Citrus Sinensis ID: 005932

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------67
MATEPPRSSTTATTVPQEKRHRSVFDLPSNFFDSCRLLSPLATSMSDNDSRPAAETLKVIHDYEEEDNRSINSVALTRWTCNTCKTEFESLQDQRSHFKSDVHRFNVKLTIAGKDIVKEEDFEELTSDSLKDYDVSSISGSEDEADKLSCRHDPRGESVPSVRTKLFIRLQSGERVSFWKCLMLNESESVSYEDDKSFSVNDEGCLSVSEVIERLKSLTCEPRDGTHLRVVLLASGGHFAGSVFDGNLVVARKTFHRYVVRAKAGKKQSSKDASGKAANSAGAALRRYNELALKKDLQELLASWKPYFDASICVFIYAPSTNRQLLFNGDKSYFSHQCCTIQNIPLAVRRPTLKETQRVYRQLTQVAYEVDEKDISLETCESSRINSISNCDPGSSKEDLADKLDLKETFEASSSCKQYSEQCLSSESESEVTGITTSLHEAAQSSIAQKVLELLEQGLDPCIKDENGRTPYMLASEKEVRNTFRRFMASNPDKWDWHAAKVPSALTKEMEESQAAKQAEKDAKRKARAKELKKLRKAREKRAAQAQAAENAAVADNQLTPSSVLKGEAQLRGLHISKEEELKRSQAAEREKRAAAAERRMAAALALNAQGSSTSVAPSTLQPKTGLATDINCSCCGASLAGKVPFHRYNYKYCSTSCMHVHREVLEDG
ccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHccccccEEEEEEEccccccccccccccccccccccccccHHHHHHHHHcccccccccccEEEEEEEccccEEEEEEcccEEEEEEEccccccccccccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcc
ccccccccccccccccccccccEEEcccHHHHHHcccccccccHHccccccccccccccccccccccccccccccccccEccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccccccccccccccHHHHHccccccccHHccccccccccccEEEEcccccccccccccEEEcccccccccHHHHHHHHHHHcccccccccEEEEEEEccccEEEEEEcccEEEEEEcEEEEEEEHcccccccccHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccEEEcccccccccccccccccccccccccHHHHHHHHHHHcEEEEccccHHHHHcccccccccccccccccccHHHHccccHHHHHHHHHHHHHHcccHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHcHHHHHHHHHHHHcccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccHHHcHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHccccccccccEEcccccccHHHHHHHHHHHHcc
matepprssttattvpqekrhrsvfdlpsnffdscrllsplatsmsdndsrpaaeTLKVIHDyeeednrsinsvALTRWTCNTCKTEFESLQDQRSHFKSDVHRFNVKLtiagkdivkeedfeeltsdslkdydvssisgsedeadklscrhdprgesvpsVRTKLFIRLQSGERVSFWKCLMlnesesvsyeddksfsvndegclSVSEVIERLksltceprdgtHLRVVLLASgghfagsvfdgnlVVARKTFHRYVVRAkagkkqsskdaSGKAANSAGAALRRYNELALKKDLQELLASwkpyfdasICVFIyapstnrqllfngdksyfshqcctiqniplavrrptlkETQRVYRQLTQVAYEvdekdisletcessrinsisncdpgsskedladkldlketfeasssckqyseqclssesesevtGITTSLHEAAQSSIAQKVLELLEQgldpcikdengrtpymlASEKEVRNTFRRFmasnpdkwdwhaakvPSALTKEMEESQAAKQAEKDAKRKARAKELKKLRKAREKRAAQAQAAENaavadnqltpssvlkgEAQLRGLHISKEEELKRSQAAEREKRAAAAERRMAAALALNAqgsstsvapstlqpktglatdincsccgaslagkvpfhrynykycstscmhvhrevledg
matepprssttattvpqekrhrsvfdlpsnfFDSCRLLSPLatsmsdndsrPAAETLKVihdyeeednrsinsvaltRWTCNTCKTEFESlqdqrshfksdvhrfnvkltiagkdivkeedfeeltsdslkdydvssisgsedeadklscrhdprgesvpsvrtKLFIrlqsgervsfWKCLMLNESESvsyeddksfsvndegCLSVSEVIERLksltceprdgTHLRVVLLASGGHFAGSVFDGNLVVARKTFHRYVVRakagkkqsskdasgKAANSAGAALRRYNELALKKDLQELLASWKPYFDASICVFIYAPSTNRQLLFNGDKSYFSHQCCTIqniplavrrptlKETQRVYRQLTQvayevdekdisletcessrinsisncdpgssKEDLADKLDLKETFEASSSCKQYSEQCLSSESESEVTGITTSLHEAAQSSIAQKVLELLEQGLDPCIKDENGRTPYMLASEKEVRNTFRRFMasnpdkwdwHAAKVPSALTKEMEESQAAKQAEKDAKRKARAKELKKLRKAREKRAAQAQAaenaavadnqltpssVLKGEAQLRGlhiskeeelkrsqAAEREKRAAAAERRMAAALALnaqgsstsvaPSTLQPKTGLATDINCSCCGASLAGKVPFHRYNYKYCSTSCMHVHREVLEDG
MATEPPRSSTTATTVPQEKRHRSVFDLPSNFFDSCRLLSPLATSMSDNDSRPAAETLKVIHDYEEEDNRSINSVALTRWTCNTCKTEFESLQDQRSHFKSDVHRFNVKLTIAGKDIVKEEDFEELTSDSLKDYDVSSISGSEDEADKLSCRHDPRGESVPSVRTKLFIRLQSGERVSFWKCLMLNESESVSYEDDKSFSVNDEGCLSVSEVIERLKSLTCEPRDGTHLRVVLLASGGHFAGSVFDGNLVVARKTFHRYVVRAKAGKKQsskdasgkaansagaaLRRYNELALKKDLQELLASWKPYFDASICVFIYAPSTNRQLLFNGDKSYFSHQCCTIQNIPLAVRRPTLKETQRVYRQLTQVAYEVDEKDISLETCESSRINSISNCDPGSSKEDLADKLDLKETFEASSSCKQYSEQCLsseseseVTGITTSLHEAAQSSIAQKVLELLEQGLDPCIKDENGRTPYMLASEKEVRNTFRRFMASNPDKWDWHAAKVPSALTKEMEESqaakqaekdakrkarakelkklrkarekraaqaqaaenaavadnqLTPSSVLKGEAQLRGLHISKEEELKRSQaaerekraaaaerrmaaalalnaQGSSTSVAPSTLQPKTGLATDINCSCCGASLAGKVPFHRYNYKYCSTSCMHVHREVLEDG
**************************LPSNFFDSCRLL********************VIHDY*****RSINSVALTRWTCNTCKTEFESLQDQRSHFKSDVHRFNVKLTIAGKDIVK********************************************RTKLFIRLQSGERVSFWKCLMLNES**********FSVNDEGCLSVSEVIERLKSLTCEPRDGTHLRVVLLASGGHFAGSVFDGNLVVARKTFHRYVVRA**********************LRRYNELALKKDLQELLASWKPYFDASICVFIYAPSTNRQLLFNGDKSYFSHQCCTIQNIPLAVRRPTLKETQRVYRQLTQVAYEVDEKDISL***********************************************************************QKVLELLEQGLDPCIK*******YML*******NTFRRFMAS*PDKWDWHA******************************************************************************************************************************GLATDINCSCCGASLAGKVPFHRYNYKYCSTSCMHVHR******
**********************SVFDLPSNFFDSCRLLSP***************************************TCNTCKTEFESLQDQRSHFKSDVHRFNVK************************************************************RLQSGERVSFWKCLMLNESES*************************LKSLTCEPRDGTHLRVVLLASGGHFAGSVFDGNLVVARKTFHRY***************************RRYNELALKKDLQELLASWKPYFDASICVFIYAPSTNRQLLFNGDKSYFSHQCCTIQNIPLAVRRPTLKETQRVYRQLTQVAYEVDE************************************************************TGITTSLHEAAQSSIAQKVLELLEQGLDPCIKDENGRTPYMLASEKEVRNTFRRFMASNPDKWDWHAAKV*********************************************************************************************************************************NCSCCGASLAGKVPFHRYNYKYCSTSCMHVHR******
********************HRSVFDLPSNFFDSCRLLSPLATSMSDNDSRPAAETLKVIHDYEEEDNRSINSVALTRWTCNTCKTEFESLQDQRSHFKSDVHRFNVKLTIAGKDIVKEEDFEELTSDSLKDYDVSS**************HDPRGESVPSVRTKLFIRLQSGERVSFWKCLMLNESE***********VNDEGCLSVSEVIERLKSLTCEPRDGTHLRVVLLASGGHFAGSVFDGNLVVARKTFHRYVVR*********************AALRRYNELALKKDLQELLASWKPYFDASICVFIYAPSTNRQLLFNGDKSYFSHQCCTIQNIPLAVRRPTLKETQRVYRQLTQVAYEVDEKDISLETCESSRINSISNCDPGSSKEDLADKLDLKETF*************************TTSLHEAAQSSIAQKVLELLEQGLDPCIKDENGRTPYMLASEKEVRNTFRRFMASNPDKWDWHAAKVPSAL**********************************************AVADNQLTPSSVLKGEAQLRGLHISKEEE*******************MAAALALN*************QPKTGLATDINCSCCGASLAGKVPFHRYNYKYCSTSCMHVHREVLEDG
******************KRHRSVFDLPSNFFDSCRLL***************************************RWTCNTCKTEFESLQDQRSHFKSDVHRFNVKLTIAGKDIVKEEDFEELTS*********************************************GERVSFWKCLMLNESESVSYEDDKSFSVNDEGCLSVSEVIERLKSLTCEPRDGTHLRVVLLASGGHFAGSVFDGNLVVARKTFHRYVVRAKA******************AALRRYNELALKKDLQELLASWKPYFDASICVFIYAPSTNRQLLFNGDKSYFSHQCCTIQNIPLAVRRPTLKETQRVYRQLTQVAYEVDE**************************************EASSSCKQYSE*CLSSESESEVTGITTSLHEAAQSSIAQKVLELLEQGLDPCIKDENGRTPYMLASEKEVRNTFRRFMASNPDKWDWHAAKVPSALT*E*EESQAAK************************************************************************REKRAAAAERRMAAALAL*******************LATDINCSCCGASLAGKVPFHRYNYKYCSTSCMHVHREVL***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATEPPRSSTTATTVPQEKRHRSVFDLPSNFFDSCRLLSPLATSMSDNDSRPAAETLKVIHDYEEEDNRSINSVALTRWTCNTCKTEFESLQDQRSHFKSDVHRFNVKLTIAGKDIVKEEDFEELTSDSLKDYDVSSISGSEDEADKLSCRHDPRGESVPSVRTKLFIRLQSGERVSFWKCLMLNESESVSYEDDKSFSVNDEGCLSVSEVIERLKSLTCEPRDGTHLRVVLLASGGHFAGSVFDGNLVVARKTFHRYVVRAKAGKKQSSKDASGKAANSAGAALRRYNELALKKDLQELLASWKPYFDASICVFIYAPSTNRQLLFNGDKSYFSHQCCTIQNIPLAVRRPTLKETQRVYRQLTQVAYEVDEKDISLETCESSRINSISNCDPGSSKEDLADKLDLKETFEASSSCKQYSEQCLSSESESEVTGITTSLHEAAQSSIAQKVLELLEQGLDPCIKDENGRTPYMLASEKEVRNTFRRFMASNPDKWDWHAAKVPSALTKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAVADNQLTPSSVLKGEAQLRGLHISxxxxxxxxxxxxxxxxxxxxxRRMAAALALNAQGSSTSVAPSTLQPKTGLATDINCSCCGASLAGKVPFHRYNYKYCSTSCMHVHREVLEDG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query669 2.2.26 [Sep-21-2011]
Q66H85722 Ankyrin repeat and zinc f yes no 0.402 0.372 0.352 5e-42
Q9H8Y5726 Ankyrin repeat and zinc f yes no 0.414 0.381 0.371 2e-41
Q80UU1748 Ankyrin repeat and zinc f yes no 0.409 0.366 0.325 1e-36
Q04311632 Protein VMS1 OS=Saccharom yes no 0.808 0.856 0.273 4e-34
Q58CQ5728 Ankyrin repeat and zinc f yes no 0.406 0.373 0.362 2e-33
O74977600 VMS1 homolog C1827.04 OS= yes no 0.523 0.583 0.283 1e-26
P34511618 Protein vms-1 OS=Caenorha yes no 0.387 0.419 0.289 2e-24
Q90Y35405 Zinc finger protein 622 O no no 0.073 0.120 0.387 0.0004
>sp|Q66H85|ANKZ1_RAT Ankyrin repeat and zinc finger domain-containing protein 1 OS=Rattus norvegicus GN=Ankzf1 PE=2 SV=1 Back     alignment and function desciption
 Score =  173 bits (438), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 109/309 (35%), Positives = 161/309 (52%), Gaps = 40/309 (12%)

Query: 81  CNTCKTEFESLQDQRSHFKSDVHRFNVKLTIAGKDIVKEEDFEELTSDSLKDYDVSSISG 140
           C+ C   F++ Q+QR H+K D HRFN+K  +  K ++   DFE  +S      D+SSISG
Sbjct: 72  CSACDQVFQNHQEQREHYKLDWHRFNLKQRLKNKPLLSASDFERQSSRG----DLSSISG 127

Query: 141 SED-----EADKLSCRHDPRGESVPSVRT------KLFIRLQSGERVSFWKCLMLNESES 189
           SED     E D L+   + R ES    R       ++  R   G+ +  ++C++      
Sbjct: 128 SEDSDSASEEDLLTLDEE-RAESEKPNRPPGFYPHRVLFRNAQGQFLYAYRCVL------ 180

Query: 190 VSYEDDKSFSVNDEGCLSVSEVIERLKSLTCEPRDGTHLRVVLLASGGHFAGSVFDGNLV 249
                     +  E       +++ L++       G    VVL+A+ GHFAG++F G  V
Sbjct: 181 ------GPHQIPPE---KAELLLQNLQN------GGPRHYVVLMAAAGHFAGAIFQGREV 225

Query: 250 VARKTFHRYVVRAKAGKKQSSKDASGKAANSAGAALRRYNELALKKDLQELLA--SWKPY 307
           VA KTFHRY VRAK G  Q  +DA G+A+ SAGA LRRYNE  L KD+++LLA  +W   
Sbjct: 226 VAHKTFHRYTVRAKRGTAQGLQDAQGRASRSAGANLRRYNEAMLYKDVRDLLAGPTWSKA 285

Query: 308 FDASICVFIYAPSTNRQLLFNGDKSYFSHQCCTIQNIPLAVRRPTLKETQRVYRQLTQV- 366
              +  + ++AP + R L F G  +        + +IPL  RRPT  E QRV  +LT + 
Sbjct: 286 LGEAETILLHAPRSGRSLFFGGQGAPLQRSDFRLWDIPLTTRRPTFGELQRVLHKLTTLQ 345

Query: 367 AYEVDEKDI 375
            Y+ D +++
Sbjct: 346 VYDEDPREM 354
Involved in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway.
Rattus norvegicus (taxid: 10116)
>sp|Q9H8Y5|ANKZ1_HUMAN Ankyrin repeat and zinc finger domain-containing protein 1 OS=Homo sapiens GN=ANKZF1 PE=1 SV=1 Back     alignment and function description
>sp|Q80UU1|ANKZ1_MOUSE Ankyrin repeat and zinc finger domain-containing protein 1 OS=Mus musculus GN=Ankzf1 PE=2 SV=2 Back     alignment and function description
>sp|Q04311|VMS1_YEAST Protein VMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMS1 PE=1 SV=1 Back     alignment and function description
>sp|Q58CQ5|ANKZ1_BOVIN Ankyrin repeat and zinc finger domain-containing protein 1 OS=Bos taurus GN=ANKZF1 PE=2 SV=2 Back     alignment and function description
>sp|O74977|VMS1_SCHPO VMS1 homolog C1827.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.04 PE=1 SV=1 Back     alignment and function description
>sp|P34511|VMS1_CAEEL Protein vms-1 OS=Caenorhabditis elegans GN=vms-1 PE=2 SV=2 Back     alignment and function description
>sp|Q90Y35|ZN622_CHICK Zinc finger protein 622 OS=Gallus gallus GN=ZNF622 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query669
255541350666 conserved hypothetical protein [Ricinus 0.982 0.986 0.666 0.0
225453772668 PREDICTED: ankyrin repeat and zinc finge 0.958 0.959 0.640 0.0
296089085666 unnamed protein product [Vitis vinifera] 0.958 0.962 0.640 0.0
147781804634 hypothetical protein VITISV_011424 [Viti 0.907 0.957 0.627 0.0
356566840649 PREDICTED: ankyrin repeat and zinc finge 0.949 0.978 0.599 0.0
449433115666 PREDICTED: ankyrin repeat and zinc finge 0.974 0.978 0.599 0.0
224067795587 predicted protein [Populus trichocarpa] 0.866 0.988 0.626 0.0
357506897690 Ankyrin repeat and zinc finger domain-co 0.940 0.911 0.545 0.0
18378900580 zinc finger protein-like protein [Arabid 0.838 0.967 0.564 1e-172
21592492580 unknown [Arabidopsis thaliana] 0.840 0.968 0.560 1e-170
>gi|255541350|ref|XP_002511739.1| conserved hypothetical protein [Ricinus communis] gi|223548919|gb|EEF50408.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/678 (66%), Positives = 530/678 (78%), Gaps = 21/678 (3%)

Query: 1   MATEPPRSSTTATTVPQEKRHRSVFDLPSNFFDSCRLLSPLATSMSDNDSRPAAETL-KV 59
           MATE P    TAT++PQEKR+RS+F++P+NFFD+C LLSP ATS+SD   R    T+ K 
Sbjct: 1   MATERPL--VTATSIPQEKRNRSIFNVPANFFDACCLLSPSATSVSDTFERSENSTIAKT 58

Query: 60  IHDYEEEDNRSI--NSVALTRWTCNTCKTEFESLQDQRSHFKSDVHRFNVKLTIAGKDIV 117
           + D  ++    I  N   + R TCNTCK EFESLQDQRSHFKSD+HR NVKL+IAGKDIV
Sbjct: 59  LDDETDDKEDKIYKNDAPIPRLTCNTCKAEFESLQDQRSHFKSDIHRINVKLSIAGKDIV 118

Query: 118 KEEDFEELTSDSLKDYDVSSISGSEDEADK-LSCRHDPRGESVPSVRTKLFIRLQSGERV 176
            EED ++ TSD+ KDYD+SSISGSEDEADK     +D +  S+ SV+ KLFI L++GERV
Sbjct: 119 NEEDLDDFTSDNFKDYDISSISGSEDEADKAFLPGNDVKKGSIESVKQKLFICLRTGERV 178

Query: 177 SFWKCLMLNESESVSYEDDKSFSVNDEGCLSVSEVIERLKSLTCEPRDGTHLRVVLLASG 236
           S WKC +LN+ ESVSYE+DK   +    CL  +EVIERL  L  EPRD T LR+VLLASG
Sbjct: 179 SIWKCALLNDFESVSYENDKEVPLQ---CLKENEVIERLNFLIHEPRDKTRLRIVLLASG 235

Query: 237 GHFAGSVFDGNLVVARKTFHRYVVRAKAGKKQSSKDASGKAANSAGAALRRYNELALKKD 296
           GHFAG VFDGN V+  KTFHRYVVRAKAGKKQSSKD SG+AA+SAGA+LRRYNELALKKD
Sbjct: 236 GHFAGCVFDGNSVMVHKTFHRYVVRAKAGKKQSSKDGSGRAAHSAGASLRRYNELALKKD 295

Query: 297 LQELLASWKPYFDASICVFIYAPSTNRQLLFNGDKSYFSHQCCTIQNIPLAVRRPTLKET 356
           +QELLA+WKPYFDAS  VFI+APS+NRQLLF+GDK+YFSHQ C ++N+PL+VRRPTLKE 
Sbjct: 296 IQELLAAWKPYFDASTSVFIHAPSSNRQLLFDGDKAYFSHQHCFVRNVPLSVRRPTLKEA 355

Query: 357 QRVYRQLTQVAYEVDEKDISLETCESSRINSISNCDP--GSSKEDLADKLDLKETFEASS 414
           +R+Y QLTQVAYE DEK+    T E   ++ I   D    S +EDL D +D ++T EAS+
Sbjct: 356 RRIYNQLTQVAYEADEKEFRSATKEGFSLSEIPATDSIQDSKREDLKDCVDRRDTSEAST 415

Query: 415 SCKQYSEQCLSSESESEVTGITTSLHEAAQSSIAQKVLELLEQGLDPCIKDENGRTPYML 474
           S +   E  + SE ESEV GITT LHEAAQS  A KVLELLEQGLDP +KDE GRTPYML
Sbjct: 416 SHENSHELIIPSEGESEVIGITTPLHEAAQSDDAHKVLELLEQGLDPAVKDEKGRTPYML 475

Query: 475 ASEKEVRNTFRRFMASNPDKWDWHAAKVPSALTKEMEESQAAKQAEKDAKRKARAKELKK 534
           A+EKEVRNTFRRFMASN D+WDWHAAKVPSALTKEMEESQAAKQAEKDAK+KARAKELKK
Sbjct: 476 ANEKEVRNTFRRFMASNHDRWDWHAAKVPSALTKEMEESQAAKQAEKDAKKKARAKELKK 535

Query: 535 LRKAREKRAAQAQAAEN--AAVADNQLTPSSVLKGEAQLRG-LHISKEEELKRSQAAERE 591
           LRKA+EK  AQA  ++N  AA   +   P+S  KG+ Q  G L +SKEEEL+R+QAAERE
Sbjct: 536 LRKAKEKAQAQAALSQNSMAASTGHCTAPTSASKGQPQPSGRLQLSKEEELERAQAAERE 595

Query: 592 KRAAAAERRMAAALALNAQGSSTSVAPSTLQPKTGLATDINCSCCGASLAGKVPFHRYNY 651
           KRAAAAE     A ALN+QG+ T+ A      K+GLATD+NCSCC ASLAGK+PFHRYNY
Sbjct: 596 KRAAAAE--RRMAAALNSQGTGTTSA-----AKSGLATDMNCSCCNASLAGKIPFHRYNY 648

Query: 652 KYCSTSCMHVHREVLEDG 669
           KYCST+CMHVHREVLEDG
Sbjct: 649 KYCSTTCMHVHREVLEDG 666

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225453772|ref|XP_002270342.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089085|emb|CBI38788.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147781804|emb|CAN65446.1| hypothetical protein VITISV_011424 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356566840|ref|XP_003551634.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|449433115|ref|XP_004134343.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224067795|ref|XP_002302543.1| predicted protein [Populus trichocarpa] gi|222844269|gb|EEE81816.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357506897|ref|XP_003623737.1| Ankyrin repeat and zinc finger domain-containing protein [Medicago truncatula] gi|355498752|gb|AES79955.1| Ankyrin repeat and zinc finger domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|18378900|ref|NP_563641.1| zinc finger protein-like protein [Arabidopsis thaliana] gi|8570444|gb|AAF76471.1|AC020622_5 Contains similarity to an unnamed protein from Homo sapiens gb|AK001277 and contains an Ank repeat PF|00023 domain [Arabidopsis thaliana] gi|26452448|dbj|BAC43309.1| unknown protein [Arabidopsis thaliana] gi|29824279|gb|AAP04100.1| unknown protein [Arabidopsis thaliana] gi|332189234|gb|AEE27355.1| zinc finger protein-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21592492|gb|AAM64442.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query669
TAIR|locus:2025487580 AT1G01930 [Arabidopsis thalian 0.741 0.855 0.543 1.9e-138
UNIPROTKB|F1NVQ2716 ANKZF1 "Uncharacterized protei 0.428 0.400 0.347 2.1e-57
UNIPROTKB|Q9H8Y5726 ANKZF1 "Ankyrin repeat and zin 0.417 0.384 0.353 7.8e-56
UNIPROTKB|Q58CQ5728 ANKZF1 "Ankyrin repeat and zin 0.397 0.365 0.356 1.3e-54
UNIPROTKB|F1SR83726 ANKZF1 "Uncharacterized protei 0.399 0.367 0.344 5.2e-53
MGI|MGI:1098746748 Ankzf1 "ankyrin repeat and zin 0.225 0.201 0.402 1.4e-51
RGD|1359242722 Ankzf1 "ankyrin repeat and zin 0.218 0.202 0.402 1.6e-51
UNIPROTKB|Q66H85722 Ankzf1 "Ankyrin repeat and zin 0.218 0.202 0.402 1.6e-51
UNIPROTKB|J9NYX5721 ANKZF1 "Uncharacterized protei 0.402 0.373 0.332 1.8e-51
UNIPROTKB|E2RH72751 ANKZF1 "Uncharacterized protei 0.402 0.358 0.332 2.6e-51
TAIR|locus:2025487 AT1G01930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1355 (482.0 bits), Expect = 1.9e-138, P = 1.9e-138
 Identities = 281/517 (54%), Positives = 363/517 (70%)

Query:     1 MATEPPRSSTTATTVPQEKRHRSVFDLPSNFFDSCRLLSPLATSMSDNDSRPAAETLKVI 60
             MAT    ++TT    P+ K+ RS+FDL ++FFDSCRL +P       ++++ A    K  
Sbjct:     1 MATTGA-AATTEIGNPEYKQPRSIFDLTADFFDSCRLSNP-------SETQSAFGPPKTF 52

Query:    61 HDYE-EEDNRSINSVALTRWTCNTCKTEFESLQDQRSHFKSDVHRFNVKLTIAGKDIVKE 119
                E EED  S + V L RWTCNTCK EF SLQDQR HFKSD+HR N+KL++AGK I+KE
Sbjct:    53 DPEEAEEDKSSKDGVILDRWTCNTCKIEFLSLQDQRYHFKSDIHRLNIKLSVAGKAILKE 112

Query:   120 EDFEELTSDSLKDYDVSSISGSEDEAD-KLSCRHDPRGESVPSVRTKLFIRLQSGERVSF 178
             ED +ELTS+S++DYDVSSISGSEDEA+ +    H    + +   + KLF RLQSG++VS 
Sbjct:   113 EDVDELTSESVQDYDVSSISGSEDEAETRPPSFHFDAQKGID--KKKLFFRLQSGDKVSI 170

Query:   179 WKCLMLNESESVSYEDDKSFSVNDEGCLSVSEVIERLKSLTCEPRDGTHLRVVLLASGGH 238
             WKCL+++++ESVS+E+D+  SV+  G L  +EV ERL++L  E +D   +RVVLLASGGH
Sbjct:   171 WKCLIMDDAESVSFENDRGVSVDCCGSLVENEVTERLRNLIRENKDDRQMRVVLLASGGH 230

Query:   239 FAGSVFDGNLVVARKTFHRYVVRAKAGKKQXXXXXXXXXXXXXXXXLRRYNELALKKDLQ 298
             FAG+VF+G  VVA KTFHRYVVRAKAGKKQ                LRRYNELALKKD+Q
Sbjct:   231 FAGTVFNGKSVVAHKTFHRYVVRAKAGKKQSTKDASGRSIHSAGASLRRYNELALKKDIQ 290

Query:   299 ELLASWKPYFDASICVFIYAPSTNRQLLFNGDKSYFSHQCCTIQNIPLAVRRPTLKETQR 358
             ELLASWKPYFD + CVF++APS++RQLLFNG K YFS Q C ++N+P  +RRPT KE+QR
Sbjct:   291 ELLASWKPYFDGAACVFVHAPSSSRQLLFNGGKPYFSSQNCAVRNVPFTIRRPTFKESQR 350

Query:   359 VYRQLTQVAYEVDEKDISLETCESSRINSISNCDPGSSKEDLADKLDLKETFEASSSCKQ 418
             +Y QLTQ+A+  +E  I +   E ++ N++      +  ED + K   KE  + +SS   
Sbjct:   351 IYNQLTQIAHVTEE--IFVNRPEVTKANTVVQ----THNED-SGKTSRKEEPDETSSSNI 403

Query:   419 YSEQC--LXXXXXXXVTGITTSLHEAAQSSIAQKVLELLEQGLDPCIKDENGRTPYMLAS 476
               E+   +       VTG +T+LHEAA+S   ++V+E LE+G+DPC KDE GRTPYMLA+
Sbjct:   404 ILEEPNRIEEDIEDGVTGTSTALHEAAKSGDCERVMEFLEEGMDPCAKDERGRTPYMLAN 463

Query:   477 EKEVRNTFRRFMASNPDKWDWHAAKVPSALTKEMEES 513
             EKEVRNTFRRFMA N +KW+WH AKVPS LTKEMEES
Sbjct:   464 EKEVRNTFRRFMALNLEKWNWHDAKVPSPLTKEMEES 500
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
GO:0009630 "gravitropism" evidence=RCA
UNIPROTKB|F1NVQ2 ANKZF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H8Y5 ANKZF1 "Ankyrin repeat and zinc finger domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q58CQ5 ANKZF1 "Ankyrin repeat and zinc finger domain-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SR83 ANKZF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1098746 Ankzf1 "ankyrin repeat and zinc finger domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1359242 Ankzf1 "ankyrin repeat and zinc finger domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q66H85 Ankzf1 "Ankyrin repeat and zinc finger domain-containing protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYX5 ANKZF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RH72 ANKZF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00026256001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (651 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query669
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-06
TIGR02794346 TIGR02794, tolA_full, TolA protein 5e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-04
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 2e-04
PRK05035 695 PRK05035, PRK05035, electron transport complex pro 3e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-04
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 4e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 5e-04
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 6e-04
PRK05035695 PRK05035, PRK05035, electron transport complex pro 8e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.001
TIGR02794 346 TIGR02794, tolA_full, TolA protein 0.002
PRK05035695 PRK05035, PRK05035, electron transport complex pro 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
TIGR02794346 TIGR02794, tolA_full, TolA protein 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 45.5 bits (108), Expect = 8e-06
 Identities = 20/57 (35%), Positives = 27/57 (47%)

Query: 437 TSLHEAAQSSIAQKVLELLEQGLDPCIKDENGRTPYMLASEKEVRNTFRRFMASNPD 493
           T LH AA +   + V  LLE G D   KD +GRTP  LA++       +  +    D
Sbjct: 9   TPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGAD 65

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 669
KOG2505591 consensus Ankyrin repeat protein [General function 100.0
PTZ00448373 hypothetical protein; Provisional 99.65
KOG2785390 consensus C2H2-type Zn-finger protein [General fun 99.54
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.2
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 98.94
KOG4412226 consensus 26S proteasome regulatory complex, subun 98.76
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.75
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 98.74
PF1360630 Ank_3: Ankyrin repeat 98.73
PHA02798489 ankyrin-like protein; Provisional 98.52
PHA03095471 ankyrin-like protein; Provisional 98.51
PHA02989494 ankyrin repeat protein; Provisional 98.46
KOG4412226 consensus 26S proteasome regulatory complex, subun 98.44
PHA02736154 Viral ankyrin protein; Provisional 98.44
KOG0512228 consensus Fetal globin-inducing factor (contains a 98.39
PHA02741169 hypothetical protein; Provisional 98.33
KOG0502296 consensus Integral membrane ankyrin-repeat protein 98.32
PHA02743166 Viral ankyrin protein; Provisional 98.32
PHA02795437 ankyrin-like protein; Provisional 98.31
PHA02946 446 ankyin-like protein; Provisional 98.31
PHA03100480 ankyrin repeat protein; Provisional 98.3
PHA02730 672 ankyrin-like protein; Provisional 98.29
PHA02791284 ankyrin-like protein; Provisional 98.28
KOG4214117 consensus Myotrophin and similar proteins [Transcr 98.27
PHA02791284 ankyrin-like protein; Provisional 98.27
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 98.26
PHA02741169 hypothetical protein; Provisional 98.24
PHA02743166 Viral ankyrin protein; Provisional 98.22
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.21
PHA02875413 ankyrin repeat protein; Provisional 98.2
PHA02875413 ankyrin repeat protein; Provisional 98.17
PHA02884300 ankyrin repeat protein; Provisional 98.17
PHA02878477 ankyrin repeat protein; Provisional 98.16
PHA02716764 CPXV016; CPX019; EVM010; Provisional 98.16
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 98.14
KOG0514452 consensus Ankyrin repeat protein [General function 98.13
PHA02874434 ankyrin repeat protein; Provisional 98.11
PLN03192823 Voltage-dependent potassium channel; Provisional 98.1
PHA02859209 ankyrin repeat protein; Provisional 98.1
PHA02874434 ankyrin repeat protein; Provisional 98.07
PHA02878477 ankyrin repeat protein; Provisional 98.07
KOG0512228 consensus Fetal globin-inducing factor (contains a 98.03
PHA02876 682 ankyrin repeat protein; Provisional 98.0
PHA02736154 Viral ankyrin protein; Provisional 98.0
PHA02798 489 ankyrin-like protein; Provisional 98.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 97.99
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 97.96
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 97.95
PHA02884300 ankyrin repeat protein; Provisional 97.92
PHA03095 471 ankyrin-like protein; Provisional 97.92
KOG0510 929 consensus Ankyrin repeat protein [General function 97.91
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 97.9
KOG0508 615 consensus Ankyrin repeat protein [General function 97.89
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 97.88
PHA02859209 ankyrin repeat protein; Provisional 97.87
PHA03100 480 ankyrin repeat protein; Provisional 97.86
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 97.85
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 97.84
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 97.8
PHA02792631 ankyrin-like protein; Provisional 97.78
KOG0508 615 consensus Ankyrin repeat protein [General function 97.77
PHA02917661 ankyrin-like protein; Provisional 97.75
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 97.75
PHA02989 494 ankyrin repeat protein; Provisional 97.71
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 97.7
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 97.69
PLN03192823 Voltage-dependent potassium channel; Provisional 97.67
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 97.65
PHA02730672 ankyrin-like protein; Provisional 97.64
KOG0510 929 consensus Ankyrin repeat protein [General function 97.61
PHA02917 661 ankyrin-like protein; Provisional 97.6
PHA02946446 ankyin-like protein; Provisional 97.58
KOG0502296 consensus Integral membrane ankyrin-repeat protein 97.57
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 97.56
PHA02876682 ankyrin repeat protein; Provisional 97.55
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 97.55
KOG0522 560 consensus Ankyrin repeat protein [General function 97.52
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 97.48
TIGR00870 743 trp transient-receptor-potential calcium channel p 97.47
KOG0514452 consensus Ankyrin repeat protein [General function 97.44
PHA02792 631 ankyrin-like protein; Provisional 97.39
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 97.37
PHA02795437 ankyrin-like protein; Provisional 97.36
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 97.32
KOG2505591 consensus Ankyrin repeat protein [General function 97.26
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.21
KOG4214117 consensus Myotrophin and similar proteins [Transcr 97.15
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 96.95
KOG0705749 consensus GTPase-activating protein Centaurin gamm 96.9
TIGR00870 743 trp transient-receptor-potential calcium channel p 96.84
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 96.82
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 96.74
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 96.71
KOG2384223 consensus Major histocompatibility complex protein 96.69
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 96.62
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 96.33
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 96.26
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 95.69
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 95.67
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.18
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.76
KOG0783 1267 consensus Uncharacterized conserved protein, conta 94.59
KOG0783 1267 consensus Uncharacterized conserved protein, conta 94.57
KOG0520975 consensus Uncharacterized conserved protein, conta 93.72
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 92.47
KOG0521785 consensus Putative GTPase activating proteins (GAP 92.1
KOG0521785 consensus Putative GTPase activating proteins (GAP 91.49
PF0646743 zf-FCS: MYM-type Zinc finger with FCS sequence mot 91.1
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 90.96
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 90.47
PF0839437 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: 89.19
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 87.96
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 87.82
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 86.61
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 85.69
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 84.66
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 84.02
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 83.09
smart0074639 TRASH metallochaperone-like domain. 81.91
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 81.28
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=8.3e-122  Score=982.68  Aligned_cols=553  Identities=37%  Similarity=0.511  Sum_probs=428.4

Q ss_pred             ccCCCcccccCCCceecCChhHHhhccccCCCcCCCCCCCCCCccccccccccccccccccccccccccccccccccccC
Q 005932           10 TTATTVPQEKRHRSVFDLPSNFFDSCRLLSPLATSMSDNDSRPAAETLKVIHDYEEEDNRSINSVALTRWTCNTCKTEFE   89 (669)
Q Consensus        10 ~~~~~~~~~k~~lyvfdLp~~~l~sl~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~F~   89 (669)
                      +|.-+....+++|||||||.+||++|.|++++.+......    +.|....  ....+.......+++.++|++|++.|.
T Consensus         4 a~~mg~~~k~~~l~if~l~~~i~~~l~L~s~s~te~~~~~----~~Tsd~~--~~~~e~~~r~~v~sd~~~CstCq~~F~   77 (591)
T KOG2505|consen    4 APDMGFTLKSNELLIFSLPADIFESLELESASETEEELIV----PETSDSM--SLEEEGDMRDSVISDSDQCSTCQIPFG   77 (591)
T ss_pred             cccccCccccCccceecCchHHHhhcccCCCCchhhhhcC----CcCCCcc--chhhccchhhhhhcccccccccCCccc
Confidence            4455667889999999999999999999988765532111    1111100  001111112334678999999999999


Q ss_pred             CHHHHHhhcccchhhhhhhhhhcCCCCCCHHHHHHHhhcccCCCCCCCCCCCccccccccCC-------CCCCCC-----
Q 005932           90 SLQDQRSHFKSDVHRFNVKLTIAGKDIVKEEDFEELTSDSLKDYDVSSISGSEDEADKLSCR-------HDPRGE-----  157 (669)
Q Consensus        90 ~~~~qr~H~kSdwHryNlKrkl~gl~plse~eFe~~~~~~~~~~d~sSiSGSese~d~~~~~-------~~~~~~-----  157 (669)
                      ++++||+||||||||||+||+|+|+|+||+++|+.++++     |++||||||+|.++.+.+       .+...+     
T Consensus        78 s~~eqr~HyksD~HR~N~Krkl~~~~ils~edFe~i~s~-----d~ssiSgsEde~~s~tsSdheq~ek~~dr~~~~~~~  152 (591)
T KOG2505|consen   78 SRQEQREHYKSDWHRFNTKRKLRGKPILSEEDFEGIISS-----DLSSISGSEDEAESLTSSDHEQTEKGLDRDKLDEEF  152 (591)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHhcCCCcccHHHHHHhhhc-----ccccccccccccccCCcchhHHHHHhhhhhhhhHHH
Confidence            999999999999999999999999999999999999863     789999999864322211       000000     


Q ss_pred             -C-CCccc-------ccceeeccCCceeEEEeecccCccCccccccccccccccccccchHHHHHHhhhcccCCCCCCce
Q 005932          158 -S-VPSVR-------TKLFIRLQSGERVSFWKCLMLNESESVSYEDDKSFSVNDEGCLSVSEVIERLKSLTCEPRDGTHL  228 (669)
Q Consensus       158 -~-~~~~~-------~~~~~~~~~g~~~si~r~~l~~~~~~~~~~~~~a~~~~~~~~~~~~e~l~~l~~~~~~~~~~~~~  228 (669)
                       + .....       +...|.+..|.+++||+|+|+...+.                  +..++-.|+++|.   .++..
T Consensus       153 ds~~~~~~qk~l~~~~~~s~~~e~~~~l~vyr~~~~~~n~~------------------~~~~~~~~~N~q~---~~p~~  211 (591)
T KOG2505|consen  153 DSLDEPANQKPLIMDHRVSFSIENGSVLSVYRCILHVGNER------------------TESLVLLLRNLQS---RGPFD  211 (591)
T ss_pred             hhhcccCcccchhhHHHHHhhhcCCceEEEeeecccccCCC------------------CHHHHHHHHhhcc---CCchh
Confidence             0 00001       12245567899999999999874221                  2345556777774   45677


Q ss_pred             EEEEEecCCceeEEEecCCeeEEeeccccceeecccCCcccccccCCCcccccccchhhccHHHHHHHHHHHHHhhHHhh
Q 005932          229 RVVLLASGGHFAGSVFDGNLVVARKTFHRYVVRAKAGKKQSSKDASGKAANSAGAALRRYNELALKKDLQELLASWKPYF  308 (669)
Q Consensus       229 ~~i~m~~gGhFAg~vf~~~~~~~HKtfhrYtvR~KqGg~Qs~~D~~~g~akSAGa~lRRynE~al~~~i~~lL~~W~~~l  308 (669)
                      +||||+||||||||||+|..||+|||||||||||||||+||++|++||++|||||+||||||++|++|||+||++|+.||
T Consensus       212 ~avfm~~GGHFAgaIfs~~~vvahKTFHRYttRaKqGgsQs~~Da~gG~ahSAGa~LRRYNE~aLkkDIQ~llasW~~~L  291 (591)
T KOG2505|consen  212 CAVFMAGGGHFAGAIFSGDKVVAHKTFHRYTTRAKQGGSQSAHDAGGGAAHSAGAQLRRYNEQALKKDIQSLLASWKKYL  291 (591)
T ss_pred             eeeeeecCcchhHHHhcCcchhhhhhHHHHHHHHhcccccchhhccCCccccchHHHhhhhHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccceeEEecCCCCcccccCCCCCccCCCCCccccCCCCCCCCCHHHHHHHHHhhheEEee-ccccchh--hhhccccc-
Q 005932          309 DASICVFIYAPSTNRQLLFNGDKSYFSHQCCTIQNIPLAVRRPTLKETQRVYRQLTQVAYE-VDEKDIS--LETCESSR-  384 (669)
Q Consensus       309 ~~~~~Ifira~~~~r~~lf~~~~~~l~~~d~Rir~iPf~trrpt~~El~Rv~~~L~~v~~~-~~e~~~~--~~~~~~~~-  384 (669)
                      ++|++||||||.+.|++||++.+++|..+|||||.|||+|+|||+.|++|||++|++|++. +++.-+.  ++.+.... 
T Consensus       292 e~~~~IFiRA~~ssr~l~F~~~~a~is~~d~~ir~~PFttkRPt~~El~rc~~eL~~~kishv~e~~l~~reev~K~~~~  371 (591)
T KOG2505|consen  292 EKADLIFIRAPASSRNLFFEGDGAGISTGDPRIRTFPFTTKRPTIKELSRCWQELQQVKISHVREEMLEVREEVKKLARK  371 (591)
T ss_pred             ccCCeEEEEccccccceeecCCCCccCCCCCcccccCCCCCCCchHHHHHHHHHhhhhhccCCchHHhhccHHHHHHHHH
Confidence            9999999999999999999999899999999999999999999999999999999999864 4333121  11111111 


Q ss_pred             -cc--ccCCCCCCCChhhHhhhhh---cc--cchhhchhcccccccCCCCCcccccCCCCcHHHHHHHcCCHHHHHHHHH
Q 005932          385 -IN--SISNCDPGSSKEDLADKLD---LK--ETFEASSSCKQYSEQCLSSESESEVTGITTSLHEAAQSSIAQKVLELLE  456 (669)
Q Consensus       385 -~~--~~~~~~~~~s~e~~~~~l~---~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~g~TpLH~AA~~G~~~iV~~LLe  456 (669)
                       .+  .+..+....+++.....++   .+  .+.-+.++..+..+.+|.+.|+..+....|+|||||.+|...+|.+||+
T Consensus       372 v~k~~~ksee~e~k~e~~~Te~i~s~lkk~~~p~~ie~lken~lsgnf~~~pe~~~~ltsT~LH~aa~qg~~k~v~~~Le  451 (591)
T KOG2505|consen  372 VAKKKRKSEENEDKSEEKKTEHIISRLKKKPEPDSIEALKENLLSGNFDVTPEANDYLTSTFLHYAAAQGARKCVKYFLE  451 (591)
T ss_pred             HhhhhcccccccchhhhhhhHHHHHHHhccCchhHHHHHHhcCCcccccccccccccccchHHHHHHhcchHHHHHHHHH
Confidence             11  1111111222222222221   12  2333456666777888888899999999999999999999999999999


Q ss_pred             CCCCcCCccCCCCcceeecccccHHHHHHHHHHcCCCccccccCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 005932          457 QGLDPCIKDENGRTPYMLASEKEVRNTFRRFMASNPDKWDWHAAKVPSALTKEMEESQAAKQAEKDAKRKARAKELKKLR  536 (669)
Q Consensus       457 ~GADP~ikn~~GkTP~~lA~dk~~Rd~Fr~~~~~~~d~~Dw~~A~VP~plskE~e~~q~~k~~ekk~~~k~r~kE~ek~k  536 (669)
                      .||||+++|..|+|||+++.++++|++|+.++..|+.+|||+.+|||.|||+||+++|++|++|+++.+|++++.+++++
T Consensus       452 eg~Dp~~kd~~Grtpy~ls~nkdVk~~F~a~~~l~es~~nW~~t~i~~PltrEq~~eq~ekkkek~anqka~kk~kkelr  531 (591)
T KOG2505|consen  452 EGCDPSTKDGAGRTPYSLSANKDVKSIFIARRVLNESFGNWARTHIPEPLTREQEREQAEKKKEKKANQKAKKKLKKELR  531 (591)
T ss_pred             hcCCchhcccCCCCcccccccHHHHHHHHHHHHhcccccchhhhcCCCcccHHHHHHHHHHHHHHHHhHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhhhcccCCCcccccchhhcccccCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 005932          537 KAREKRAAQAQAAENAAVADNQLTPSSVLKGEAQLRGLHISKEEELKRSQAAEREKRAAAAERRMAA  603 (669)
Q Consensus       537 ke~ek~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~eEe~~~~~~~eREkRA~AAE~Rl~~  603 (669)
                      +.+++++.+++++.+  +.|+.++..+. ....+.+++  +    ++++|+.+||+||.|||.||+.
T Consensus       532 kaeekqk~ae~sere--g~gk~l~i~~v-~~v~~l~sl--~----~e~r~r~~re~ra~aa~~rm~~  589 (591)
T KOG2505|consen  532 KAEEKQKYAEMSERE--GDGKLLGIPPV-LRVHQLGSL--L----PETRFRYSRESRACAAEHRMAN  589 (591)
T ss_pred             HHHHHHHHHHHHhhc--cCccccCCChH-HHHHHHhcc--C----chhhHHHHHHHHHHHHHHhhcc
Confidence            988877665533222  33344322221 112222222  2    3688999999999999999964

>PTZ00448 hypothetical protein; Provisional Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>PF06467 zf-FCS: MYM-type Zinc finger with FCS sequence motif; InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>smart00746 TRASH metallochaperone-like domain Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query669
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-05
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-04
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-04
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-04
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 56.0 bits (134), Expect = 3e-08
 Identities = 82/520 (15%), Positives = 145/520 (27%), Gaps = 156/520 (30%)

Query: 47  DNDSRPAAETLKVIHDYEEEDN--RSINSVALTRWTCNTCKTEFESLQDQRSH----FKS 100
           + D +   +  K I   EE D+   S ++V+ T          F +L  ++      F  
Sbjct: 32  NFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRL-------FWTLLSKQEEMVQKFVE 84

Query: 101 DVHRFNVKLTIAGKDIVKEEDFEELTSDSLKDYDVSSISGSEDEADKLSCRHDPRGESVP 160
           +V R N K  +     +K E  +   S   + Y +       ++    +  +  R +   
Sbjct: 85  EVLRINYKF-LMSP--IKTEQRQ--PSMMTRMY-IEQRDRLYNDNQVFAKYNVSRLQPYL 138

Query: 161 SVRTKLFIRLQSGERVS------FWK-CLMLNESESVSYEDDKSFSV---NDEGCLSVSE 210
            +R  L   L+  + V         K  + L+   S   +    F +   N + C S   
Sbjct: 139 KLRQALL-ELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPET 197

Query: 211 VIERLKSLTCEPRDGTHLRVVLLASGGHFAGSVFDGNLVVARKTFHRYVVRAKAGKKQSS 270
           V+E L+ L                          D N            +R         
Sbjct: 198 VLEMLQKL-L---------------------YQIDPNWTSRSDHSSNIKLRI-------- 227

Query: 271 KDASGKAANSAGAALRRYNELALKKDLQELLASWKPYFDASICVFIYAPSTNRQLLFNGD 330
                   +S  A LRR             L   KPY     C+ +     N +      
Sbjct: 228 --------HSIQAELRR-------------LLKSKPY---ENCLLVLLNVQNAKAW---- 259

Query: 331 KSYFSHQCCTIQNIPLAVRRPTLKETQRVYRQLTQVAYEVDEKDISLETCESSRINSISN 390
            + F+  C              L  T+  ++Q+T          ISL+            
Sbjct: 260 -NAFNLSC------------KILLTTR--FKQVTDFLSAATTTHISLD------------ 292

Query: 391 CDPGSSKEDLADKLDLKETFEASSSCKQYSEQCLSSESES----EVTGITTSLHEAA--- 443
                     +  L   E             Q L  E  +     ++ I  S+ +     
Sbjct: 293 --------HHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATW 344

Query: 444 ---QSSIAQKVLELLEQGLDPCIKDENGRTPYMLASEKEVRNTFRRFMASNPDKWDWHAA 500
              +     K+  ++E  L+            +L    E R  F R     P       A
Sbjct: 345 DNWKHVNCDKLTTIIESSLN------------VL-EPAEYRKMFDRLSVFPPS------A 385

Query: 501 KVPSA----LTKEMEESQAAKQAEKDAKRKARAKELKKLR 536
            +P+     +  ++ +S       K  K     K+ K+  
Sbjct: 386 HIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKEST 425
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query669
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.05
4gpm_A169 Engineered protein OR264; de novo protein, structu 98.92
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 98.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 98.9
4gpm_A169 Engineered protein OR264; de novo protein, structu 98.89
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 98.87
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 98.81
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 98.79
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 98.78
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 98.78
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 98.77
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 98.75
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 98.74
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 98.74
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 98.72
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 98.72
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 98.71
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 98.7
1awc_B153 Protein (GA binding protein beta 1); complex (tran 98.69
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 98.69
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 98.68
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 98.68
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 98.68
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 98.68
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 98.68
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 98.67
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 98.67
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.67
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 98.67
3deo_A183 Signal recognition particle 43 kDa protein; chloro 98.67
1awc_B153 Protein (GA binding protein beta 1); complex (tran 98.67
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 98.67
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 98.66
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 98.64
3v30_A172 DNA-binding protein rfxank; structural genomics co 98.63
1sw6_A327 Regulatory protein SWI6; transcription regulation, 98.63
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 98.63
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 98.62
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 98.62
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 98.62
3v31_A167 Ankyrin repeat family A protein 2; structural geno 98.62
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 98.61
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.61
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 98.6
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 98.6
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 98.6
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 98.59
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 98.58
3v30_A172 DNA-binding protein rfxank; structural genomics co 98.58
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 98.58
2rfa_A232 Transient receptor potential cation channel subfa 98.58
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 98.58
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 98.58
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 98.57
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 98.57
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 98.57
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 98.56
3v31_A167 Ankyrin repeat family A protein 2; structural geno 98.56
3hra_A201 Ankyrin repeat family protein; structural protein; 98.55
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 98.55
3hra_A201 Ankyrin repeat family protein; structural protein; 98.55
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 98.54
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 98.54
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 98.53
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 98.52
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 98.52
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 98.52
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 98.51
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 98.5
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 98.5
1sw6_A327 Regulatory protein SWI6; transcription regulation, 98.5
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 98.5
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 98.5
3jxi_A260 Vanilloid receptor-related osmotically activated p 98.49
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 98.49
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 98.48
2etb_A256 Transient receptor potential cation channel subfam 98.48
3deo_A183 Signal recognition particle 43 kDa protein; chloro 98.47
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 98.46
2pnn_A273 Transient receptor potential cation channel subfa 98.46
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 98.46
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 98.45
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 98.45
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 98.45
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 98.44
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 98.44
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 98.44
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 98.44
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 98.43
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 98.4
2etb_A256 Transient receptor potential cation channel subfam 98.4
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 98.4
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.4
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 98.39
2rfa_A232 Transient receptor potential cation channel subfa 98.39
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 98.38
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 98.38
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 98.38
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.38
3jxi_A260 Vanilloid receptor-related osmotically activated p 98.37
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 98.37
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 98.37
2pnn_A273 Transient receptor potential cation channel subfa 98.35
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 98.33
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 98.31
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 98.31
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 98.31
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 98.28
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 98.28
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 98.26
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 98.24
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 98.14
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 97.7
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 97.46
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.92
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 88.68
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 88.66
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
Probab=99.05  E-value=1.6e-10  Score=97.36  Aligned_cols=62  Identities=32%  Similarity=0.378  Sum_probs=55.6

Q ss_pred             ccccCCCCcHHHHHHHcCCHHHHHHHHHCCCCcCCccCCCCcceeecccccHHHHHHHHHHc
Q 005932          429 ESEVTGITTSLHEAAQSSIAQKVLELLEQGLDPCIKDENGRTPYMLASEKEVRNTFRRFMAS  490 (669)
Q Consensus       429 ~~~~~~g~TpLH~AA~~G~~~iV~~LLe~GADP~ikn~~GkTP~~lA~dk~~Rd~Fr~~~~~  490 (669)
                      ..+|..|+||||+|+..|+.++|++||+.|+|++.+|..|+||+++|...+..++++.+...
T Consensus        29 n~~d~~g~t~L~~A~~~~~~~~v~~Ll~~ga~~~~~d~~g~t~l~~A~~~~~~~~~~~Ll~~   90 (93)
T 1n0q_A           29 NAKDKNGRTPLHLAARNGHLEVVKLLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLLLEA   90 (93)
T ss_dssp             TCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHT
T ss_pred             cccCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCccCCCCCCHHHHHHHcCCHHHHHHHHHc
Confidence            34677899999999999999999999999999999999999999999988888888876643
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 669
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.001
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 44.2 bits (103), Expect = 4e-05
 Identities = 12/42 (28%), Positives = 19/42 (45%)

Query: 437 TSLHEAAQSSIAQKVLELLEQGLDPCIKDENGRTPYMLASEK 478
           T LH A+       V  LL++G  P + +    TP  +A+  
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARA 43
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query669
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.0
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 98.98
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 98.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 98.91
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 98.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 98.86
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 98.84
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 98.82
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 98.79
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 98.79
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 98.77
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 98.75
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 98.74
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 98.68
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 98.67
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 98.67
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 98.62
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 98.61
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 98.59
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 98.58
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 98.57
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 98.54
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 98.47
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 98.47
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 98.43
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 98.41
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 98.3
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 98.29
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 98.28
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 98.23
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 98.16
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 98.13
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 98.03
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 97.93
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 97.81
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 97.71
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 87.14
d1zu1a255 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 86.17
d2dasa149 Zinc finger MYM-type protein 5 {Human (Homo sapien 80.13
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 80.05
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.00  E-value=4.6e-11  Score=104.72  Aligned_cols=53  Identities=21%  Similarity=0.214  Sum_probs=45.0

Q ss_pred             cccCCCCcHHHHHHHcCCHHHHHHHHHCCCCcCCccCCCCcceeecccccHHH
Q 005932          430 SEVTGITTSLHEAAQSSIAQKVLELLEQGLDPCIKDENGRTPYMLASEKEVRN  482 (669)
Q Consensus       430 ~~~~~g~TpLH~AA~~G~~~iV~~LLe~GADP~ikn~~GkTP~~lA~dk~~Rd  482 (669)
                      .+|..|+||||+|+..|+.++|++||++||||+++|.+|+||+++|....++.
T Consensus        63 ~~d~~g~tpLh~A~~~~~~~~v~~Ll~~Gad~~~~d~~G~t~l~~a~~~~i~~  115 (118)
T d1myoa_          63 APDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKA  115 (118)
T ss_dssp             CCSSSCSCHHHHHHTTTCCHHHHHHHTTCCCSSSSSSSTCCCCCTCSSTTTGG
T ss_pred             ecccccccchhhhhhcCchhhhhhhhcccccceeeCCCCCCHHHHHhHHHHHH
Confidence            35678999999999999999999999999999999999999999987665543
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2dasa1 g.39.1.17 (A:8-56) Zinc finger MYM-type protein 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure