEEEEEEEEEETTEEEEEEEEHHHHHHHTHHHHHHTHHHHHHHHHHHTCCGGGCCEEEEESGGGGCHHHHHHH
T ss_pred             hhccCCCceEEEEEecccCCCccceEEcHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHCCEEEEECCccccHHHHHHH
Confidence            99999999999999988889999999999999999999999999999999999998888999999999999999999999


Q ss_pred             HHhcCCCcccccCCchhhHHhHHHHHHHHHc
Q 005824          355 QEFFNGKRLCQNINPDEAVAYGAAVQAAVLS  385 (675)
Q Consensus       355 ~~~~~~~~v~~~~~p~~ava~Gaa~~a~~l~  385 (675)
                      ++.|++.++..+.||++|||.|||++|+.++
T Consensus       163 ~~~f~~~~i~~~~~p~~aVa~GaA~~aa~ls  193 (193)
T d1bupa2         163 QDFFNGKELNKSINPDEAVAYGAAVQAAILS  193 (193)
T ss_dssp             HHHTTTCCCBCSSCGGGHHHHHHHHHHHHHC
T ss_pred             HHHcCCCCCCCCCChHHHHHHHHHHHHHhhC
Confidence            9999878888888999999999999999875
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2d0oa3 c.55.1.6 (A:404-606) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6ca2 c.55.1.8 (A:133-312) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nbwa2 c.55.1.6 (A:2-91,A:257-405) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1sz2a1 c.55.1.7 (A:3-321) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ch5a2 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2zgya1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u6za3 c.55.1.8 (A:136-312) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hoea2 c.55.1.10 (A:200-368) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2aa4a2 c.55.1.10 (A:120-289) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gupa2 c.55.1.10 (A:115-289) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ap1a1 c.55.1.10 (A:118-303) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z05a2 c.55.1.10 (A:209-405) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure