Citrus Sinensis ID: 005949

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------67
MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILHKGEVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLTSLGWSERTIWEEGLRKTIEWYTQNPDWWGDVSGALLPHPRMLMMPGGRHFDGSEENKAVSSVSTNNIQSRMVVPVSKCSSPRKPSMKFLIYGRTGWIGGLLGKLCEKEGIPFEYGKGRLEDCSSLIADVQSVKPTHVFNAAGVTGRPNVDWCESHKTDTIRTNVAGTLTLADVCRDHGILMMNYATGCIFEYDAAHPEGSGIGYKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYINPEFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLIKYVFEPNKKT
cccccccEEEEEccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccEEEcccccHHHHHHHHHHccccEEEEcccccccccccccHHHHHHccHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHccccccEEEccccccccccccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHHccccccccEEccccccccccccccccHHHHccccccccHHHHHHHHHHHHHccHHHHHccccccccccHHccccccccccccccccccccccccccccEEEEcccccccccccccEEEEEccccHHcHHHHHHHHHHcccEEEEccccccHHHHHHHHHHccccEEEEcccccccccccccccccccEEEccHHHHHHHHHHHHHHccEEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEcccccccccccHHHHHccccccccccccHHHHcccccHHHHHHHccccccccccccccccHHHHHHHHHHHcccccccccccHHHccEEEEccccccHHcHHHHHHHcccccccHHHHHHHHccccccc
cccccccEEEEEccccHHHHHHHHHHHHHccccEEEEEEcccccccHHHcccccccccEEEEccccccHHHHHHHHHHHcccEEEEcccccccccccccccHHHHHHcHHHHHHHHHHHHcccEEEEEEEEEHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEcEEEccccccccHHHHHHHHHHccccEEEEcccccEEEEEEHHHHHHHHHHHHHHcccccEEEEccccEEEHHHHHHHHHHHHcccHHHHEEEEccccccccEEEEcHHHHHHccccccccHHHHHHHHHHHHHHcHHHHHHHHccccccHHHccccccccccccccccccEcccccccEEEEEEcccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEcEccccHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEEEccccccccccccEEEEccccEEEccccHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHccccccEEEEcHHHHcEEEEcccccccccHHHHHHHcHHHccHHHHHHHHHccccccc
matytpknilITGAAGFIASHVCNRLIRNYPEYKIVVLDKLdycsnlknlipskassnfkfvkgdiasaDLVNFLLITESIDTIMHFAAQthvdnsfgnsfeftknniyGTHVLLEACKVTGQIRRFIHVstdevygetdedavvgnheasqllptnpysatkAGAEMLVMAYGrsyglpvittrgnnvygpnqfpeklIPKFILLAMrglplpihgdgsnvrsyLYCEDVAEAFECILhkgevghvynvgtkkerRVIDVAKDICKLfsmdpetsikfvenrpfndqryflddqkltslgwsertIWEEGLRKTIEWYtqnpdwwgdvsgallphprmlmmpggrhfdgseenkavssvstnniqsrmvvpvskcssprkpsmkFLIYGRTGWIGGLLgklcekegipfeygkgrledCSSLIAdvqsvkpthvfnaagvtgrpnvdwceshktdtirtnvAGTLTLADVCRDHGILMMNYATgcifeydaahpegsgigykeedtpnftgsfySKTKAMVEELLKEYDNVCtlrvrmpissdlnnprnfitKISRYNkvvnipnsmtvlDELLPISIEMAKRNLRGiwnftnpgvvsHNEILEMYKKyinpefkwvnftLEEQAKVIvaprsnnemdasklkkefpelLSIKDSLIKYvfepnkkt
matytpknilitgaAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGnheasqllptnpYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILHkgevghvynvgtkkerrviDVAKDICKLFSMDPETSIKFVENRPFNDQryflddqkltslgwsertiWEEGLRKTIEWYTQNPDWWGDVSGALLPHPRMLMMPGGRHFDGSEENKAVSsvstnniqsrmvvpvskcssprkpSMKFLIYGRTGWIGGLLGKLCEKEGIPFEYGKGRLEDCSSLIADVQSVKPTHVFnaagvtgrpnvdWCESHKTdtirtnvagtLTLADVCRDHGILMMNYATGCIFEYDAAHPEGSGIGYKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRvrmpissdlnnprnfITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYINPEFKWVNFTLEEQAKVIVaprsnnemdasklkkefpellsikdslikyvfepnkkt
MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILHKGEVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLTSLGWSERTIWEEGLRKTIEWYTQNPDWWGDVSGALLPHPRMLMMPGGRHFDGSEENKAVSSVSTNNIQSRMVVPVSKCSSPRKPSMKFLIYGRTGWIggllgklcekegIPFEYGKGRLEDCSSLIADVQSVKPTHVFNAAGVTGRPNVDWCESHKTDTIRTNVAGTLTLADVCRDHGILMMNYATGCIFEYDAAHPEGSGIGYKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYINPEFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLIKYVFEPNKKT
******KNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNH****LLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILHKGEVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLTSLGWSERTIWEEGLRKTIEWYTQNPDWWGDVSGALLPHPR*********************************************MKFLIYGRTGWIGGLLGKLCEKEGIPFEYGKGRLEDCSSLIADVQSVKPTHVFNAAGVTGRPNVDWCESHKTDTIRTNVAGTLTLADVCRDHGILMMNYATGCIFEYDAAHPEGSGIGYKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYINPEFKWVNFTLEEQAKVIVA******************LLSIKDSLIKYVF******
****TPK*ILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILHKGEVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLTSLGWSERTIWEEGLRKTIEWYTQNPDWWGDVSGALLPHPRMLMM*******************************************FLIYGRTGWIGGLLGKLCEKEGIPFEYGKGRLEDCSSLIADVQSVKPTHVFNAAGVTGRPNVDWCESHKTDTIRTNVAGTLTLADVCRDHGILMMNYATGCIFEYDAAHPEGSGIGYKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYINPEFKWVNFTLEEQAKVIV***************EFPELLSIKDSLIKYVFEPN***
MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILHKGEVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLTSLGWSERTIWEEGLRKTIEWYTQNPDWWGDVSGALLPHPRMLMMPGGRHFDG***********TNNIQSRMVV********RKPSMKFLIYGRTGWIGGLLGKLCEKEGIPFEYGKGRLEDCSSLIADVQSVKPTHVFNAAGVTGRPNVDWCESHKTDTIRTNVAGTLTLADVCRDHGILMMNYATGCIFEYDAAHPEGSGIGYKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYINPEFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLIKYVFEPNKKT
****TPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILHKGEVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLTSLGWSERTIWEEGLRKTIEWYTQNPDWWGDVSGALLPHPRMLMMPG***********AVSSVSTNNIQSRMVVPVSKCSSPRKPSMKFLIYGRTGWIGGLLGKLCEKEGIPFEYGKGRLEDCSSLIADVQSVKPTHVFNAAGVTGRPNVDWCESHKTDTIRTNVAGTLTLADVCRDHGILMMNYATGCIFEYDAAHPEGSGIGYKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYINPEFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLIKYVFEPNK**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILHKGEVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLTSLGWSERTIWEEGLRKTIEWYTQNPDWWGDVSGALLPHPRMLMMPGGRHFDGSEENKAVSSVSTNNIQSRMVVPVSKCSSPRKPSMKFLIYGRTGWIGGLLGKLCEKEGIPFEYGKGRLEDCSSLIADVQSVKPTHVFNAAGVTGRPNVDWCESHKTDTIRTNVAGTLTLADVCRDHGILMMNYATGCIFEYDAAHPEGSGIGYKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYINPEFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLIKYVFEPNKKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query668 2.2.26 [Sep-21-2011]
Q9SYM5669 Probable rhamnose biosynt yes no 1.0 0.998 0.886 0.0
Q9LH76664 Probable rhamnose biosynt no no 0.994 1.0 0.857 0.0
Q9LPG6667 Probable rhamnose biosynt no no 0.994 0.995 0.856 0.0
Q8VDR7355 dTDP-D-glucose 4,6-dehydr yes no 0.489 0.921 0.482 8e-89
O95455350 dTDP-D-glucose 4,6-dehydr yes no 0.489 0.934 0.470 6e-86
A6QLW2355 dTDP-D-glucose 4,6-dehydr yes no 0.489 0.921 0.467 1e-85
Q54WS6434 dTDP-D-glucose 4,6-dehydr yes no 0.474 0.730 0.462 1e-84
Q5UR12323 Putative dTDP-D-glucose 4 N/A no 0.465 0.962 0.451 4e-75
P27830355 dTDP-glucose 4,6-dehydrat N/A no 0.479 0.901 0.405 1e-64
P55294355 dTDP-glucose 4,6-dehydrat yes no 0.476 0.895 0.411 1e-64
>sp|Q9SYM5|RHM1_ARATH Probable rhamnose biosynthetic enzyme 1 OS=Arabidopsis thaliana GN=RHM1 PE=1 SV=1 Back     alignment and function desciption
 Score = 1256 bits (3250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/669 (88%), Positives = 633/669 (94%), Gaps = 1/669 (0%)

Query: 1   MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFK 60
           MA+YTPKNILITGAAGFIASHV NRLIR+YP+YKIVVLDKLDYCSNLKNL PSK S NFK
Sbjct: 1   MASYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFK 60

Query: 61  FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV 120
           FVKGDIASADLVN LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct: 61  FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV 120

Query: 121 TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP 180
           TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct: 121 TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP 180

Query: 181 VITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILH 240
           VITTRGNNVYGPNQFPEKLIPKFILLAMRG  LPIHGDGSNVRSYLYCEDVAEAFE +LH
Sbjct: 181 VITTRGNNVYGPNQFPEKLIPKFILLAMRGQVLPIHGDGSNVRSYLYCEDVAEAFEVVLH 240

Query: 241 KGEVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLTSL 300
           KGEVGHVYN+GTKKERRV DVAKDICKLF+MDPE +IKFV+NRPFNDQRYFLDDQKL  L
Sbjct: 241 KGEVGHVYNIGTKKERRVNDVAKDICKLFNMDPEANIKFVDNRPFNDQRYFLDDQKLKKL 300

Query: 301 GWSERTIWEEGLRKTIEWYTQNPDWWGDVSGALLPHPRMLMMPGGRHFDGSEENKAVSSV 360
           GWSERT WEEGL+KT++WYTQNP+WWGDVSGALLPHPRMLMMPGGRHFDGSE+N   +++
Sbjct: 301 GWSERTTWEEGLKKTMDWYTQNPEWWGDVSGALLPHPRMLMMPGGRHFDGSEDNSLAATL 360

Query: 361 STNNIQSRMVVPVSKCS-SPRKPSMKFLIYGRTGWIGGLLGKLCEKEGIPFEYGKGRLED 419
           S    Q+ MVVP  + + +P+KPS+KFLIYG+TGWIGGLLGK+C+K+GI +EYGKGRLED
Sbjct: 361 SEKPSQTHMVVPSQRSNGTPQKPSLKFLIYGKTGWIGGLLGKICDKQGIAYEYGKGRLED 420

Query: 420 CSSLIADVQSVKPTHVFNAAGVTGRPNVDWCESHKTDTIRTNVAGTLTLADVCRDHGILM 479
            SSL+ D+QSVKPTHVFN+AGVTGRPNVDWCESHKT+TIR NVAGTLTLADVCR+HG+LM
Sbjct: 421 RSSLLQDIQSVKPTHVFNSAGVTGRPNVDWCESHKTETIRANVAGTLTLADVCREHGLLM 480

Query: 480 MNYATGCIFEYDAAHPEGSGIGYKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRM 539
           MN+ATGCIFEYD  HPEGSGIG+KEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRM
Sbjct: 481 MNFATGCIFEYDDKHPEGSGIGFKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRM 540

Query: 540 PISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVS 599
           PISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGVVS
Sbjct: 541 PISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVVS 600

Query: 600 HNEILEMYKKYINPEFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLIK 659
           HNEILEMY+ YINPEFKW NFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIK+SLIK
Sbjct: 601 HNEILEMYRDYINPEFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIK 660

Query: 660 YVFEPNKKT 668
           Y + PNKKT
Sbjct: 661 YAYGPNKKT 669
Probably involved in the synthesis of pectinaceous rhamnogalacturonan I.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: -
>sp|Q9LH76|RHM3_ARATH Probable rhamnose biosynthetic enzyme 3 OS=Arabidopsis thaliana GN=RHM3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LPG6|RHM2_ARATH Probable rhamnose biosynthetic enzyme 2 OS=Arabidopsis thaliana GN=RHM2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VDR7|TGDS_MOUSE dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=Tgds PE=2 SV=2 Back     alignment and function description
>sp|O95455|TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=TGDS PE=2 SV=1 Back     alignment and function description
>sp|A6QLW2|TGDS_BOVIN dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TGDS PE=2 SV=1 Back     alignment and function description
>sp|Q54WS6|TGDS_DICDI dTDP-D-glucose 4,6-dehydratase OS=Dictyostelium discoideum GN=tgds PE=3 SV=1 Back     alignment and function description
>sp|Q5UR12|TGDS_MIMIV Putative dTDP-D-glucose 4,6-dehydratase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R141 PE=3 SV=1 Back     alignment and function description
>sp|P27830|RMLB2_ECOLI dTDP-glucose 4,6-dehydratase 2 OS=Escherichia coli (strain K12) GN=rffG PE=1 SV=3 Back     alignment and function description
>sp|P55294|RMLB_NEIMB dTDP-glucose 4,6-dehydratase OS=Neisseria meningitidis serogroup B (strain MC58) GN=rfbB1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query668
224119002670 predicted protein [Populus trichocarpa] 1.0 0.997 0.9 0.0
211906526667 rhamnose synthase [Gossypium hirsutum] 0.997 0.998 0.904 0.0
225461808675 PREDICTED: probable rhamnose biosyntheti 1.0 0.989 0.900 0.0
283488503667 rhamnose synthase [Gossypium hirsutum] 0.997 0.998 0.899 0.0
297839725669 RHM1/ROL1 [Arabidopsis lyrata subsp. lyr 1.0 0.998 0.893 0.0
356549610669 PREDICTED: probable rhamnose biosyntheti 0.995 0.994 0.894 0.0
356544142669 PREDICTED: probable rhamnose biosyntheti 0.995 0.994 0.894 0.0
15218420669 UDP-glucose 4,6-dehydratase [Arabidopsis 1.0 0.998 0.886 0.0
449438897670 PREDICTED: probable rhamnose biosyntheti 0.995 0.992 0.885 0.0
283488501667 rhamnose synthase [Gossypium hirsutum] 0.997 0.998 0.895 0.0
>gi|224119002|ref|XP_002331301.1| predicted protein [Populus trichocarpa] gi|222873884|gb|EEF11015.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1271 bits (3290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/670 (90%), Positives = 637/670 (95%), Gaps = 2/670 (0%)

Query: 1   MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFK 60
           MATYTPKNILITGAAGFIASHVCNRLIRNYP+YKIVVLDKLDYCSNLKNL+PSK+S NFK
Sbjct: 1   MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK 60

Query: 61  FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV 120
           FVKGDI SADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct: 61  FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV 120

Query: 121 TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP 180
           TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct: 121 TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP 180

Query: 181 VITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILH 240
           VITTRGNNVYGPNQFPEKLIPKFILLAM+G  LPIHGDGSNVRSYLYCEDVAEAFE ILH
Sbjct: 181 VITTRGNNVYGPNQFPEKLIPKFILLAMQGKDLPIHGDGSNVRSYLYCEDVAEAFEVILH 240

Query: 241 KGEVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLTSL 300
           KGEVGHVYNVGTKKERRVIDVAKDIC LFSMDP+ SIKFVENRPFNDQRYFLDDQKL  L
Sbjct: 241 KGEVGHVYNVGTKKERRVIDVAKDICNLFSMDPDKSIKFVENRPFNDQRYFLDDQKLKIL 300

Query: 301 GWSERTIWEEGLRKTIEWYTQNPDWWGDVSGALLPHPRMLMMPGGRHFDGSEENKAVSSV 360
           GWSE T WEEGLRKTIEWYTQNPDWWGDV+GALLPHPRMLMMPGGRHFDGSEEN+  S V
Sbjct: 301 GWSEHTTWEEGLRKTIEWYTQNPDWWGDVTGALLPHPRMLMMPGGRHFDGSEENRDASYV 360

Query: 361 STNNIQSRMVVPVSKC--SSPRKPSMKFLIYGRTGWIGGLLGKLCEKEGIPFEYGKGRLE 418
           S N+ Q+RMV+PV+K    SPRKPS+KFLIYGRTGWIGGLLGKLCEK+GI FEYGKGRLE
Sbjct: 361 SNNSNQARMVIPVTKVGTGSPRKPSLKFLIYGRTGWIGGLLGKLCEKQGISFEYGKGRLE 420

Query: 419 DCSSLIADVQSVKPTHVFNAAGVTGRPNVDWCESHKTDTIRTNVAGTLTLADVCRDHGIL 478
           D SSL++D+Q+++PTHVFNAAGVTGRPNVDWCESHKT+TIRTNVAGTLTLADVCR+H +L
Sbjct: 421 DRSSLLSDIQNIRPTHVFNAAGVTGRPNVDWCESHKTETIRTNVAGTLTLADVCREHNLL 480

Query: 479 MMNYATGCIFEYDAAHPEGSGIGYKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVR 538
           M+N+ATGCIFEYDA HPEGSGIG+ EED PNF GSFYSKTKAMVEELL+EYDNVCTLRVR
Sbjct: 481 MVNFATGCIFEYDAGHPEGSGIGFTEEDKPNFIGSFYSKTKAMVEELLREYDNVCTLRVR 540

Query: 539 MPISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVV 598
           MPISSDL+NPRNFITKISRYNKVVNIPNSMT+L+ELLPISIEMAKRNLRGIWNFTNPGVV
Sbjct: 541 MPISSDLSNPRNFITKISRYNKVVNIPNSMTILEELLPISIEMAKRNLRGIWNFTNPGVV 600

Query: 599 SHNEILEMYKKYINPEFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLI 658
           SHNEIL+MYK YI+P F WVNF LEEQAKVIVAPRSNNE+DASKLK EFPELL IK+SLI
Sbjct: 601 SHNEILDMYKNYIDPNFTWVNFNLEEQAKVIVAPRSNNELDASKLKNEFPELLPIKESLI 660

Query: 659 KYVFEPNKKT 668
           KYVFEPNK+T
Sbjct: 661 KYVFEPNKRT 670

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|211906526|gb|ACJ11756.1| rhamnose synthase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|225461808|ref|XP_002285634.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|283488503|gb|ADB24773.1| rhamnose synthase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|297839725|ref|XP_002887744.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata] gi|297333585|gb|EFH64003.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356549610|ref|XP_003543185.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356544142|ref|XP_003540514.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine max] Back     alignment and taxonomy information
>gi|15218420|ref|NP_177978.1| UDP-glucose 4,6-dehydratase [Arabidopsis thaliana] gi|62901057|sp|Q9SYM5.1|RHM1_ARATH RecName: Full=Probable rhamnose biosynthetic enzyme 1 gi|4836876|gb|AAD30579.1|AC007260_10 Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana] gi|14596091|gb|AAK68773.1| Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana] gi|20148285|gb|AAM10033.1| similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana] gi|332198001|gb|AEE36122.1| UDP-glucose 4,6-dehydratase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449438897|ref|XP_004137224.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis sativus] gi|449483174|ref|XP_004156513.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|283488501|gb|ADB24772.1| rhamnose synthase [Gossypium hirsutum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query668
TAIR|locus:2202960669 RHM1 "rhamnose biosynthesis 1" 1.0 0.998 0.872 0.0
TAIR|locus:2099372664 RHM3 "rhamnose biosynthesis 3" 0.994 1.0 0.841 2.10000000002e-313
TAIR|locus:2024902667 MUM4 "MUCILAGE-MODIFIED 4" [Ar 0.992 0.994 0.840 4.6e-311
TAIR|locus:2015489301 NRS/ER "nucleotide-rhamnose sy 0.443 0.983 0.763 1.9e-124
WB|WBGene00015298631 C01F1.3 [Caenorhabditis elegan 0.465 0.492 0.383 2.1e-86
DICTYBASE|DDB_G0279465434 tgds "putative dTDP-D-glucose 0.390 0.601 0.525 1.9e-83
MGI|MGI:1923605355 Tgds "TDP-glucose 4,6-dehydrat 0.488 0.918 0.486 2.4e-83
RGD|1306544355 Tgds "TDP-glucose 4,6-dehydrat 0.488 0.918 0.480 1.7e-82
UNIPROTKB|F1RP60355 TGDS "Uncharacterized protein" 0.488 0.918 0.477 2e-81
UNIPROTKB|O95455350 TGDS "dTDP-D-glucose 4,6-dehyd 0.488 0.931 0.471 2.5e-81
TAIR|locus:2202960 RHM1 "rhamnose biosynthesis 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3123 (1104.4 bits), Expect = 0., P = 0.
 Identities = 584/669 (87%), Positives = 621/669 (92%)

Query:     1 MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFK 60
             MA+YTPKNILITGAAGFIASHV NRLIR+YP+YKIVVLDKLDYCSNLKNL PSK S NFK
Sbjct:     1 MASYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFK 60

Query:    61 FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV 120
             FVKGDIASADLVN LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct:    61 FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV 120

Query:   121 TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP 180
             TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct:   121 TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP 180

Query:   181 VITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILH 240
             VITTRGNNVYGPNQFPEKLIPKFILLAMRG  LPIHGDGSNVRSYLYCEDVAEAFE +LH
Sbjct:   181 VITTRGNNVYGPNQFPEKLIPKFILLAMRGQVLPIHGDGSNVRSYLYCEDVAEAFEVVLH 240

Query:   241 KGEVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLTSL 300
             KGEVGHVYN+GTKKERRV DVAKDICKLF+MDPE +IKFV+NRPFNDQRYFLDDQKL  L
Sbjct:   241 KGEVGHVYNIGTKKERRVNDVAKDICKLFNMDPEANIKFVDNRPFNDQRYFLDDQKLKKL 300

Query:   301 GWSERTIWEEGLRKTIEWYTQNPDWWGDVSGALLPHPRMLMMPGGRHFDGSEENKAVSSV 360
             GWSERT WEEGL+KT++WYTQNP+WWGDVSGALLPHPRMLMMPGGRHFDGSE+N   +++
Sbjct:   301 GWSERTTWEEGLKKTMDWYTQNPEWWGDVSGALLPHPRMLMMPGGRHFDGSEDNSLAATL 360

Query:   361 STNNIQSRMVVPVSKCS-SPRKPSMKFLIYGRTGWIXXXXXXXXXXXXIPFEYGKGRLED 419
             S    Q+ MVVP  + + +P+KPS+KFLIYG+TGWI            I +EYGKGRLED
Sbjct:   361 SEKPSQTHMVVPSQRSNGTPQKPSLKFLIYGKTGWIGGLLGKICDKQGIAYEYGKGRLED 420

Query:   420 CSSLIADVQSVKPTHVFNAAGVTGRPNVDWCESHKTDTIRTNVAGTLTLADVCRDHGILM 479
              SSL+ D+QSVKPTHVFN+AGVTGRPNVDWCESHKT+TIR NVAGTLTLADVCR+HG+LM
Sbjct:   421 RSSLLQDIQSVKPTHVFNSAGVTGRPNVDWCESHKTETIRANVAGTLTLADVCREHGLLM 480

Query:   480 MNYATGCIFEYDAAHPEGSGIGYKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRM 539
             MN+ATGCIFEYD  HPEGSGIG+KEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRM
Sbjct:   481 MNFATGCIFEYDDKHPEGSGIGFKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRM 540

Query:   540 PISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVS 599
             PISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNL+GIWNFTNPGVVS
Sbjct:   541 PISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVVS 600

Query:   600 HNEILEMYKKYINPEFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLIK 659
             HNEILEMY+ YINPEFKW NFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIK+SLIK
Sbjct:   601 HNEILEMYRDYINPEFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIK 660

Query:   660 YVFEPNKKT 668
             Y + PNKKT
Sbjct:   661 YAYGPNKKT 669
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA;ISS
GO:0008831 "dTDP-4-dehydrorhamnose reductase activity" evidence=IEA
GO:0009225 "nucleotide-sugar metabolic process" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0044237 "cellular metabolic process" evidence=IEA
GO:0045226 "extracellular polysaccharide biosynthetic process" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0010253 "UDP-rhamnose biosynthetic process" evidence=IDA;IMP
GO:0050377 "UDP-glucose 4,6-dehydratase activity" evidence=IDA
GO:0010280 "UDP-L-rhamnose synthase activity" evidence=IDA
GO:0010315 "auxin efflux" evidence=IMP
GO:0051555 "flavonol biosynthetic process" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009813 "flavonoid biosynthetic process" evidence=RCA
GO:0010224 "response to UV-B" evidence=RCA
TAIR|locus:2099372 RHM3 "rhamnose biosynthesis 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024902 MUM4 "MUCILAGE-MODIFIED 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015489 NRS/ER "nucleotide-rhamnose synthase/epimerase-reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00015298 C01F1.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279465 tgds "putative dTDP-D-glucose 4,6-dehydratase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1923605 Tgds "TDP-glucose 4,6-dehydratase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306544 Tgds "TDP-glucose 4,6-dehydratase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RP60 TGDS "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O95455 TGDS "dTDP-D-glucose 4,6-dehydratase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SYM5RHM1_ARATH4, ., 2, ., 1, ., -0.88631.00.9985yesno
Q9LH76RHM3_ARATH4, ., 2, ., 1, ., -0.85770.99401.0nono
Q9LPG6RHM2_ARATH4, ., 2, ., 1, ., -0.85600.99400.9955nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.2.1.46LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_1680019
SubName- Full=Putative uncharacterized protein; (671 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pm.C_LG_I0410
SubName- Full=Putative uncharacterized protein; (302 aa)
  •  •••0.900
eugene3.00030924
SubName- Full=Putative uncharacterized protein; (302 aa)
  •  •••0.900
gw1.XIII.2344.1
hypothetical protein (409 aa)
     •  0.899
gw1.5051.2.1
hypothetical protein (250 aa)
     •  0.899
grail3.0018042501
UDP-glucose 4-epimerase (EC-5.1.3.2) (348 aa)
     • •0.899
eugene3.40280001
UTP--glucose-1-phosphate uridylyltransferase (308 aa)
     •  0.899
eugene3.00440223
UTP--glucose-1-phosphate uridylyltransferase (EC-2.7.7.9) (469 aa)
     •  0.899
eugene3.00101501
UDP-glucose 6-dehydrogenase (EC-1.1.1.22) (480 aa)
     •  0.899
eugene3.00061661
galactose-1-phosphate uridylyltransferase (EC-2.7.7.10) (348 aa)
     •  0.899
estExt_fgenesh4_pm.C_LG_XVII0156
UDP-glucose 6-dehydrogenase (EC-1.1.1.22) (481 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query668
PLN02260668 PLN02260, PLN02260, probable rhamnose biosynthetic 0.0
PLN02778298 PLN02778, PLN02778, 3,5-epimerase/4-reductase 0.0
cd05246315 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydra 1e-173
COG1088340 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cel 1e-136
TIGR01181317 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehyd 1e-124
PRK10217355 PRK10217, PRK10217, dTDP-glucose 4,6-dehydratase; 1e-83
PRK10084352 PRK10084, PRK10084, dTDP-glucose 4,6 dehydratase; 7e-81
cd05256304 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-e 1e-64
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 9e-61
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 3e-59
cd05257316 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, 3e-57
cd05254280 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4 1e-54
cd08946200 cd08946, SDR_e, extended (e) SDRs 4e-52
cd05264300 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase 5e-47
cd05258337 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, e 1e-45
cd05230305 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase 2e-44
cd05253332 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimera 9e-43
TIGR01179328 TIGR01179, galE, UDP-glucose-4-epimerase GalE 1e-40
COG1087329 COG1087, GalE, UDP-glucose 4-epimerase [Cell envel 3e-40
cd05247323 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, 2e-38
TIGR04180297 TIGR04180, EDH_00030, NAD dependent epimerase/dehy 4e-38
cd05234305 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, 8e-38
cd05260316 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase 3e-31
cd05252336 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydrata 9e-27
COG1086588 COG1086, COG1086, Predicted nucleoside-diphosphate 4e-26
cd05237287 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-l 6e-26
cd05232303 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, 6e-26
pfam02719280 pfam02719, Polysacc_synt_2, Polysaccharide biosynt 3e-25
PLN02240352 PLN02240, PLN02240, UDP-glucose 4-epimerase 8e-24
cd05239300 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, exte 2e-23
cd05273328 cd05273, GME-like_SDR_e, Arabidopsis thaliana GDP- 3e-23
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 5e-23
PRK10675338 PRK10675, PRK10675, UDP-galactose-4-epimerase; Pro 6e-23
PLN02206442 PLN02206, PLN02206, UDP-glucuronate decarboxylase 2e-22
PLN02166436 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase 5e-22
cd05248317 cd05248, ADP_GME_SDR_e, ADP-L-glycero-D-mannohepto 3e-21
cd05254280 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4 6e-21
cd05241331 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid d 7e-21
pfam07993245 pfam07993, NAD_binding_4, Male sterility protein 3e-19
pfam01073280 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydr 4e-19
cd05263293 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens 8e-19
PRK15181348 PRK15181, PRK15181, Vi polysaccharide biosynthesis 2e-18
cd09813335 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD 6e-18
TIGR02622349 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydra 1e-16
COG1091281 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [C 2e-16
cd02266186 cd02266, SDR, Short-chain dehydrogenases/reductase 3e-16
cd05240306 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase 4e-16
TIGR02197314 TIGR02197, heptose_epim, ADP-L-glycero-D-manno-hep 3e-15
cd08957307 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptic 4e-15
cd05238305 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a n 1e-14
cd05265250 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 1e-14
cd05236320 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (F 2e-14
COG1091281 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [C 8e-14
cd05235290 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 1e-13
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 3e-13
PLN02725306 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5- 9e-13
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 1e-12
TIGR01746367 TIGR01746, Thioester-redct, thioester reductase do 3e-12
COG3320382 COG3320, COG3320, Putative dehydrogenase domain of 5e-12
PLN02695370 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase 5e-12
TIGR01214287 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase 6e-12
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 7e-12
TIGR03589324 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehyd 3e-11
PRK11908347 PRK11908, PRK11908, NAD-dependent epimerase/dehydr 4e-11
cd05271273 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ub 8e-11
cd05227301 cd05227, AR_SDR_e, aldehyde reductase, extended (e 1e-10
cd05193295 cd05193, AR_like_SDR_e, aldehyde reductase, flavon 3e-10
pfam04321284 pfam04321, RmlD_sub_bind, RmlD substrate binding d 7e-10
cd09811354 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD 8e-10
COG1089345 COG1089, Gmd, GDP-D-mannose dehydratase [Cell enve 9e-10
TIGR01472343 TIGR01472, gmd, GDP-mannose 4,6-dehydratase 1e-09
cd05255382 cd05255, SQD1_like_SDR_e, UDP_sulfoquinovose_synth 2e-09
COG0702275 COG0702, COG0702, Predicted nucleoside-diphosphate 2e-09
PLN02427386 PLN02427, PLN02427, UDP-apiose/xylose synthase 4e-09
TIGR01214287 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase 6e-09
cd05261248 cd05261, CAPF_like_SDR_e, capsular polysaccharide 1e-08
cd08946200 cd08946, SDR_e, extended (e) SDRs 3e-08
PLN02653340 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase 2e-07
TIGR04130337 TIGR04130, FnlA, UDP-N-acetylglucosamine 4,6-dehyd 8e-07
pfam04321284 pfam04321, RmlD_sub_bind, RmlD substrate binding d 2e-06
TIGR03466328 TIGR03466, HpnA, hopanoid-associated sugar epimera 4e-06
cd05266251 cd05266, SDR_a4, atypical (a) SDRs, subgroup 4 6e-06
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 6e-05
PLN02572442 PLN02572, PLN02572, UDP-sulfoquinovose synthase 6e-05
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Pro 1e-04
cd05247323 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, 3e-04
cd05262291 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 3e-04
COG1087329 COG1087, GalE, UDP-glucose 4-epimerase [Cell envel 5e-04
cd05265250 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 8e-04
cd05242296 cd05242, SDR_a8, atypical (a) SDRs, subgroup 8 8e-04
pfam07993245 pfam07993, NAD_binding_4, Male sterility protein 0.001
PLN02996491 PLN02996, PLN02996, fatty acyl-CoA reductase 0.001
cd09812339 cd09812, 3b-HSD_like_1_SDR_e, 3beta-hydroxysteroid 0.001
PRK08125660 PRK08125, PRK08125, bifunctional UDP-glucuronic ac 0.001
cd05238305 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a n 0.003
cd08958293 cd08958, FR_SDR_e, flavonoid reductase (FR), exten 0.004
>gnl|CDD|215146 PLN02260, PLN02260, probable rhamnose biosynthetic enzyme Back     alignment and domain information 
 Score = 1481 bits (3837), Expect = 0.0
 Identities = 598/669 (89%), Positives = 626/669 (93%), Gaps = 5/669 (0%)

Query: 1   MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFK 60
           MATY PKNILITGAAGFIASHV NRLIRNYP+YKIVVLDKLDYCSNLKNL PSK+S NFK
Sbjct: 1   MATYEPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK 60

Query: 61  FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV 120
           FVKGDIASADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct: 61  FVKGDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV 120

Query: 121 TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP 180
           TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP
Sbjct: 121 TGQIRRFIHVSTDEVYGETDEDADVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLP 180

Query: 181 VITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILH 240
           VITTRGNNVYGPNQFPEKLIPKFILLAM+G PLPIHGDGSNVRSYLYCEDVAEAFE +LH
Sbjct: 181 VITTRGNNVYGPNQFPEKLIPKFILLAMQGKPLPIHGDGSNVRSYLYCEDVAEAFEVVLH 240

Query: 241 KGEVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLTSL 300
           KGEVGHVYN+GTKKERRVIDVAKDICKLF +DPE SIKFVENRPFNDQRYFLDDQKL  L
Sbjct: 241 KGEVGHVYNIGTKKERRVIDVAKDICKLFGLDPEKSIKFVENRPFNDQRYFLDDQKLKKL 300

Query: 301 GWSERTIWEEGLRKTIEWYTQNPDWWGDVSGALLPHPRMLMMPGGRHFDGSEENKAVSSV 360
           GW ERT WEEGL+KT+EWYT NPDWWGDVSGALLPHPRMLMMPG R FDGSEE K  SS 
Sbjct: 301 GWQERTSWEEGLKKTMEWYTSNPDWWGDVSGALLPHPRMLMMPGVRLFDGSEEIKLSSSG 360

Query: 361 STNNIQSRMVVPVSKC-SSPRKPSMKFLIYGRTGWIGGLLGKLCEKEGIPFEYGKGRLED 419
           S    Q+ +VV      SSP KPS+KFLIYGRTGWIGGLLGKLCEK+GI +EYGKGRLED
Sbjct: 361 S----QTGLVVVTKPAGSSPGKPSLKFLIYGRTGWIGGLLGKLCEKQGIAYEYGKGRLED 416

Query: 420 CSSLIADVQSVKPTHVFNAAGVTGRPNVDWCESHKTDTIRTNVAGTLTLADVCRDHGILM 479
            SSL+AD+++VKPTHVFNAAGVTGRPNVDWCESHK +TIR NV GTLTLADVCR++G+LM
Sbjct: 417 RSSLLADIRNVKPTHVFNAAGVTGRPNVDWCESHKVETIRANVVGTLTLADVCRENGLLM 476

Query: 480 MNYATGCIFEYDAAHPEGSGIGYKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRM 539
           MN+ATGCIFEYDA HPEGSGIG+KEED PNFTGSFYSKTKAMVEELL+EYDNVCTLRVRM
Sbjct: 477 MNFATGCIFEYDAKHPEGSGIGFKEEDKPNFTGSFYSKTKAMVEELLREYDNVCTLRVRM 536

Query: 540 PISSDLNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVS 599
           PISSDL+NPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVS
Sbjct: 537 PISSDLSNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVS 596

Query: 600 HNEILEMYKKYINPEFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLIK 659
           HNEILEMYK YI+P FKW NFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIK+SLIK
Sbjct: 597 HNEILEMYKDYIDPGFKWSNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIK 656

Query: 660 YVFEPNKKT 668
           YVFEPNKKT
Sbjct: 657 YVFEPNKKT 665

Length = 668
>gnl|CDD|178377 PLN02778, PLN02778, 3,5-epimerase/4-reductase Back     alignment and domain information
>gnl|CDD|187557 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224013 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|182313 PRK10217, PRK10217, dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|236649 PRK10084, PRK10084, dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187564 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4-hexulose reductase and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187574 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase (G4E), subgroup 5, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187568 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187541 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187563 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE Back     alignment and domain information
>gnl|CDD|224012 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187558 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|200431 TIGR04180, EDH_00030, NAD dependent epimerase/dehydratase, LLPSF_EDH_00030 family Back     alignment and domain information
>gnl|CDD|187545 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, subgroup 2, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187570 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187562 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked N-acetylglucosamine) inverting 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|217199 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein Back     alignment and domain information
>gnl|CDD|177883 PLN02240, PLN02240, UDP-glucose 4-epimerase Back     alignment and domain information
>gnl|CDD|187550 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187581 cd05273, GME-like_SDR_e, Arabidopsis thaliana GDP-mannose-3',5'-epimerase (GME)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|182639 PRK10675, PRK10675, UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|177856 PLN02206, PLN02206, UDP-glucuronate decarboxylase Back     alignment and domain information
>gnl|CDD|165812 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|187559 cd05248, ADP_GME_SDR_e, ADP-L-glycero-D-mannoheptose 6-epimerase (GME), extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187564 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4-hexulose reductase and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information
>gnl|CDD|216283 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|185103 PRK15181, PRK15181, Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>gnl|CDD|187673 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD(P)H steroid dehydrogenase-like protein)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|233954 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|224016 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR) Back     alignment and domain information
>gnl|CDD|187551 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase (G4E), subgroup 3, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|233775 TIGR02197, heptose_epim, ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>gnl|CDD|187660 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptica enzymes WbmH and WbmG-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187549 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a nucleoside-diphosphate-sugar 4-epimerase)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|187547 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (FARs), extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224016 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187546 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178326 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|233557 TIGR01746, Thioester-redct, thioester reductase domain Back     alignment and domain information
>gnl|CDD|225857 COG3320, COG3320, Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|178298 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>gnl|CDD|200085 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|132628 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|183375 PRK11908, PRK11908, NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187536 cd05193, AR_like_SDR_e, aldehyde reductase, flavonoid reductase, and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|218026 pfam04321, RmlD_sub_bind, RmlD substrate binding domain Back     alignment and domain information
>gnl|CDD|187671 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD (hydroxysteroid dehydrogenase) and HSD3B1(delta 5-delta 4-isomerase)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224014 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|233427 TIGR01472, gmd, GDP-mannose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|187565 cd05255, SQD1_like_SDR_e, UDP_sulfoquinovose_synthase (Arabidopsis thaliana SQD1 and related proteins), extended (e) SDRs Back     alignment and domain information
>gnl|CDD|223774 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178047 PLN02427, PLN02427, UDP-apiose/xylose synthase Back     alignment and domain information
>gnl|CDD|200085 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>gnl|CDD|187571 cd05261, CAPF_like_SDR_e, capsular polysaccharide assembling protein (CAPF) like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|178259 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|200381 TIGR04130, FnlA, UDP-N-acetylglucosamine 4,6-dehydratase/5-epimerase Back     alignment and domain information
>gnl|CDD|218026 pfam04321, RmlD_sub_bind, RmlD substrate binding domain Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information
>gnl|CDD|187576 cd05266, SDR_a4, atypical (a) SDRs, subgroup 4 Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|215310 PLN02572, PLN02572, UDP-sulfoquinovose synthase Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187558 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187572 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 Back     alignment and domain information
>gnl|CDD|224012 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|187553 cd05242, SDR_a8, atypical (a) SDRs, subgroup 8 Back     alignment and domain information
>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information
>gnl|CDD|215538 PLN02996, PLN02996, fatty acyl-CoA reductase Back     alignment and domain information
>gnl|CDD|187672 cd09812, 3b-HSD_like_1_SDR_e, 3beta-hydroxysteroid dehydrogenase (3b-HSD)-like, subgroup1, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|236156 PRK08125, PRK08125, bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>gnl|CDD|187549 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a nucleoside-diphosphate-sugar 4-epimerase)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187661 cd08958, FR_SDR_e, flavonoid reductase (FR), extended (e) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 668
PLN02260668 probable rhamnose biosynthetic enzyme 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 100.0
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 100.0
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 100.0
PRK07201657 short chain dehydrogenase; Provisional 100.0
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 100.0
PLN02572442 UDP-sulfoquinovose synthase 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 100.0
PLN02166436 dTDP-glucose 4,6-dehydratase 100.0
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 100.0
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 100.0
PLN02206442 UDP-glucuronate decarboxylase 100.0
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 100.0
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 100.0
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 100.0
PRK11908347 NAD-dependent epimerase/dehydratase family protein 100.0
PLN02427386 UDP-apiose/xylose synthase 100.0
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 100.0
PLN02653340 GDP-mannose 4,6-dehydratase 100.0
PLN02778298 3,5-epimerase/4-reductase 100.0
PLN02695370 GDP-D-mannose-3',5'-epimerase 100.0
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 100.0
PLN02214342 cinnamoyl-CoA reductase 100.0
PLN02240352 UDP-glucose 4-epimerase 100.0
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 100.0
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 100.0
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 100.0
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 100.0
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 100.0
PRK10675338 UDP-galactose-4-epimerase; Provisional 100.0
PLN00198338 anthocyanidin reductase; Provisional 100.0
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 100.0
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 100.0
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 100.0
PLN02650351 dihydroflavonol-4-reductase 100.0
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 100.0
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 100.0
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 100.0
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 100.0
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 100.0
PLN02896353 cinnamyl-alcohol dehydrogenase 100.0
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 100.0
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 100.0
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 100.0
PLN02166436 dTDP-glucose 4,6-dehydratase 100.0
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 100.0
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 100.0
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 100.0
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 100.0
PLN02572442 UDP-sulfoquinovose synthase 100.0
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 100.0
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 100.0
PLN02206442 UDP-glucuronate decarboxylase 100.0
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 100.0
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 100.0
PRK11908347 NAD-dependent epimerase/dehydratase family protein 100.0
PLN00016378 RNA-binding protein; Provisional 100.0
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 100.0
PLN02427386 UDP-apiose/xylose synthase 100.0
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 100.0
PLN02695370 GDP-D-mannose-3',5'-epimerase 100.0
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 100.0
PLN02653340 GDP-mannose 4,6-dehydratase 100.0
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 100.0
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 100.0
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 100.0
PLN02686367 cinnamoyl-CoA reductase 100.0
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 100.0
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 100.0
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 100.0
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 100.0
PLN02214342 cinnamoyl-CoA reductase 100.0
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 100.0
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 100.0
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 100.0
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 100.0
PLN02260 668 probable rhamnose biosynthetic enzyme 100.0
PLN02240352 UDP-glucose 4-epimerase 99.98
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.98
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.98
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.98
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.97
PLN02583297 cinnamoyl-CoA reductase 99.97
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.97
PLN00198338 anthocyanidin reductase; Provisional 99.97
PLN02896353 cinnamyl-alcohol dehydrogenase 99.97
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 99.97
PLN02996491 fatty acyl-CoA reductase 99.97
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.97
PLN02650351 dihydroflavonol-4-reductase 99.97
PRK05865 854 hypothetical protein; Provisional 99.97
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.97
PLN02778298 3,5-epimerase/4-reductase 99.97
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.97
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.97
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.96
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.96
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.96
CHL00194317 ycf39 Ycf39; Provisional 99.96
PLN02686367 cinnamoyl-CoA reductase 99.96
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.95
PRK06484520 short chain dehydrogenase; Validated 99.95
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 99.95
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.95
PLN00016378 RNA-binding protein; Provisional 99.95
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.95
CHL00194317 ycf39 Ycf39; Provisional 99.94
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.94
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.93
PLN02583297 cinnamoyl-CoA reductase 99.93
PLN02503605 fatty acyl-CoA reductase 2 99.93
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.93
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.93
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.93
PLN02996491 fatty acyl-CoA reductase 99.92
PRK12320 699 hypothetical protein; Provisional 99.92
PRK05865 854 hypothetical protein; Provisional 99.92
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 99.92
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.92
PRK07201 657 short chain dehydrogenase; Provisional 99.91
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.91
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.91
PRK06482276 short chain dehydrogenase; Provisional 99.88
COG3320382 Putative dehydrogenase domain of multifunctional n 99.88
KOG2774366 consensus NAD dependent epimerase [General functio 99.88
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.87
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 99.87
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.87
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 99.87
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.86
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.86
PRK09135249 pteridine reductase; Provisional 99.85
PRK12320 699 hypothetical protein; Provisional 99.85
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.84
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.84
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.84
PRK06194287 hypothetical protein; Provisional 99.84
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.83
PRK08263275 short chain dehydrogenase; Provisional 99.83
PRK07774250 short chain dehydrogenase; Provisional 99.83
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.82
PRK05875276 short chain dehydrogenase; Provisional 99.82
PLN02503605 fatty acyl-CoA reductase 2 99.82
PRK07067257 sorbitol dehydrogenase; Provisional 99.82
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.82
PRK07775274 short chain dehydrogenase; Provisional 99.81
PRK07074257 short chain dehydrogenase; Provisional 99.81
PRK06180277 short chain dehydrogenase; Provisional 99.81
PLN03209576 translocon at the inner envelope of chloroplast su 99.81
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.81
PRK06914280 short chain dehydrogenase; Provisional 99.81
PRK05876275 short chain dehydrogenase; Provisional 99.81
COG3320382 Putative dehydrogenase domain of multifunctional n 99.81
PRK12746254 short chain dehydrogenase; Provisional 99.81
PRK06128300 oxidoreductase; Provisional 99.81
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.81
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.81
PRK07806248 short chain dehydrogenase; Provisional 99.8
PRK12829264 short chain dehydrogenase; Provisional 99.8
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.8
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.8
PRK12827249 short chain dehydrogenase; Provisional 99.8
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.8
PRK12828239 short chain dehydrogenase; Provisional 99.8
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.79
PRK06482276 short chain dehydrogenase; Provisional 99.79
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.79
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.78
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 99.78
PRK07890258 short chain dehydrogenase; Provisional 99.77
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.77
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.77
PRK06138252 short chain dehydrogenase; Provisional 99.77
PRK08219227 short chain dehydrogenase; Provisional 99.77
PRK12939250 short chain dehydrogenase; Provisional 99.77
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.77
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.77
PRK06182273 short chain dehydrogenase; Validated 99.77
PRK07060245 short chain dehydrogenase; Provisional 99.77
PRK06123248 short chain dehydrogenase; Provisional 99.76
PRK07985294 oxidoreductase; Provisional 99.76
PRK06500249 short chain dehydrogenase; Provisional 99.76
PRK06701290 short chain dehydrogenase; Provisional 99.76
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 99.76
PRK09134258 short chain dehydrogenase; Provisional 99.76
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.76
PLN02253280 xanthoxin dehydrogenase 99.75
PRK06179270 short chain dehydrogenase; Provisional 99.75
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.75
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.75
PRK07856252 short chain dehydrogenase; Provisional 99.75
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.75
PRK05717255 oxidoreductase; Validated 99.75
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.75
PRK08264238 short chain dehydrogenase; Validated 99.74
PRK06181263 short chain dehydrogenase; Provisional 99.74
KOG2774366 consensus NAD dependent epimerase [General functio 99.74
PRK06398258 aldose dehydrogenase; Validated 99.74
PRK07577234 short chain dehydrogenase; Provisional 99.74
PRK09186256 flagellin modification protein A; Provisional 99.74
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.74
PRK06841255 short chain dehydrogenase; Provisional 99.73
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.73
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.73
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.73
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.73
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.73
PRK09135249 pteridine reductase; Provisional 99.73
PRK07454241 short chain dehydrogenase; Provisional 99.72
PRK06523260 short chain dehydrogenase; Provisional 99.72
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.72
PRK08324681 short chain dehydrogenase; Validated 99.72
PRK07478254 short chain dehydrogenase; Provisional 99.72
PRK06198260 short chain dehydrogenase; Provisional 99.72
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.72
PRK07326237 short chain dehydrogenase; Provisional 99.72
PRK08628258 short chain dehydrogenase; Provisional 99.71
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.71
PRK05993277 short chain dehydrogenase; Provisional 99.71
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.71
PRK07024257 short chain dehydrogenase; Provisional 99.71
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.7
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.7
PRK12742237 oxidoreductase; Provisional 99.7
PRK09242257 tropinone reductase; Provisional 99.7
PRK12744257 short chain dehydrogenase; Provisional 99.7
PRK07814263 short chain dehydrogenase; Provisional 99.7
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.7
PRK07035252 short chain dehydrogenase; Provisional 99.7
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.7
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.7
PRK09291257 short chain dehydrogenase; Provisional 99.7
PRK10538248 malonic semialdehyde reductase; Provisional 99.7
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.7
PRK08643256 acetoin reductase; Validated 99.69
PRK06114254 short chain dehydrogenase; Provisional 99.69
PRK08265261 short chain dehydrogenase; Provisional 99.69
PRK06196315 oxidoreductase; Provisional 99.69
PRK07806248 short chain dehydrogenase; Provisional 99.69
PRK08589272 short chain dehydrogenase; Validated 99.69
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.69
PRK08226263 short chain dehydrogenase; Provisional 99.69
PRK08263275 short chain dehydrogenase; Provisional 99.69
PRK08267260 short chain dehydrogenase; Provisional 99.69
PRK06947248 glucose-1-dehydrogenase; Provisional 99.68
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.68
PRK08277278 D-mannonate oxidoreductase; Provisional 99.68
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.68
PRK12747252 short chain dehydrogenase; Provisional 99.68
PRK12743256 oxidoreductase; Provisional 99.68
PRK05867253 short chain dehydrogenase; Provisional 99.68
PRK07063260 short chain dehydrogenase; Provisional 99.68
PRK12937245 short chain dehydrogenase; Provisional 99.68
PRK08017256 oxidoreductase; Provisional 99.68
PRK06172253 short chain dehydrogenase; Provisional 99.68
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.68
PRK05650270 short chain dehydrogenase; Provisional 99.68
PRK07825273 short chain dehydrogenase; Provisional 99.68
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.68
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.67
PRK07576264 short chain dehydrogenase; Provisional 99.67
PRK07067257 sorbitol dehydrogenase; Provisional 99.67
PRK06197306 short chain dehydrogenase; Provisional 99.67
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.67
PRK05693274 short chain dehydrogenase; Provisional 99.67
PRK07677252 short chain dehydrogenase; Provisional 99.66
PRK06057255 short chain dehydrogenase; Provisional 99.66
PRK07109334 short chain dehydrogenase; Provisional 99.66
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.66
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.66
PRK07041230 short chain dehydrogenase; Provisional 99.66
PRK07774250 short chain dehydrogenase; Provisional 99.66
PRK05875276 short chain dehydrogenase; Provisional 99.66
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.65
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.65
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.65
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.65
PRK07069251 short chain dehydrogenase; Validated 99.65
PRK07775274 short chain dehydrogenase; Provisional 99.65
PRK05872296 short chain dehydrogenase; Provisional 99.65
PRK06139330 short chain dehydrogenase; Provisional 99.65
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.65
PRK06101240 short chain dehydrogenase; Provisional 99.64
PRK06180277 short chain dehydrogenase; Provisional 99.64
PRK06949258 short chain dehydrogenase; Provisional 99.64
PRK05866293 short chain dehydrogenase; Provisional 99.64
PRK07102243 short chain dehydrogenase; Provisional 99.64
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.64
PRK08251248 short chain dehydrogenase; Provisional 99.64
COG0300265 DltE Short-chain dehydrogenases of various substra 99.64
PRK08339263 short chain dehydrogenase; Provisional 99.64
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.63
PRK12746254 short chain dehydrogenase; Provisional 99.63
PRK08278273 short chain dehydrogenase; Provisional 99.63
PRK06483236 dihydromonapterin reductase; Provisional 99.62
PRK06914280 short chain dehydrogenase; Provisional 99.62
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.62
PRK08936261 glucose-1-dehydrogenase; Provisional 99.62
PRK08219227 short chain dehydrogenase; Provisional 99.62
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.62
PRK07074257 short chain dehydrogenase; Provisional 99.62
PRK07023243 short chain dehydrogenase; Provisional 99.62
PRK06128300 oxidoreductase; Provisional 99.62
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.61
PRK07904253 short chain dehydrogenase; Provisional 99.61
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.61
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.61
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.61
PRK07578199 short chain dehydrogenase; Provisional 99.61
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 99.61
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.61
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.6
PRK09134258 short chain dehydrogenase; Provisional 99.6
PRK12827249 short chain dehydrogenase; Provisional 99.6
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 99.6
PRK07831262 short chain dehydrogenase; Provisional 99.6
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.6
PRK09072263 short chain dehydrogenase; Provisional 99.6
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.6
PLN03209 576 translocon at the inner envelope of chloroplast su 99.6
PRK08703239 short chain dehydrogenase; Provisional 99.6
PRK05854313 short chain dehydrogenase; Provisional 99.6
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.6
PRK07890258 short chain dehydrogenase; Provisional 99.59
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.59
PRK06123248 short chain dehydrogenase; Provisional 99.59
PRK12829264 short chain dehydrogenase; Provisional 99.59
PRK07062265 short chain dehydrogenase; Provisional 99.59
PRK07791286 short chain dehydrogenase; Provisional 99.58
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.58
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.58
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.58
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.58
PRK06924251 short chain dehydrogenase; Provisional 99.58
PRK05717255 oxidoreductase; Validated 99.58
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.58
PLN02253280 xanthoxin dehydrogenase 99.58
PRK06194287 hypothetical protein; Provisional 99.58
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.57
PRK06701290 short chain dehydrogenase; Provisional 99.57
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.57
PRK06182273 short chain dehydrogenase; Validated 99.57
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.57
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.57
PRK12828239 short chain dehydrogenase; Provisional 99.57
PRK07060245 short chain dehydrogenase; Provisional 99.57
PRK06500249 short chain dehydrogenase; Provisional 99.56
PRK06138252 short chain dehydrogenase; Provisional 99.56
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.56
PRK05876275 short chain dehydrogenase; Provisional 99.56
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.56
PRK06484520 short chain dehydrogenase; Validated 99.56
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.56
PRK06940275 short chain dehydrogenase; Provisional 99.56
PRK06181263 short chain dehydrogenase; Provisional 99.56
PRK07832272 short chain dehydrogenase; Provisional 99.56
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.55
PRK06953222 short chain dehydrogenase; Provisional 99.55
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.55
PRK05993277 short chain dehydrogenase; Provisional 99.55
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.55
PRK09186256 flagellin modification protein A; Provisional 99.55
PRK08340259 glucose-1-dehydrogenase; Provisional 99.54
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.54
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.54
PRK10538248 malonic semialdehyde reductase; Provisional 99.54
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.54
PRK05855582 short chain dehydrogenase; Validated 99.54
PRK06125259 short chain dehydrogenase; Provisional 99.54
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.54
PRK08628258 short chain dehydrogenase; Provisional 99.54
PRK09009235 C factor cell-cell signaling protein; Provisional 99.54
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.53
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.53
PRK06179270 short chain dehydrogenase; Provisional 99.53
PRK12744257 short chain dehydrogenase; Provisional 99.52
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.52
PRK12743256 oxidoreductase; Provisional 99.52
PRK07024257 short chain dehydrogenase; Provisional 99.52
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.52
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.52
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.51
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.51
PRK08177225 short chain dehydrogenase; Provisional 99.51
COG2910211 Putative NADH-flavin reductase [General function p 99.51
PRK06947248 glucose-1-dehydrogenase; Provisional 99.51
PRK05884223 short chain dehydrogenase; Provisional 99.51
PRK12367245 short chain dehydrogenase; Provisional 99.51
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.51
PRK07985294 oxidoreductase; Provisional 99.5
PRK08264238 short chain dehydrogenase; Validated 99.5
PRK08643256 acetoin reductase; Validated 99.5
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.5
PRK12937245 short chain dehydrogenase; Provisional 99.49
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.49
PRK06101240 short chain dehydrogenase; Provisional 99.49
PRK06523260 short chain dehydrogenase; Provisional 99.49
PRK05693274 short chain dehydrogenase; Provisional 99.49
PRK06841255 short chain dehydrogenase; Provisional 99.49
PRK07578199 short chain dehydrogenase; Provisional 99.49
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.49
PRK07577234 short chain dehydrogenase; Provisional 99.48
PRK07102243 short chain dehydrogenase; Provisional 99.48
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.48
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.48
PRK08267260 short chain dehydrogenase; Provisional 99.47
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.47
PRK06398258 aldose dehydrogenase; Validated 99.47
PRK12939250 short chain dehydrogenase; Provisional 99.47
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.47
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.47
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 99.46
PRK12747252 short chain dehydrogenase; Provisional 99.46
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.46
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.46
PRK07856252 short chain dehydrogenase; Provisional 99.46
PLN02780320 ketoreductase/ oxidoreductase 99.45
PRK08017256 oxidoreductase; Provisional 99.45
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.45
PRK07454241 short chain dehydrogenase; Provisional 99.44
PRK08324681 short chain dehydrogenase; Validated 99.44
PRK07041230 short chain dehydrogenase; Provisional 99.44
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.44
PRK05599246 hypothetical protein; Provisional 99.44
PRK05650270 short chain dehydrogenase; Provisional 99.44
PRK07814263 short chain dehydrogenase; Provisional 99.44
PRK07326237 short chain dehydrogenase; Provisional 99.44
PRK08265261 short chain dehydrogenase; Provisional 99.44
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.43
PRK08251248 short chain dehydrogenase; Provisional 99.43
PRK07825273 short chain dehydrogenase; Provisional 99.43
PRK09291257 short chain dehydrogenase; Provisional 99.43
PRK06949258 short chain dehydrogenase; Provisional 99.43
PRK12742237 oxidoreductase; Provisional 99.43
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.43
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.43
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.42
PRK06196315 oxidoreductase; Provisional 99.42
PRK07023243 short chain dehydrogenase; Provisional 99.41
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.41
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.41
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.41
PRK07677252 short chain dehydrogenase; Provisional 99.41
PRK07035252 short chain dehydrogenase; Provisional 99.41
PRK06057255 short chain dehydrogenase; Provisional 99.4
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.4
PRK08303305 short chain dehydrogenase; Provisional 99.4
PRK07109334 short chain dehydrogenase; Provisional 99.39
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.39
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.39
PRK06483236 dihydromonapterin reductase; Provisional 99.38
PRK08278273 short chain dehydrogenase; Provisional 99.38
PRK06139330 short chain dehydrogenase; Provisional 99.38
COG0300265 DltE Short-chain dehydrogenases of various substra 99.38
PRK07478254 short chain dehydrogenase; Provisional 99.38
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.38
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.38
PRK06198260 short chain dehydrogenase; Provisional 99.38
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.37
PRK08226263 short chain dehydrogenase; Provisional 99.37
PRK08277278 D-mannonate oxidoreductase; Provisional 99.37
PRK09242257 tropinone reductase; Provisional 99.37
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.37
PRK05866293 short chain dehydrogenase; Provisional 99.37
PRK09072263 short chain dehydrogenase; Provisional 99.36
PRK08589272 short chain dehydrogenase; Validated 99.36
PRK06172253 short chain dehydrogenase; Provisional 99.36
PRK06953222 short chain dehydrogenase; Provisional 99.36
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.36
PRK05867253 short chain dehydrogenase; Provisional 99.36
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.36
PRK07576264 short chain dehydrogenase; Provisional 99.35
PRK06197306 short chain dehydrogenase; Provisional 99.35
PRK07069251 short chain dehydrogenase; Validated 99.35
PRK06114254 short chain dehydrogenase; Provisional 99.35
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.35
KOG4288283 consensus Predicted oxidoreductase [General functi 99.35
PRK08862227 short chain dehydrogenase; Provisional 99.34
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.34
PRK05854313 short chain dehydrogenase; Provisional 99.34
PRK07063260 short chain dehydrogenase; Provisional 99.34
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 99.34
PRK06924251 short chain dehydrogenase; Provisional 99.33
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.32
PRK07904253 short chain dehydrogenase; Provisional 99.32
PRK07832272 short chain dehydrogenase; Provisional 99.31
PRK08936261 glucose-1-dehydrogenase; Provisional 99.31
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.31
PRK05872296 short chain dehydrogenase; Provisional 99.31
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.31
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.31
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.31
PLN00015308 protochlorophyllide reductase 99.3
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.3
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.3
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.29
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 99.29
PRK05855582 short chain dehydrogenase; Validated 99.29
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information 
Probab=100.00  E-value=2.2e-88  Score=753.85  Aligned_cols=663  Identities=89%  Similarity=1.403  Sum_probs=547.8

Q ss_pred             CCCCCCeEEEEcCCChhHHHHHHHHHHhCCCCEEEEEcCCCccCCccccCCCcCCCCeEEEEccCCCHHHHHHHhccCCC
Q 005949            2 ATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVKGDIASADLVNFLLITESI   81 (668)
Q Consensus         2 ~~~~~~~vLVtGgtG~iG~~l~~~L~~~g~~~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~~Dl~d~~~~~~~~~~~~~   81 (668)
                      ..+++|+|||||||||||++|++.|++++++++|+++++.........+.......+++++.+|+.|.+.+..++...++
T Consensus         2 ~~~~~~~VLVTGatGfIG~~lv~~Ll~~g~~~~V~~~d~~~~~~~~~~l~~~~~~~~v~~~~~Dl~d~~~~~~~~~~~~~   81 (668)
T PLN02260          2 ATYEPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFVKGDIASADLVNYLLITEGI   81 (668)
T ss_pred             CCCCCCEEEEECCCcHHHHHHHHHHHHhCCCCEEEEEeCCCccchhhhhhhcccCCCeEEEECCCCChHHHHHHHhhcCC
Confidence            45678999999999999999999999998789999998753222222222222234789999999999988887755789


Q ss_pred             CEEEEcCccCCcccccCChHHHHHHHHHHHHHHHHHHHHcCCCcEEEEEcCccccCCCCCCcCCCCCCCCCCCCCChhHH
Q 005949           82 DTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSA  161 (668)
Q Consensus        82 d~Vih~a~~~~~~~~~~~~~~~~~~nv~~~~~l~~~~~~~~~~~~~v~~SS~~vyg~~~~~~~~~~~e~~~~~p~~~Y~~  161 (668)
                      |+|||+|+....+.++.++.+++++|+.+|.+|+++|++.+.+++|||+||..+||........+..|+.+..|.++|+.
T Consensus        82 D~ViHlAa~~~~~~~~~~~~~~~~~Nv~gt~~ll~a~~~~~~vkr~I~~SS~~vyg~~~~~~~~~~~E~~~~~p~~~Y~~  161 (668)
T PLN02260         82 DTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDADVGNHEASQLLPTNPYSA  161 (668)
T ss_pred             CEEEECCCccCchhhhhCHHHHHHHHHHHHHHHHHHHHhcCCCcEEEEEcchHHhCCCccccccCccccCCCCCCCCcHH
Confidence            99999999877666666778899999999999999999977689999999999999876544334467777778899999


Q ss_pred             HHHHHHHHHHHHHHhcCCCEEEEeeCceeCCCCCCCChHHHHHHHHHcCCCceeecCCCceEeceeHHHHHHHHHHHHhc
Q 005949          162 TKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILHK  241 (668)
Q Consensus       162 sK~~~E~~~~~~~~~~~~~~~ilR~~~v~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~D~a~ai~~~~~~  241 (668)
                      +|..+|.+++.+.++++++++++||++||||++.+..+++.++..+..++++.+++++.+.++|+|++|+|+++..++++
T Consensus       162 sK~~aE~~v~~~~~~~~l~~vilR~~~VyGp~~~~~~~i~~~~~~a~~g~~i~i~g~g~~~r~~ihV~Dva~a~~~~l~~  241 (668)
T PLN02260        162 TKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMQGKPLPIHGDGSNVRSYLYCEDVAEAFEVVLHK  241 (668)
T ss_pred             HHHHHHHHHHHHHHHcCCCEEEECcccccCcCCCcccHHHHHHHHHhCCCCeEEecCCCceEeeEEHHHHHHHHHHHHhc
Confidence            99999999999988889999999999999999877778888888888888888889999999999999999999999988


Q ss_pred             CCCCceEEEcCCCcccHHHHHHHHHHHhCCCCCcceEeccCCCCCCcccccChHHHHhCCCcccCCHHHHHHHHHHHHhh
Q 005949          242 GEVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLTSLGWSERTIWEEGLRKTIEWYTQ  321 (668)
Q Consensus       242 ~~~~~~~ni~~~~~~s~~el~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~k~~~lG~~~~~~~~~~l~~~~~~~~~  321 (668)
                      ...+++||+++++.+++.|+++.+++.+|.++...+...+.+++....+.+|++|+++|||+|+++++|+|+++++||++
T Consensus       242 ~~~~~vyni~~~~~~s~~el~~~i~~~~g~~~~~~i~~~~~~p~~~~~~~~d~~k~~~lGw~p~~~~~egl~~~i~w~~~  321 (668)
T PLN02260        242 GEVGHVYNIGTKKERRVIDVAKDICKLFGLDPEKSIKFVENRPFNDQRYFLDDQKLKKLGWQERTSWEEGLKKTMEWYTS  321 (668)
T ss_pred             CCCCCEEEECCCCeeEHHHHHHHHHHHhCCCCcceeeecCCCCCCcceeecCHHHHHHcCCCCCCCHHHHHHHHHHHHHh
Confidence            77788999999999999999999999999865544555556666666778999999999999999999999999999999


Q ss_pred             CCCcccccCCCCCCCCcccccCCCCCCCCcccccccccccccccccccccccccCCCCCCCCcEEEEEcCCcchhHHHHH
Q 005949          322 NPDWWGDVSGALLPHPRMLMMPGGRHFDGSEENKAVSSVSTNNIQSRMVVPVSKCSSPRKPSMKFLIYGRTGWIGGLLGK  401 (668)
Q Consensus       322 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~mkvli~G~~G~iG~~l~~  401 (668)
                      ++.+|++.++++.+||++.++++...++..++.....   .+........+.........++||||||||+||||++|++
T Consensus       322 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~mkiLVtGa~G~iG~~l~~  398 (668)
T PLN02260        322 NPDWWGDVSGALLPHPRMLMMPGVRLFDGSEEIKLSS---SGSQTGLVVVTKPAGSSPGKPSLKFLIYGRTGWIGGLLGK  398 (668)
T ss_pred             ChhhhhccccccccCCCcccccccccccchhhhcccc---ccccccccccccccccCCCCCCceEEEECCCchHHHHHHH
Confidence            9999999999999999998888766666555533111   0000000001111123344456899999999999999999


Q ss_pred             HHHHcCCcccccccccCChhHHHHHhhhcCCCEEEEcccccCCCCccccccccccceehhhhhhHHHHHHHHHcCCcEEE
Q 005949          402 LCEKEGIPFEYGKGRLEDCSSLIADVQSVKPTHVFNAAGVTGRPNVDWCESHKTDTIRTNVAGTLTLADVCRDHGILMMN  481 (668)
Q Consensus       402 ~l~~~g~~v~~~~~D~~d~~~~~~~l~~~~~d~Vih~a~~~~~~~~~~~~~~~~~~~~~Nv~~~~~ll~~~~~~~~~~v~  481 (668)
                      .|.++|++|.+..+|++|.+.+.+.+...+||+|||||++++.+.+++++.++...+++|+.|+.+|+++|++.++++++
T Consensus       399 ~L~~~g~~v~~~~~~l~d~~~v~~~i~~~~pd~Vih~Aa~~~~~~~~~~~~~~~~~~~~N~~gt~~l~~a~~~~g~~~v~  478 (668)
T PLN02260        399 LCEKQGIAYEYGKGRLEDRSSLLADIRNVKPTHVFNAAGVTGRPNVDWCESHKVETIRANVVGTLTLADVCRENGLLMMN  478 (668)
T ss_pred             HHHhCCCeEEeeccccccHHHHHHHHHhhCCCEEEECCcccCCCCCChHHhCHHHHHHHHhHHHHHHHHHHHHcCCeEEE
Confidence            99999999877788999999999999988999999999998655567788899999999999999999999999999999


Q ss_pred             EecceeEeecCCCCCCCCCCCCCCCCCCCCCCcchhhHHHHHHHHHhccCeeEeEEeeeecCCCCChhhHHHHhhcccce
Q 005949          482 YATGCIFEYDAAHPEGSGIGYKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSDLNNPRNFITKISRYNKV  561 (668)
Q Consensus       482 ~sS~~vy~~~~~~p~~~~~~~~ee~~~~~~~~~Y~~sK~~~E~~~~~~~~~~~l~~~~~r~~~~~g~~~~~~~~~~~~~~  561 (668)
                      +||++||++....|.+.+.++.|++.+.++.+.||.||+++|++++.+.+.+++|+++++.+..+++.+|+..+++....
T Consensus       479 ~Ss~~v~~~~~~~~~~~~~p~~E~~~~~~~~~~Yg~sK~~~E~~~~~~~~~~~~r~~~~~~~~~~~~~nfv~~~~~~~~~  558 (668)
T PLN02260        479 FATGCIFEYDAKHPEGSGIGFKEEDKPNFTGSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLSNPRNFITKISRYNKV  558 (668)
T ss_pred             EcccceecCCcccccccCCCCCcCCCCCCCCChhhHHHHHHHHHHHhhhhheEEEEEEecccCCCCccHHHHHHhcccee
Confidence            99999997643222112235777777777779999999999999999988889999999887777888999999988776


Q ss_pred             eecCCCcccHhhHHHHHHHHHhccCCceeeecCCCccCHHHHHHHHHhhcCCCCCCCCCCHHHhhhhhccCCCCCccChh
Q 005949          562 VNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYINPEFKWVNFTLEEQAKVIVAPRSNNEMDAS  641 (668)
Q Consensus       562 ~~~~~~~~~v~D~a~~~~~~~~~~~~g~~ni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~ld~~  641 (668)
                      ..++.+..+++|++.+++.++++..+|+||+++++.+|++||++.+++.++....+.++...+.....+..++...||++
T Consensus       559 ~~vp~~~~~~~~~~~~~~~l~~~~~~giyni~~~~~~s~~e~a~~i~~~~~~~~~~~~~~~~~~~~~~~a~rp~~~l~~~  638 (668)
T PLN02260        559 VNIPNSMTVLDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMYKDYIDPGFKWSNFTLEEQAKVIVAPRSNNEMDAS  638 (668)
T ss_pred             eccCCCceehhhHHHHHHHHHHhCCCceEEecCCCcCcHHHHHHHHHHhcCCcccccccCHHHhhhHhhCCCccccccHH
Confidence            66677888999999999999886667999999999999999999999987533224455555433224566666699999


Q ss_pred             HHHhhcCCccChHHHHHHHHhccCCC
Q 005949          642 KLKKEFPELLSIKDSLIKYVFEPNKK  667 (668)
Q Consensus       642 k~~~~~g~~~~~~~~l~~~~~~~~~~  667 (668)
                      |+++.++.+++|+++|.+++.+.+++
T Consensus       639 k~~~~~~~~~~~~~~l~~~~~~~~~~  664 (668)
T PLN02260        639 KLKKEFPELLSIKESLIKYVFEPNKK  664 (668)
T ss_pred             HHHHhCccccchHHHHHHHHhhhhhh
Confidence            99998877789999999999988765

>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query668
2hun_A336 Crystal Structure Of Hypothetical Protein Ph0414 Fr 4e-70
4egb_A346 3.0 Angstrom Resolution Crystal Structure Of Dtdp-G 2e-65
1bxk_A355 Dtdp-Glucose 4,6-Dehydratase From E. Coli Length = 2e-64
1g1a_A361 The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydra 5e-64
1r66_A337 Crystal Structure Of Desiv (Dtdp-Glucose 4,6-Dehydr 1e-61
1r6d_A337 Crystal Structure Of Desiv Double Mutant (Dtdp-Gluc 1e-60
1kep_A348 The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydra 3e-53
3vps_A321 Structure Of A Novel Nad Dependent-Ndp-Hexosamine 5 9e-27
2p5u_A311 Crystal Structure Of Thermus Thermophilus Hb8 Udp-G 2e-25
4ef7_B337 Udp-Xylose Synthase Length = 337 2e-24
3ehe_A313 Crystal Structure Of Udp-Glucose 4 Epimerase (Gale- 5e-24
2pzj_A377 Crystal Structure Of The Bordetella Bronchiseptica 2e-23
3icp_A312 Crystal Structure Of Udp-Galactose 4-Epimerase Leng 2e-23
1kvs_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 2e-23
1lrj_A338 Crystal Structure Of E. Coli Udp-Galactose 4-Epimer 4e-23
2udp_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 4e-23
1kvr_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 6e-23
1kvq_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 6e-23
1kvt_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 7e-23
2b69_A343 Crystal Structure Of Human Udp-Glucoronic Acid Deca 7e-23
1kvu_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 1e-22
1a9z_A338 Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEX 1e-22
1a9y_A338 Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEX 2e-22
3aw9_A308 Structure Of Udp-Galactose 4-Epimerase Mutant Lengt 4e-22
1lrk_A338 Crystal Structure Of Escherichia Coli Udp-Galactose 5e-22
1orr_A347 Crystal Structure Of Cdp-tyvelose 2-epimerase Compl 4e-21
2pk3_A321 Crystal Structure Of A Gdp-4-Keto-6-Deoxy-D-Mannose 5e-21
3lu1_A364 Crystal Structure Analysis Of Wbgu: A Udp-Galnac 4- 3e-20
3ru9_A351 Specific Recognition Of N-Acetylated Substrates And 3e-20
3ru7_A351 Specific Recognition Of N-Acetylated Substrates And 3e-20
2c20_A330 Crystal Structure Of Udp-Glucose 4-Epimerase Length 6e-20
3ruc_A351 Specific Recognition Of N-Acetylated Substrates And 9e-20
1sb8_A352 Crystal Structure Of Pseudomonas Aeruginosa Udp-N-A 1e-18
3sxp_A362 Crystal Structure Of Helicobacter Pylori Adp-L-Glyc 5e-16
1z45_A699 Crystal Structure Of The Gal10 Fusion Protein Galac 5e-14
3m2p_A311 The Crystal Structure Of Udp-N-Acetylglucosamine 4- 3e-13
1gy8_A397 Trypanosoma Brucei Udp-Galactose 4' Epimerase Lengt 6e-11
1bws_A321 Crystal Structure Of Gdp-4-Keto-6-Deoxy-D-Mannose E 1e-10
1e6u_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Le 2e-10
1e7q_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase S1 3e-10
1bsv_A321 Gdp-Fucose Synthetase From Escherichia Coli Complex 3e-10
1e7s_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase K1 6e-10
2c59_A379 Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana 8e-10
2c54_A379 Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana 2e-09
1hzj_A348 Human Udp-Galactose 4-Epimerase: Accommodation Of U 2e-09
1ek5_A348 Structure Of Human Udp-Galactose 4-Epimerase In Com 2e-09
1wvg_A359 Structure Of Cdp-D-Glucose 4,6-Dehydratase From Sal 2e-09
2c5a_A379 Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana 2e-09
1e7r_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Y1 3e-09
1i3k_A348 Molecular Basis For Severe Epimerase-Deficiency Gal 3e-09
2c5e_A379 Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana 4e-09
3enk_A341 1.9a Crystal Structure Of Udp-Glucose 4-Epimerase F 2e-08
1rkx_A357 Crystal Structure At 1.8 Angstrom Of Cdp-D-Glucose 7e-08
1db3_A372 E.Coli Gdp-Mannose 4,6-Dehydratase Length = 372 1e-06
2bll_A345 Apo-Structure Of The C-Terminal Decarboxylase Domai 2e-06
3a1n_A317 Crystal Structure Of L-Threonine Dehydrogenase From 2e-06
1z75_A358 Crystal Structure Of Arna Dehydrogenase (decarboxyl 2e-06
1u9j_A358 Crystal Structure Of E. Coli Arna (Pmri) Decarboxyl 2e-06
1z74_A358 Crystal Structure Of E.Coli Arna Dehydrogenase (Dec 2e-06
1z7b_A358 Crystal Structure Of E.Coli Arna Dehydrogenase (Dec 2e-06
1t2a_A375 Crystal Structure Of Human Gdp-D-Mannose 4,6-Dehydr 2e-06
1z73_A358 Crystal Structure Of E. Coli Arna Dehydrogenase (de 3e-06
1z7e_A660 Crystal Structure Of Full Length Arna Length = 660 3e-06
2q1w_A333 Crystal Structure Of The Bordetella Bronchiseptica 5e-06
3a9w_A317 Crystal Structure Of L-Threonine Bound L-Threonine 5e-06
3slg_A372 Crystal Structure Of Pbgp3 Protein From Burkholderi 8e-06
4f6l_B508 Crystal Structure Of Aureusimine Biosynthetic Clust 9e-06
4f6c_A427 Crystal Structure Of Aureusimine Biosynthetic Clust 2e-05
1rpn_A335 Crystal Structure Of Gdp-D-Mannose 4,6-Dehydratase 6e-05
2gn4_A344 Crystal Structure Of Udp-Glcnac Inverting 4,6-Dehyd 1e-04
2p4h_X322 Crystal Structure Of Vestitone Reductase From Alfal 6e-04
3rft_A267 Crystal Structure Of Uronate Dehydrogenase From Agr 7e-04
2z1m_A345 Crystal Structure Of Gdp-D-Mannose Dehydratase From 8e-04
2pzk_A330 Crystal Structure Of The Bordetella Bronchiseptica 8e-04
>pdb|2HUN|A Chain A, Crystal Structure Of Hypothetical Protein Ph0414 From Pyrococcus Horikoshii Ot3 Length = 336 Back     alignment and structure 
Iteration: 1

 Score =  262 bits (670), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 137/330 (41%), Positives = 203/330 (61%), Gaps = 7/330 (2%)
Query: 9   ILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVKGDIAS 68
           +L+TG  GFI S+    ++  +P+++++ +DKL Y SN  NL   +    + FVKGD+A 
Sbjct: 6   LLVTGGMGFIGSNFIRYILEKHPDWEVINIDKLGYGSNPANLKDLEDDPRYTFVKGDVAD 65
Query: 69  ADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFI 128
            +LV  L+    +D ++H AA++HVD S  +   F  +N+ GT+ LLE+ +      RF+
Sbjct: 66  YELVKELV--RKVDGVVHLAAESHVDRSISSPEIFLHSNVIGTYTLLESIRRENPEVRFV 123
Query: 129 HVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNN 188
           HVSTDEVYG+  + +   N    +L+P++PYSATKA ++MLV+ + R+Y L    TR  N
Sbjct: 124 HVSTDEVYGDILKGSFTEN---DRLMPSSPYSATKAASDMLVLGWTRTYNLNASITRCTN 180
Query: 189 VYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILHKGEVGHVY 248
            YGP QFPEKLIPK I+ A  GL +PI+G G NVR +LY ED   A E +L KGE   +Y
Sbjct: 181 NYGPYQFPEKLIPKTIIRASLGLKIPIYGTGKNVRDWLYVEDHVRAIELVLLKGESREIY 240
Query: 249 NVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLT-SLGWSERTI 307
           N+   +E+  ++V K I +L     E  I+ VE+RP +D RY LD  K+T  L W  +  
Sbjct: 241 NISAGEEKTNLEVVKIILRLMGKGEEL-IELVEDRPGHDLRYSLDSWKITRDLKWRPKYT 299
Query: 308 WEEGLRKTIEWYTQNPDWWGDVSGALLPHP 337
           ++EG++KTI+WY +N  WW  +    + HP
Sbjct: 300 FDEGIKKTIDWYLKNEWWWKPLVDERILHP 329
>pdb|4EGB|A Chain A, 3.0 Angstrom Resolution Crystal Structure Of Dtdp-Glucose 4,6- Dehydratase (Rfbb) From Bacillus Anthracis Str. Ames In Complex With Nad Length = 346 Back     alignment and structure
>pdb|1BXK|A Chain A, Dtdp-Glucose 4,6-Dehydratase From E. Coli Length = 355 Back     alignment and structure
>pdb|1G1A|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase (Rmlb)from Salmonella Enterica Serovar Typhimurium Length = 361 Back     alignment and structure
>pdb|1R66|A Chain A, Crystal Structure Of Desiv (Dtdp-Glucose 4,6-Dehydratase) From Streptomyces Venezuelae With Nad And Tyd Bound Length = 337 Back     alignment and structure
>pdb|1R6D|A Chain A, Crystal Structure Of Desiv Double Mutant (Dtdp-Glucose 4,6- Dehydratase) From Streptomyces Venezuelae With Nad And Dau Bound Length = 337 Back     alignment and structure
>pdb|1KEP|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase (Rmlb) From Streptococcus Suis With Dtdp-Xylose Bound Length = 348 Back     alignment and structure
>pdb|3VPS|A Chain A, Structure Of A Novel Nad Dependent-Ndp-Hexosamine 5,6-Dehydratase, Tuna, Involved In Tunicamycin Biosynthesis Length = 321 Back     alignment and structure
>pdb|2P5U|A Chain A, Crystal Structure Of Thermus Thermophilus Hb8 Udp-Glucose 4- Epimerase Complex With Nad Length = 311 Back     alignment and structure
>pdb|3EHE|A Chain A, Crystal Structure Of Udp-Glucose 4 Epimerase (Gale-1) From Archaeoglobus Fulgidus Length = 313 Back     alignment and structure
>pdb|2PZJ|A Chain A, Crystal Structure Of The Bordetella Bronchiseptica Enzyme Wbmf In Complex With Nad+ Length = 377 Back     alignment and structure
>pdb|3ICP|A Chain A, Crystal Structure Of Udp-Galactose 4-Epimerase Length = 312 Back     alignment and structure
>pdb|1KVS|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1LRJ|A Chain A, Crystal Structure Of E. Coli Udp-Galactose 4-Epimerase Complexed With Udp-N-Acetylglucosamine Length = 338 Back     alignment and structure
>pdb|2UDP|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVR|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVQ|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVT|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|2B69|A Chain A, Crystal Structure Of Human Udp-Glucoronic Acid Decarboxylase Length = 343 Back     alignment and structure
>pdb|1KVU|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1A9Z|A Chain A, Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEXED WITH UDP- Galactose Length = 338 Back     alignment and structure
>pdb|1A9Y|A Chain A, Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEXED WITH UDP- Glucose Length = 338 Back     alignment and structure
>pdb|3AW9|A Chain A, Structure Of Udp-Galactose 4-Epimerase Mutant Length = 308 Back     alignment and structure
>pdb|1LRK|A Chain A, Crystal Structure Of Escherichia Coli Udp-Galactose 4-Epimerase Mutant Y299c Complexed With Udp-N-Acetylglucosamine Length = 338 Back     alignment and structure
>pdb|1ORR|A Chain A, Crystal Structure Of Cdp-tyvelose 2-epimerase Complexed With Nad And Cdp Length = 347 Back     alignment and structure
>pdb|2PK3|A Chain A, Crystal Structure Of A Gdp-4-Keto-6-Deoxy-D-Mannose Reductase Length = 321 Back     alignment and structure
>pdb|3LU1|A Chain A, Crystal Structure Analysis Of Wbgu: A Udp-Galnac 4-Epimerase Length = 364 Back     alignment and structure
>pdb|3RU9|A Chain A, Specific Recognition Of N-Acetylated Substrates And Domain Flexibility In Wbgu: A Udp-Galnac 4-Epimerase Length = 351 Back     alignment and structure
>pdb|3RU7|A Chain A, Specific Recognition Of N-Acetylated Substrates And Domain Flexibility In Wbgu: A Udp-Galnac 4-Epimerase Length = 351 Back     alignment and structure
>pdb|2C20|A Chain A, Crystal Structure Of Udp-Glucose 4-Epimerase Length = 330 Back     alignment and structure
>pdb|3RUC|A Chain A, Specific Recognition Of N-Acetylated Substrates And Domain Flexibility In Wbgu: A Udp-Galnac 4-Epimerase Length = 351 Back     alignment and structure
>pdb|1SB8|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa Udp-N-Acetylglucosamine 4- Epimerase Complexed With Udp-N-Acetylgalactosamine Length = 352 Back     alignment and structure
>pdb|3SXP|A Chain A, Crystal Structure Of Helicobacter Pylori Adp-L-Glycero-D-Manno- Heptose-6-Epimerase (Rfad, Hp0859) Length = 362 Back     alignment and structure
>pdb|1Z45|A Chain A, Crystal Structure Of The Gal10 Fusion Protein Galactose MutarotaseUDP-Galactose 4-Epimerase From Saccharomyces Cerevisiae Complexed With Nad, Udp-Glucose, And Galactose Length = 699 Back     alignment and structure
>pdb|3M2P|A Chain A, The Crystal Structure Of Udp-N-Acetylglucosamine 4-Epimerase From Bacillus Cereus Length = 311 Back     alignment and structure
>pdb|1GY8|A Chain A, Trypanosoma Brucei Udp-Galactose 4' Epimerase Length = 397 Back     alignment and structure
>pdb|1BWS|A Chain A, Crystal Structure Of Gdp-4-Keto-6-Deoxy-D-Mannose EpimeraseREDUCTASE From Escherichia Coli A Key Enzyme In The Biosynthesis Of Gdp-L- Fucose Length = 321 Back     alignment and structure
>pdb|1E6U|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Length = 321 Back     alignment and structure
>pdb|1E7Q|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase S107a Length = 321 Back     alignment and structure
>pdb|1BSV|A Chain A, Gdp-Fucose Synthetase From Escherichia Coli Complex With Nadph Length = 321 Back     alignment and structure
>pdb|1E7S|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase K140r Length = 321 Back     alignment and structure
>pdb|2C59|A Chain A, Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana), With Gdp-Alpha-D-Mannose And Gdp-Beta-L-Galactose Bound In The Active Site. Length = 379 Back     alignment and structure
>pdb|2C54|A Chain A, Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana), K178r, With Gdp-Beta-L-Gulose And Gdp-4-Keto-Beta-L-Gulose Bound In Active Site. Length = 379 Back     alignment and structure
>pdb|1HZJ|A Chain A, Human Udp-Galactose 4-Epimerase: Accommodation Of Udp-N- Acetylglucosamine Within The Active Site Length = 348 Back     alignment and structure
>pdb|1EK5|A Chain A, Structure Of Human Udp-Galactose 4-Epimerase In Complex With Nad+ Length = 348 Back     alignment and structure
>pdb|1WVG|A Chain A, Structure Of Cdp-D-Glucose 4,6-Dehydratase From Salmonella Typhi Length = 359 Back     alignment and structure
>pdb|2C5A|A Chain A, Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana), Y174f, With Gdp-Beta-L-Galactose Bound In The Active Site Length = 379 Back     alignment and structure
>pdb|1E7R|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Y136e Length = 321 Back     alignment and structure
>pdb|1I3K|A Chain A, Molecular Basis For Severe Epimerase-Deficiency Galactosemia: X-Ray Structure Of The Human V94m- Substituted Udp-Galactose 4-Epimerase Length = 348 Back     alignment and structure
>pdb|2C5E|A Chain A, Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana), K217a, With Gdp-Alpha-D-Mannose Bound In The Active Site. Length = 379 Back     alignment and structure
>pdb|3ENK|A Chain A, 1.9a Crystal Structure Of Udp-Glucose 4-Epimerase From Burkholderia Pseudomallei Length = 341 Back     alignment and structure
>pdb|1RKX|A Chain A, Crystal Structure At 1.8 Angstrom Of Cdp-D-Glucose 4,6- Dehydratase From Yersinia Pseudotuberculosis Length = 357 Back     alignment and structure
>pdb|1DB3|A Chain A, E.Coli Gdp-Mannose 4,6-Dehydratase Length = 372 Back     alignment and structure
>pdb|2BLL|A Chain A, Apo-Structure Of The C-Terminal Decarboxylase Domain Of Arna Length = 345 Back     alignment and structure
>pdb|3A1N|A Chain A, Crystal Structure Of L-Threonine Dehydrogenase From Hyperthermophilic Archaeon Thermoplasma Volcanium Length = 317 Back     alignment and structure
>pdb|1Z75|A Chain A, Crystal Structure Of Arna Dehydrogenase (decarboxylase) Domain, R619m Mutant Length = 358 Back     alignment and structure
>pdb|1U9J|A Chain A, Crystal Structure Of E. Coli Arna (Pmri) Decarboxylase Domain Length = 358 Back     alignment and structure
>pdb|1Z74|A Chain A, Crystal Structure Of E.Coli Arna Dehydrogenase (Decarboxylase) Domain, R619y Mutant Length = 358 Back     alignment and structure
>pdb|1Z7B|A Chain A, Crystal Structure Of E.Coli Arna Dehydrogenase (Decarboxylase) Domain, R619e Mutant Length = 358 Back     alignment and structure
>pdb|1T2A|A Chain A, Crystal Structure Of Human Gdp-D-Mannose 4,6-Dehydratase Length = 375 Back     alignment and structure
>pdb|1Z73|A Chain A, Crystal Structure Of E. Coli Arna Dehydrogenase (decarboxylase) Domain, S433a Mutant Length = 358 Back     alignment and structure
>pdb|1Z7E|A Chain A, Crystal Structure Of Full Length Arna Length = 660 Back     alignment and structure
>pdb|2Q1W|A Chain A, Crystal Structure Of The Bordetella Bronchiseptica Enzyme Wbmh In Complex With Nad+ Length = 333 Back     alignment and structure
>pdb|3A9W|A Chain A, Crystal Structure Of L-Threonine Bound L-Threonine Dehydrogenase (Y137f) From Hyperthermophilic Archaeon Thermoplasma Volcanium Length = 317 Back     alignment and structure
>pdb|3SLG|A Chain A, Crystal Structure Of Pbgp3 Protein From Burkholderia Pseudomallei Length = 372 Back     alignment and structure
>pdb|4F6L|B Chain B, Crystal Structure Of Aureusimine Biosynthetic Cluster Reductase Domain Length = 508 Back     alignment and structure
>pdb|4F6C|A Chain A, Crystal Structure Of Aureusimine Biosynthetic Cluster Reductase Domain Length = 427 Back     alignment and structure
>pdb|1RPN|A Chain A, Crystal Structure Of Gdp-D-Mannose 4,6-Dehydratase In Complexes With Gdp And Nadph Length = 335 Back     alignment and structure
>pdb|2GN4|A Chain A, Crystal Structure Of Udp-Glcnac Inverting 4,6-Dehydratase In Complex With Nadph And Udp-Glcnac Length = 344 Back     alignment and structure
>pdb|2P4H|X Chain X, Crystal Structure Of Vestitone Reductase From Alfalfa (Medicago Sativa L.) Length = 322 Back     alignment and structure
>pdb|3RFT|A Chain A, Crystal Structure Of Uronate Dehydrogenase From Agrobacterium Tumefaciens Length = 267 Back     alignment and structure
>pdb|2Z1M|A Chain A, Crystal Structure Of Gdp-D-Mannose Dehydratase From Aquifex Aeolicus Vf5 Length = 345 Back     alignment and structure
>pdb|2PZK|A Chain A, Crystal Structure Of The Bordetella Bronchiseptica Enzyme Wbmg In Complex With Nad Length = 330 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query668
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 1e-138
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 1e-138
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 1e-136
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 1e-134
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 1e-130
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 1e-127
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 1e-109
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 1e-101
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 4e-87
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 1e-84
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 1e-05
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 3e-79
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 8e-74
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 3e-73
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 6e-71
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 2e-06
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 4e-66
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 6e-66
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 1e-05
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 3e-63
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 8e-06
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 7e-62
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 5e-59
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 2e-58
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 1e-57
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 2e-04
3slg_A372 PBGP3 protein; structural genomics, seattle struct 6e-57
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 1e-54
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 1e-07
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 6e-54
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 2e-53
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 6e-53
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 2e-51
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 1e-48
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 3e-06
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 5e-42
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 2e-04
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 2e-41
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 6e-04
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 3e-40
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 1e-07
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 1e-38
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 5e-05
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1e-31
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 1e-29
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 1e-04
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 6e-29
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 4e-28
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 1e-27
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 2e-27
1z45_A699 GAL10 bifunctional protein; epimerase, mutarotase, 8e-24
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 1e-22
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 6e-21
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 2e-20
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 3e-20
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 1e-18
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 1e-18
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 3e-04
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 3e-17
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 4e-17
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 2e-16
1xq6_A253 Unknown protein; structural genomics, protein stru 4e-15
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 5e-15
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 8e-15
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 3e-11
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 3e-14
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 4e-14
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 4e-09
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 8e-14
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 2e-13
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 4e-09
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 5e-13
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 5e-12
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 1e-09
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 1e-08
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 9e-09
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 1e-08
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 1e-08
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 2e-08
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 2e-08
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 4e-08
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 4e-08
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 1e-07
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 1e-07
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 2e-07
3ius_A286 Uncharacterized conserved protein; APC63810, silic 4e-07
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 4e-07
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 5e-07
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 6e-07
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 2e-06
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 6e-06
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 7e-06
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 2e-05
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 8e-05
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 6e-05
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Length = 336 Back     alignment and structure
 Score =  408 bits (1050), Expect = e-138
 Identities = 136/331 (41%), Positives = 201/331 (60%), Gaps = 10/331 (3%)

Query: 5   TPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVKG 64
               +L+TG  GFI S+    ++  +P+++++ +DKL Y SN  NL   +    + FVKG
Sbjct: 2   HSMKLLVTGGMGFIGSNFIRYILEKHPDWEVINIDKLGYGSNPANLKDLEDDPRYTFVKG 61

Query: 65  DIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQI 124
           D+A  +LV  L+    +D ++H AA++HVD S  +   F  +N+ GT+ LLE+ +     
Sbjct: 62  DVADYELVKELV--RKVDGVVHLAAESHVDRSISSPEIFLHSNVIGTYTLLESIRRENPE 119

Query: 125 RRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITT 184
            RF+HVSTDEVYG+  + +     E  +L+P++PYSATKA ++MLV+ + R+Y L    T
Sbjct: 120 VRFVHVSTDEVYGDILKGSF---TENDRLMPSSPYSATKAASDMLVLGWTRTYNLNASIT 176

Query: 185 RGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILHKGEV 244
           R  N YGP QFPEKLIPK I+ A  GL +PI+G G NVR +LY ED   A E +L KGE 
Sbjct: 177 RCTNNYGPYQFPEKLIPKTIIRASLGLKIPIYGTGKNVRDWLYVEDHVRAIELVLLKGES 236

Query: 245 GHVYNVGTKKERRVIDVAKDICKLFSMD-PETSIKFVENRPFNDQRYFLDDQKLTS-LGW 302
             +YN+   +E+  ++V K I +L  M   E  I+ VE+RP +D RY LD  K+T  L W
Sbjct: 237 REIYNISAGEEKTNLEVVKIILRL--MGKGEELIELVEDRPGHDLRYSLDSWKITRDLKW 294

Query: 303 SERTIWEEGLRKTIEWYTQNPDWWGDV-SGA 332
             +  ++EG++KTI+WY +N  WW  +    
Sbjct: 295 RPKYTFDEGIKKTIDWYLKNEWWWKPLVDER 325
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Length = 346 Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Length = 337 Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Length = 348 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Length = 361 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Length = 347 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Length = 377 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Length = 321 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Length = 404 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Length = 404 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} Length = 313 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} PDB: 3icp_A* 3aw9_A* Length = 312 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Length = 351 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Length = 362 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Length = 310 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Length = 357 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Length = 372 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Length = 343 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Length = 379 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Length = 345 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Length = 267 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Length = 369 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Length = 369 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Length = 330 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Length = 330 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Length = 357 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Length = 397 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Length = 397 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Length = 348 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} Length = 341 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Length = 338 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Length = 699 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Length = 321 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Length = 364 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Length = 478 Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Length = 321 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Length = 286 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Length = 344 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Length = 337 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Length = 273 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Length = 273 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Length = 338 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Length = 292 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Length = 292 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Length = 322 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} Length = 287 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} Length = 287 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Length = 315 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Length = 315 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Length = 342 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Length = 299 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Length = 299 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Length = 206 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Length = 335 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Length = 372 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Length = 236 Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Length = 345 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 375 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Length = 321 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Length = 224 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Length = 286 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Length = 313 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Length = 307 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Length = 318 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Length = 381 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Length = 215 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Length = 236 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Length = 346 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query668
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 100.0
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 100.0
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 100.0
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 100.0
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 100.0
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 100.0
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 100.0
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 100.0
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 100.0
3slg_A372 PBGP3 protein; structural genomics, seattle struct 100.0
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 100.0
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 100.0
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 100.0
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 100.0
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 100.0
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 100.0
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 100.0
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 100.0
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 100.0
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 100.0
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 100.0
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 100.0
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 100.0
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 100.0
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 100.0
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 100.0
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 100.0
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 100.0
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 100.0
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 100.0
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 100.0
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 100.0
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 100.0
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 100.0
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 100.0
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 100.0
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 100.0
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 100.0
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 100.0
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 100.0
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 100.0
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 100.0
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 100.0
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 100.0
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 100.0
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 100.0
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 100.0
1z45_A699 GAL10 bifunctional protein; epimerase, mutarotase, 100.0
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 100.0
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 100.0
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 100.0
3ius_A286 Uncharacterized conserved protein; APC63810, silic 100.0
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 100.0
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 100.0
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 100.0
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 100.0
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 100.0
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 100.0
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 100.0
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 100.0
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 100.0
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 100.0
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 100.0
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 100.0
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 100.0
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 100.0
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 100.0
3slg_A372 PBGP3 protein; structural genomics, seattle struct 100.0
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 100.0
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 100.0
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 100.0
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 100.0
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 100.0
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 100.0
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 100.0
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 100.0
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 100.0
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 100.0
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 100.0
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 100.0
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 100.0
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 100.0
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 100.0
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 100.0
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 100.0
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 100.0
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 100.0
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 100.0
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 100.0
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 100.0
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 100.0
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 100.0
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 100.0
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 100.0
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 100.0
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 100.0
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 100.0
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 100.0
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 100.0
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 100.0
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 100.0
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 100.0
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.98
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.98
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.98
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.97
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.97
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.97
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.97
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.97
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.97
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.97
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.97
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.97
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.97
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.97
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.97
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.97
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.96
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.96
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.96
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.96
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.96
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.96
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.96
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.96
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.96
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.95
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.95
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.95
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.95
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.95
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.95
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.94
1xq6_A253 Unknown protein; structural genomics, protein stru 99.94
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.94
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.94
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.94
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.94
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.94
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.94
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.94
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.93
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.93
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.93
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.93
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.93
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.92
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.92
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.92
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.92
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.92
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.91
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.91
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.91
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.91
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.91
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.91
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.9
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.9
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.9
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.9
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.9
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.9
1xq6_A253 Unknown protein; structural genomics, protein stru 99.89
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.89
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.89
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.89
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.89
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.88
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.88
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.88
1spx_A278 Short-chain reductase family member (5L265); paral 99.88
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.88
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.88
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.88
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.88
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.87
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.87
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.87
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.87
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.87
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.87
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.86
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.86
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.86
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.86
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.86
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.86
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.86
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.86
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.86
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.86
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.86
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.86
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.86
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.85
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.85
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.85
3rih_A293 Short chain dehydrogenase or reductase; structural 99.85
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.85
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.85
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.85
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.85
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.85
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.85
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.85
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.85
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.85
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.84
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.84
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.84
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.84
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.84
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.84
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.84
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.84
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.84
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.84
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.84
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.84
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.84
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.84
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.84
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.84
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.84
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.84
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.84
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.84
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.84
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.84
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.83
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.83
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.83
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.83
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.83
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.83
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.83
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.83
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.83
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.83
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.83
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.83
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.83
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.83
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.83
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.83
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.83
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.83
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.83
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.83
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.83
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.83
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.82
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.82
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.82
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.82
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.82
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.82
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.82
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.82
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.82
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.82
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.82
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.82
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.82
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.82
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.82
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.82
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.82
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.82
1xkq_A280 Short-chain reductase family member (5D234); parra 99.82
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.82
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.82
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.82
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.82
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.82
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.82
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.82
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.82
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.82
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.82
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.82
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.82
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.82
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.82
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.82
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.82
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.82
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.82
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.81
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.81
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.81
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.81
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.81
4e4y_A244 Short chain dehydrogenase family protein; structur 99.81
3cxt_A291 Dehydrogenase with different specificities; rossma 99.81
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.81
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.81
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.81
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.81
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.81
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.81
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.81
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.81
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.81
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.81
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.81
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.81
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.81
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.81
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.81
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.81
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.8
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.8
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.8
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.8
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.8
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.8
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.8
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.8
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.8
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.8
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.8
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.8
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.8
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.79
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.79
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.79
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.79
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.79
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.79
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.79
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.79
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.79
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.79
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.79
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.79
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.79
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.79
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.78
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.78
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.78
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.78
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.78
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.78
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.78
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.78
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.78
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.78
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.77
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.77
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.77
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.77
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.77
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.77
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.76
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.76
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.76
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.76
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.76
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.76
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.76
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.76
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.76
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.76
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.76
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.76
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.76
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.75
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.75
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.75
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.74
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.74
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.74
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.74
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.73
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.73
1spx_A278 Short-chain reductase family member (5L265); paral 99.73
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.73
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.73
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.73
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.72
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.72
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.72
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.72
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.72
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.72
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.72
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.72
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.72
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.72
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.72
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.72
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.72
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.72
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.72
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.71
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.71
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.71
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.71
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.71
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.71
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.71
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.71
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.71
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.71
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.7
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.7
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.7
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.7
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.7
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.7
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.7
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.7
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.7
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.7
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.7
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.7
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.7
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.7
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.7
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.7
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.7
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.69
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.69
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.69
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.69
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.69
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.69
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.69
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.69
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 99.69
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.69
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.69
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.69
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.69
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.69
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.69
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.69
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.68
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.68
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.68
4e4y_A244 Short chain dehydrogenase family protein; structur 99.68
3rih_A293 Short chain dehydrogenase or reductase; structural 99.68
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.68
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.68
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.68
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.68
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.68
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.68
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.68
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.68
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.68
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.68
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.68
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.67
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.67
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.67
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.67
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.67
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.67
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.67
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.67
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.67
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.67
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.67
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.67
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.66
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.66
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.66
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.66
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.66
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.66
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.66
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.66
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.66
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.66
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.66
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.66
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.66
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.66
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.66
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.66
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.66
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.66
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.65
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.65
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.65
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.65
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.65
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.65
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.65
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.65
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.65
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.65
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.65
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.64
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.64
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.64
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
Probab=100.00  E-value=1.6e-46  Score=387.03  Aligned_cols=322  Identities=39%  Similarity=0.742  Sum_probs=270.8

Q ss_pred             CCCCCeEEEEcCCChhHHHHHHHHHHhCCCCEEEEEcCCCccCCccccCCCcCCCCeEEEEccCCCHHHHHHHhccCCCC
Q 005949            3 TYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVKGDIASADLVNFLLITESID   82 (668)
Q Consensus         3 ~~~~~~vLVtGgtG~iG~~l~~~L~~~g~~~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~~Dl~d~~~~~~~~~~~~~d   82 (668)
                      ++++|+|||||||||||++|++.|+++|+.++|++++|.........+.......+++++.+|+.|.+.+.+++...++|
T Consensus        21 ~~~~~~vlVtGatG~iG~~l~~~L~~~g~~~~v~~~~~~~~~~~~~~l~~~~~~~~~~~~~~Dl~d~~~~~~~~~~~~~d  100 (346)
T 4egb_A           21 QSNAMNILVTGGAGFIGSNFVHYMLQSYETYKIINFDALTYSGNLNNVKSIQDHPNYYFVKGEIQNGELLEHVIKERDVQ  100 (346)
T ss_dssp             ---CEEEEEETTTSHHHHHHHHHHHHHCTTEEEEEEECCCTTCCGGGGTTTTTCTTEEEEECCTTCHHHHHHHHHHHTCC
T ss_pred             ccCCCeEEEECCccHHHHHHHHHHHhhCCCcEEEEEeccccccchhhhhhhccCCCeEEEEcCCCCHHHHHHHHhhcCCC
Confidence            34578999999999999999999999977799999998754333333333333468999999999999999999655699


Q ss_pred             EEEEcCccCCcccccCChHHHHHHHHHHHHHHHHHHHHcCCCcEEEEEcCccccCCCCCCcCCCCCCCCCCCCCChhHHH
Q 005949           83 TIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSAT  162 (668)
Q Consensus        83 ~Vih~a~~~~~~~~~~~~~~~~~~nv~~~~~l~~~~~~~~~~~~~v~~SS~~vyg~~~~~~~~~~~e~~~~~p~~~Y~~s  162 (668)
                      +|||+||......+..++...+++|+.++.+++++|++.+ +++|||+||.++|+......  ..+|+++..|.+.|+.+
T Consensus       101 ~Vih~A~~~~~~~~~~~~~~~~~~nv~~~~~ll~a~~~~~-~~~~v~~SS~~vy~~~~~~~--~~~E~~~~~p~~~Y~~s  177 (346)
T 4egb_A          101 VIVNFAAESHVDRSIENPIPFYDTNVIGTVTLLELVKKYP-HIKLVQVSTDEVYGSLGKTG--RFTEETPLAPNSPYSSS  177 (346)
T ss_dssp             EEEECCCCC---------CHHHHHHTHHHHHHHHHHHHST-TSEEEEEEEGGGGCCCCSSC--CBCTTSCCCCCSHHHHH
T ss_pred             EEEECCcccchhhhhhCHHHHHHHHHHHHHHHHHHHHhcC-CCEEEEeCchHHhCCCCcCC--CcCCCCCCCCCChhHHH
Confidence            9999999877665667788999999999999999999987 89999999999999874322  34788888999999999


Q ss_pred             HHHHHHHHHHHHHhcCCCEEEEeeCceeCCCCCCCChHHHHHHHHHcCCCceeecCCCceEeceeHHHHHHHHHHHHhcC
Q 005949          163 KAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILHKG  242 (668)
Q Consensus       163 K~~~E~~~~~~~~~~~~~~~ilR~~~v~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~D~a~ai~~~~~~~  242 (668)
                      |..+|.+++.++++++++++++||++||||+..+..+++.++..+..++++.+++++.+.++|+|++|+|++++.+++.+
T Consensus       178 K~~~E~~~~~~~~~~g~~~~ilRp~~v~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~Dva~a~~~~~~~~  257 (346)
T 4egb_A          178 KASADMIALAYYKTYQLPVIVTRCSNNYGPYQYPEKLIPLMVTNALEGKKLPLYGDGLNVRDWLHVTDHCSAIDVVLHKG  257 (346)
T ss_dssp             HHHHHHHHHHHHHHHCCCEEEEEECEEESTTCCTTSHHHHHHHHHHTTCCCEEETTSCCEECEEEHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHhCCCEEEEeecceeCcCCCccchHHHHHHHHHcCCCceeeCCCCeEEeeEEHHHHHHHHHHHHhcC
Confidence            99999999999888899999999999999998777899999999999999999899999999999999999999999988


Q ss_pred             CCCceEEEcCCCcccHHHHHHHHHHHhCCCCCcceEeccCCCCCCcccccChHHHH-hCCCcccCCHHHHHHHHHHHHhh
Q 005949          243 EVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLT-SLGWSERTIWEEGLRKTIEWYTQ  321 (668)
Q Consensus       243 ~~~~~~ni~~~~~~s~~el~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~k~~-~lG~~~~~~~~~~l~~~~~~~~~  321 (668)
                      ..+++||+++++++|+.|+++.+.+.+|.+.. .+.+.+..+.....+.+|++|++ +|||+|+++++++|+++++||++
T Consensus       258 ~~g~~~~i~~~~~~s~~e~~~~i~~~~g~~~~-~~~~~~~~~~~~~~~~~d~~k~~~~lG~~p~~~~~e~l~~~~~~~~~  336 (346)
T 4egb_A          258 RVGEVYNIGGNNEKTNVEVVEQIITLLGKTKK-DIEYVTDRLGHDRRYAINAEKMKNEFDWEPKYTFEQGLQETVQWYEK  336 (346)
T ss_dssp             CTTCEEEECCSCCEEHHHHHHHHHHHHTCCGG-GCEEECC--CCCSCCCBCCHHHHHHHCCCCCCCHHHHHHHHHHHHHH
T ss_pred             CCCCEEEECCCCceeHHHHHHHHHHHhCCCcc-cccccCCCCCCcceeeccHHHHHHHcCCCCCCCHHHHHHHHHHHHHh
Confidence            88889999999999999999999999998654 24444555555566789999997 59999999999999999999999


Q ss_pred             CCCcccc
Q 005949          322 NPDWWGD  328 (668)
Q Consensus       322 ~~~~~~~  328 (668)
                      +..+|..
T Consensus       337 ~~~~~~~  343 (346)
T 4egb_A          337 NEEWWKP  343 (346)
T ss_dssp             CHHHHGG
T ss_pred             hhhhhhh
Confidence            8877664
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 668
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 5e-97
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 3e-15
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 6e-84
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 7e-11
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 1e-80
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 1e-13
d1oc2a_346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 7e-71
d1oc2a_346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 2e-07
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 2e-65
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 2e-12
d1udca_338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 5e-63
d1z45a2347 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep 3e-57
d1sb8a_341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 9e-57
d1sb8a_341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 2e-05
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 1e-56
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 2e-06
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 7e-56
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 4e-10
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 5e-52
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 1e-04
d1orra_338 c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella 1e-49
d1orra_338 c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella 0.001
d1ek6a_346 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 2e-49
d2c5aa1363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 4e-49
d2c5aa1363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 5e-08
d1n7ha_339 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cr 2e-44
d1gy8a_383 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 2e-42
d1rkxa_356 c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia 8e-30
d1y1pa1342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 5e-25
d2blla1342 c.2.1.2 (A:316-657) Polymyxin resistance protein A 5e-24
d1i24a_393 c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 3e-21
d1eq2a_307 c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimer 2e-17
d1vl0a_281 c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD 4e-16
d1vl0a_281 c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD 2e-08
d2q46a1252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 5e-16
d1qyda_312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 2e-14
d1n2sa_298 c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reduct 3e-12
d1n2sa_298 c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reduct 7e-04
d1qyca_307 c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta 6e-10
d1hdoa_205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 4e-09
d1xgka_350 c.2.1.2 (A:) Negative transcriptional regulator Nm 6e-08
d2a35a1212 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pse 1e-06
d2bkaa1232 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {H 3e-05
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 6e-05
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 2e-04
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 7e-04
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 0.001
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 0.002
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 0.002
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 0.002
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 0.003
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 0.003
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 0.003
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptococcus suis, serotype 2 [TaxId: 1307]

 Score =  300 bits (769), Expect = 5e-97
 Identities = 134/344 (38%), Positives = 186/344 (54%), Gaps = 23/344 (6%)

Query: 8   NILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVKGDIA 67
            ILITG AGFI S V   +I+N  +  +V +DKL Y  NL++L     S+ + F   DI 
Sbjct: 2   KILITGGAGFIGSAVVRHIIKNTQD-TVVNIDKLTYAGNLESLSDISESNRYNFEHADIC 60

Query: 68  SADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG----- 122
            +  +  +      D +MH AA++HVD S      F + NI GT+ LLE  +        
Sbjct: 61  DSAEITRIFEQYQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYALLEVARKYWSALGE 120

Query: 123 ---QIRRFIHVSTDEVYGETDEDAVVGNH-------EASQLLPTNPYSATKAGAEMLVMA 172
                 RF H+STDEVYG+      V N        E +   P++PYSA+KA ++ LV A
Sbjct: 121 DKKNNFRFHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYAPSSPYSASKASSDHLVRA 180

Query: 173 YGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVA 232
           + R+YGLP I T  +N YGP  FPEKLIP  IL A+ G PLPI+G G  +R +LY ED A
Sbjct: 181 WRRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA 240

Query: 233 EAFECILHKGEVGHVYNVGTKKERRVIDVAKDICKLFSM------DPETSIKFVENRPFN 286
            A   ++ +G+ G  YN+G   E++ +DV   IC L              I +V +RP +
Sbjct: 241 RALHMVVTEGKAGETYNIGGHNEKKNLDVVFTICDLLDEIVPKATSYREQITYVADRPGH 300

Query: 287 DQRYFLDDQKLTS-LGWSERTIWEEGLRKTIEWYTQNPDWWGDV 329
           D+RY +D  K++  LGW     +E G+RKT+EWY  N  W  +V
Sbjct: 301 DRRYAIDAGKISRELGWKPLETFESGIRKTVEWYLANTQWVNNV 344
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 339 Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Length = 356 Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Length = 342 Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Length = 307 Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Length = 281 Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Length = 281 Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Length = 298 Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Length = 298 Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Length = 212 Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query668
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 100.0
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 100.0
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 100.0
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 100.0
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 100.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 100.0
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 100.0
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 100.0
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 100.0
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 100.0
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 100.0
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 100.0
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 100.0
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 100.0
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 100.0
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 100.0
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 100.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 100.0
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 100.0
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 100.0
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 100.0
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 100.0
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 100.0
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 100.0
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 100.0
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 100.0
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 100.0
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 100.0
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.98
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.97
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.97
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.96
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.96
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.95
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.93
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.92
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.9
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.89
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.88
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.88
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.85
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.84
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.83
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 99.81
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.81
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.81
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.81
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.75
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.74
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.74
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.73
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.73
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.72
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.71
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.71
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.71
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.71
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.7
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.7
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.69
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.69
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.69
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.68
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.68
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.68
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.68
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.68
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.68
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.68
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.67
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.67
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.66
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.66
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.65
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.65
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.63
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.63
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.63
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.63
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.63
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.63
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.63
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.62
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 99.62
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.61
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.61
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.61
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.61
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.6
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.6
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.58
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.57
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.57
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.56
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.53
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.52
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.51
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.51
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.51
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.5
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.5
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.5
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.49
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.49
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.48
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.48
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.48
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.47
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.46
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.46
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.46
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.46
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.46
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.45
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.45
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.45
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.44
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.44
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.44
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.44
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.43
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.43
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.43
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.43
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.42
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.42
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.41
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.41
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.41
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.41
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.4
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.4
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.39
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.38
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.36
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.36
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.36
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.36
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.36
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.35
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.35
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.32
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.31
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.31
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.3
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.3
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.3
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.29
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.29
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.29
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.28
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.27
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.27
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.27
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.27
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.25
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.25
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.25
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.25
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.22
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.2
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.18
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.13
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.13
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.13
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.13
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.08
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.06
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.06
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.05
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.04
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 98.97
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 98.92
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 98.87
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 98.77
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 98.74
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 98.73
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.71
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 98.68
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 98.63
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 98.49
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.29
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.16
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 98.0
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.9
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.84
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.83
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 97.7
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.68
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 97.65
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.61
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.42
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.39
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.39
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.36
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 97.35
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 97.35
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 97.21
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.21
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.2
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.19
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 97.14
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 97.1
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 97.09
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.07
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.05
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.02
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.01
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.94
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.94
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.93
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.92
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.9
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 96.78
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 96.77
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.76
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 96.72
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.6
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 96.55
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.54
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.52
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.48
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.47
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.45
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.44
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.43
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.43
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 96.38
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 96.31
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.3
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.24
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.24
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.16
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 96.15
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.1
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 96.09
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 95.97
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 95.96
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.96
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.92
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 95.92
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.86
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.84
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.82
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.79
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.77
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.66
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 95.57
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 95.55
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.47
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.4
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.36
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.28
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 95.25
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 95.22
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 95.2
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 95.18
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.08
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 95.05
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.94
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.94
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.74
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 94.73
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 94.73
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 94.67
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 94.6
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 94.54
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 94.53
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 94.51
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 94.48
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.36
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 94.28
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 94.23
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 94.23
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.17
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.13
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 94.09
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 94.05
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 93.94
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 93.93
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 93.89
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 93.74
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 93.68
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 93.64
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 93.37
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 93.32
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.32
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 93.29
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 93.15
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.15
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.07
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 93.03
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.0
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 92.95
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 92.78
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 92.55
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 92.54
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 92.51
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.46
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.4
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.33
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 92.25
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 92.1
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.05
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 92.03
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 91.94
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 91.83
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 91.78
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 91.73
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 91.71
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 91.39
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 91.39
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 91.29
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 91.12
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 91.06
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.01
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 91.0
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 90.91
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 90.91
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 90.89
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 90.85
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 90.73
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 90.72
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 90.65
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 90.62
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.49
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 90.44
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 90.4
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 90.39
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 90.38
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 90.36
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 90.34
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 90.17
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 90.15
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 90.0
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 89.99
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 89.83
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 89.74
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 89.73
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 89.71
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.67
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 89.66
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 89.66
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 89.58
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.55
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 89.47
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 89.44
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 89.16
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 89.07
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 89.07
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 88.99
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 88.96
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 88.94
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 88.92
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 88.75
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 88.49
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 88.38
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 88.32
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 88.3
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 88.26
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 88.26
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 88.19
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 88.12
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 88.01
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 87.99
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 87.62
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 87.52
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 87.44
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 87.41
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 87.06
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 86.88
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.87
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 86.78
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 86.69
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 86.63
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 86.4
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 86.04
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 85.68
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 85.66
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 85.44
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 85.43
d1iu8a_206 Pyrrolidone carboxyl peptidase (pyroglutamate amin 85.41
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 85.31
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 85.26
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 85.18
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 85.17
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 84.99
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 84.76
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 84.75
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 84.57
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 84.5
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 84.49
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 84.41
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 84.26
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 84.08
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 83.97
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 83.7
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 83.65
d1id1a_153 Rck domain from putative potassium channel Kch {Es 83.63
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 83.58
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 83.52
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 83.42
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 83.35
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 83.34
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 83.33
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 83.05
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 83.0
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 82.99
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 82.81
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 82.76
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 82.66
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 82.55
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 82.49
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 82.48
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 82.46
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 82.19
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 82.15
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 82.09
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 82.04
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 82.03
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 81.88
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 81.84
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 81.82
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 81.82
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 81.79
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 81.3
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 81.27
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 81.25
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 81.21
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 81.15
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 80.85
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 80.73
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 80.72
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 80.49
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 80.21
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 80.2
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 80.04
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptomyces venezuelae [TaxId: 54571]

Probab=100.00  E-value=3.5e-47  Score=384.88  Aligned_cols=315  Identities=39%  Similarity=0.684  Sum_probs=277.3

Q ss_pred             CeEEEEcCCChhHHHHHHHHHHhCCCC----EEEEEcCCCccCCccccCCCcCCCCeEEEEccCCCHHHHHHHhccCCCC
Q 005949            7 KNILITGAAGFIASHVCNRLIRNYPEY----KIVVLDKLDYCSNLKNLIPSKASSNFKFVKGDIASADLVNFLLITESID   82 (668)
Q Consensus         7 ~~vLVtGgtG~iG~~l~~~L~~~g~~~----~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~~Dl~d~~~~~~~~~~~~~d   82 (668)
                      |||||||||||||++|++.|+++|+.+    +++.+|..........+.......+++++.+|+.+........  ..+|
T Consensus         1 MkIlItG~tGfIG~~l~~~L~~~g~~v~~~~~i~~~d~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~--~~~d   78 (322)
T d1r6da_           1 MRLLVTGGAGFIGSHFVRQLLAGAYPDVPADEVIVLDSLTYAGNRANLAPVDADPRLRFVHGDIRDAGLLAREL--RGVD   78 (322)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHTSCTTSCCSEEEEEECCCTTCCGGGGGGGTTCTTEEEEECCTTCHHHHHHHT--TTCC
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCccCCceEEEEeCCCccccHhHhhhhhcCCCeEEEEeccccchhhhccc--cccc
Confidence            589999999999999999999997543    5677776554444444444444568999999999999888776  7899


Q ss_pred             EEEEcCccCCcccccCChHHHHHHHHHHHHHHHHHHHHcCCCcEEEEEcCccccCCCCCCcCCCCCCCCCCCCCChhHHH
Q 005949           83 TIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSAT  162 (668)
Q Consensus        83 ~Vih~a~~~~~~~~~~~~~~~~~~nv~~~~~l~~~~~~~~~~~~~v~~SS~~vyg~~~~~~~~~~~e~~~~~p~~~Y~~s  162 (668)
                      +|+|+|+.........++.+.+++|+.|+.+++++|++.+ +++|||+||..+||.....+.   +|+++..|.++|+.+
T Consensus        79 ~vi~~a~~~~~~~~~~~~~~~~~~N~~gt~~ll~~~~~~~-~~~~I~~Ss~~~yg~~~~~~~---~E~~~~~p~~~Y~~s  154 (322)
T d1r6da_          79 AIVHFAAESHVDRSIAGASVFTETNVQGTQTLLQCAVDAG-VGRVVHVSTNQVYGSIDSGSW---TESSPLEPNSPYAAS  154 (322)
T ss_dssp             EEEECCSCCCHHHHHHCCHHHHHHHTHHHHHHHHHHHHTT-CCEEEEEEEGGGGCCCSSSCB---CTTSCCCCCSHHHHH
T ss_pred             eEEeecccccccccccchHHHhhhhHHHHHHHHHHHHHcC-CceEEEeecceeecCCCCCCC---CCCCCCCCCCHHHHH
Confidence            9999999887777777888999999999999999999977 899999999999998876543   788889999999999


Q ss_pred             HHHHHHHHHHHHHhcCCCEEEEeeCceeCCCCCCCChHHHHHHHHHcCCCceeecCCCceEeceeHHHHHHHHHHHHhcC
Q 005949          163 KAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGLPLPIHGDGSNVRSYLYCEDVAEAFECILHKG  242 (668)
Q Consensus       163 K~~~E~~~~~~~~~~~~~~~ilR~~~v~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~D~a~ai~~~~~~~  242 (668)
                      |..+|.+++.++++++++++++||++||||++.+..+++.+++.+..++++.++++|.+.|+|+|++|+|+++..+++++
T Consensus       155 K~~~E~~~~~~~~~~~~~~~~lR~~~vyGp~~~~~~~i~~~i~~~~~~~~i~v~~~g~~~r~~i~v~D~a~ai~~~~~~~  234 (322)
T d1r6da_         155 KAGSDLVARAYHRTYGLDVRITRCCNNYGPYQHPEKLIPLFVTNLLDGGTLPLYGDGANVREWVHTDDHCRGIALVLAGG  234 (322)
T ss_dssp             HHHHHHHHHHHHHHHCCCEEEEEECEEECTTCCTTSHHHHHHHHHHTTCCEEEETTSCCEEEEEEHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHhCCCEEEEEeeeEECcCCCcCcHHHHHHHHHHcCCCcEEecCCCeEEccEEHHHHHHHHHHHHhCC
Confidence            99999999999999999999999999999998888899999999999999999999999999999999999999999998


Q ss_pred             CCCceEEEcCCCcccHHHHHHHHHHHhCCCCCcceEeccCCCCCCcccccChHHHH-hCCCcccCCHHHHHHHHHHHHhh
Q 005949          243 EVGHVYNVGTKKERRVIDVAKDICKLFSMDPETSIKFVENRPFNDQRYFLDDQKLT-SLGWSERTIWEEGLRKTIEWYTQ  321 (668)
Q Consensus       243 ~~~~~~ni~~~~~~s~~el~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~k~~-~lG~~~~~~~~~~l~~~~~~~~~  321 (668)
                      ..+++||++++.+.++.|+++.+.+.+|.+.. .+.....++.....+.+|++|++ .|||+|+++++|+|+++++||++
T Consensus       235 ~~~~~~ni~~~~~~s~~e~~~~i~~~~~~~~~-~~~~~~~~~~~~~~~~~d~~k~~~~lg~~p~~~~eegI~~~i~w~~~  313 (322)
T d1r6da_         235 RAGEIYHIGGGLELTNRELTGILLDSLGADWS-SVRKVADRKGHDLRYSLDGGKIERELGYRPQVSFADGLARTVRWYRE  313 (322)
T ss_dssp             CTTCEEEECCCCEEEHHHHHHHHHHHHTCCGG-GEEEECCCTTCCCBCCBCCHHHHHHHCCCCCSCHHHHHHHHHHHHHH
T ss_pred             CCCCeeEEeecccchhHHHHHHHHHHhCCCcc-ceeecCCCCCCCceeeeCHHHHHHHHCCCCCCCHHHHHHHHHHHHHH
Confidence            88899999999999999999999999997644 34445556666677889999997 59999999999999999999999


Q ss_pred             CCCcccc
Q 005949          322 NPDWWGD  328 (668)
Q Consensus       322 ~~~~~~~  328 (668)
                      ++.+|..
T Consensus       314 n~~~~~~  320 (322)
T d1r6da_         314 NRGWWEP  320 (322)
T ss_dssp             CHHHHGG
T ss_pred             hHHhHhh
Confidence            9888764
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1iu8a_ c.56.4.1 (A:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure