Citrus Sinensis ID: 006035

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660---

MLRFHFLWLLVFCSALNSSSARHGKLNSVPKLDEGNTIRIFCFSYCFMLLGVKIYGIFCFNAAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRACGPHLSTSAKIGIGFGVLGLIFLLIICSMVWWKRRQNILRAQQIAARGAPYAKARTHLSHDIQLARHYNHHGNARTAAENGPSLLS

cccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccccccccccccccEEEEcccccccccccccccccccccccccEEcccccccccccEEEEcccccEEEEEEEEEccccccccccccEEEEEccEEEEEEEcccccccccEEEEEEEEEccccEEEEEEEccccccEEEEEEcEEccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccHHHHHHHHcccccccccEEEEccccccccEEEEEEEccccccccccccEEEEEccccccccccccccccccccEEEEEEEEEEEEcccEEEEEEccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEEcccccccEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccEEccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHEEcccHHHHHHHHHcccccccccccHHHHHHHHHHccccHHHHccccccccccc

ccHHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccEEEccccHccccccccccHHHccccccEEEccccccccccEEEEEcccccEEEEEEEEEEccccccccccEEEEEEcccEEEEEEEccccccccEEEEEEEEcccccEEEEEEEccccccEEEEEEEcccccccccccccccccEEEEEEEEEEccccccccEEEccccccccccEEEccccccccccccEEEEEEccccccccccccHHHHHHccccccccccEEEEEcccccccEEEEEEEHHHHHHcccccEEEEEEEEcccEcccccccHHcccccEEEEEcccccccccEEEEEEEccccccccEEEHEEEEEEEEccccccHHHHHHHHHHHHHcccccccccccccccccccccccEEEcccccccccEEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHHccccccEEEEccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHccccccccHHHHHHHcccHHHHHHHcccccccc

MLRFHFLWLLVFCSAlnsssarhgklnsvpkldegntirIFCFSYCFMLLGVKIYGIfcfnaapfamriscgarqnihspptntlwfkdfaytggipanatrpsfitpplktlryfplsegpencyiinrvpkghynvRIFFGLvtltsfdheplfdisvegtqiyslksgwsdhdDRAFAEALVFLRDGTvsicfhstghgdpailSLEIlqvddkayyfgqgwgeGLILRTAtrlscgngkpkfdvdysgdhwggdrfwnpilsfgqnadqrrSTESSIKQaskapnfypealYQTAlvstdsqpdlqytmdvdpnrnySIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAvngrtltvtlhpkggsHAIINAIEVFEIIAVESKTLPEEVRALQVLKnsldlphrfgwngdpcvpqqhpwsgadcqfdrtshkwvidglgldnqglrgflpngiskLRHLQSInlsgnsirgaipsslgtiASLEVLDLSynffngsipesLGQLTALRRLNLngntlsgrvpaalggrllhrasfnftdnaglcgipglracgphlstsakigiGFGVLGLIFLLIICSMVWWKRRQNILRAQQIAARGAPYAKARTHLSHDIQLARHYnhhgnartaaengpslls

MLRFHFLWLLVFCSALNSSSARHGKlnsvpkldegntIRIFCFSYCFMLLGVKIYGIFCFNAAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPanatrpsfitppLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRACGPHLSTSAKIGIGFGVLGLIFLLIICSMVWWKRRQNILRAQQIAARGAPYAKARTHLSHDIQLARHYNHHGnartaaengpslls

MLRFHFLWLLVFCSALNSSSARHGKLNSVPKLDEGNTIRIFCFSYCFMLLGVKIYGIFCFNAAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRACGPHLSTSAKigigfgvlgliflliiCSMVWWKRRQNILRAQQIAARGAPYAKARTHLSHDIQLARHYNHHGNARTAAENGPSLLS

**RFHFLWLLVFCSALNS**********VPKLDEGNTIRIFCFSYCFMLLGVKIYGIFCFNAAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFG*********************FYPEALYQTALVST****DLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRACGPHLSTSAKIGIGFGVLGLIFLLIICSMVWWKRRQNILRAQQIAARGAPYAKARTHLSHDIQLARHY******************

*LRFHFLWLLVFCSAL***************LDEGNTIRIFCFSYCFMLLGVKIYGIFCFNAAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANA*****ITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTI***GQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFNFTDNAG*********************IGFGVLGLIFLLIICSMVWWK****************************IQLARHYNHHGN*************

MLRFHFLWLLVFCSALNSSSARHGKLNSVPKLDEGNTIRIFCFSYCFMLLGVKIYGIFCFNAAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQN**************SKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRACGPHLSTSAKIGIGFGVLGLIFLLIICSMVWWKRRQNILRAQQIAARGAPYAKARTHLSHDIQLARHYNHHGNA************

MLRFHFLWLLVFCSALNSSSAR*GKLNSVPKLDEGNTIRIFCFSYCFMLLGVKIYGIFCFNAAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRACGPHLSTSAKIGIGFGVLGLIFLLIICSMVWWKRRQNI*********************HDIQLARHYNHHGNARTAAENGPSLLS

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		663	2.2.26 [Sep-21-2011]
Q9ZQQ7		886	Putative leucine-rich rep	no	no	0.728	0.545	0.292	2e-36
Q9ZQR3		868	Leucine-rich repeat recep	no	no	0.687	0.525	0.279	2e-34
Q9LIG2		899	Receptor-like protein kin	no	no	0.663	0.489	0.281	4e-34
Q9SNA3		889	Putative receptor-like pr	no	no	0.660	0.492	0.271	2e-33
Q9FN94		868	Receptor-like protein kin	no	no	0.656	0.501	0.285	2e-32
C0LGG3		885	Probable LRR receptor-lik	no	no	0.594	0.445	0.269	6e-31
O81069		884	Probable leucine-rich rep	no	no	0.594	0.445	0.269	8e-31
C0LGD9		871	Probable LRR receptor-lik	no	no	0.791	0.602	0.25	4e-30
Q9FZB1		872	Probable LRR receptor-lik	no	no	0.589	0.448	0.287	6e-30
Q9SI06		892	Putative leucine-rich rep	no	no	0.615	0.457	0.263	5e-29

>sp\|Q9ZQQ7\|Y2144_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 OS=Arabidopsis thaliana GN=At2g14440 PE=1 SV=1	Back alignment and function desciption

 Score =  154 bits (390), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 154/526 (29%), Positives = 223/526 (42%), Gaps = 43/526 (8%)

Query: 47  FMLLGVKIYGIFCF----NAAPFAMRISCGARQNIH---SPPTNTLWFKDFAY-----TG 94
            MLL    + I       N   F + + CG   N      P TN  +  D  +     TG
Sbjct: 7   LMLLACATFSIISLVKSQNQQGF-ISLYCGLPSNESPYIEPLTNLTYISDVNFVRGGKTG 65

Query: 95  GIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEP 154
            I  N +   F + P K LRYFP  EG  NCY ++      Y +R  F        +  P
Sbjct: 66  NI-KNNSDIDFTSRPYKVLRYFP--EGIRNCYSLSVKQGTKYLIRTLFFYGNYDGLNTSP 122

Query: 155 LFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQV 214
            FD+ +      S+     D  D    E +   R   + IC   TG   P I ++E+  +
Sbjct: 123 RFDLFLGPNIWTSVDVQKVDGGDGVIEEIIHVTRCNILDICLVKTGTTTPMISAIELRPL 182

Query: 215 DDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQR 274
               Y    G  + ++    T     +GK   +V Y  D +  DR W P     Q    +
Sbjct: 183 RYDTYTARTGSLKKILHFYFT----NSGK---EVRYPEDVY--DRVWIP---HSQPEWTQ 230

Query: 275 RSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQYT-MDVDPNRNYSIWLHFAEIDNT 333
            +T  ++   S   N  P+ + +TA + T+    L +T M    +     +L+FAEI   
Sbjct: 231 INTTRNVSGFSDGYN-PPQDVIKTASIPTNVSEPLTFTWMSESSDDETYAYLYFAEIQQ- 288

Query: 334 ITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVN--GRTLTVTLH--PKG 389
           +     R F IL+NG      V  +     ++ A  L T  A+   G    V L   PK 
Sbjct: 289 LKANETRQFKILVNG------VYYIDYIPRKFEAETLITPAALKCGGGVCRVQLSKTPKS 342

Query: 390 GSHAIINAIEVFEIIAV-ESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGA 448
                +NAIE+F +I   +S T  +EV A++ ++++  +  R  W GDPCVP Q  W G 
Sbjct: 343 TLPPQMNAIEIFSVIQFPQSDTNTDEVIAIKNIQSTYKV-SRISWQGDPCVPIQFSWMGV 401

Query: 449 DCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIAS 508
            C     S    I  L L + GL G +   I  L  L+ ++LS N++ G IP SL  +  
Sbjct: 402 SCNVIDISTPPRIISLDLSSSGLTGVITPSIQNLTMLRELDLSNNNLTGVIPPSLQNLTM 461

Query: 509 LEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGR 554
           L  LDLS N   G +PE L  +  L  ++L GN L G VP AL  R
Sbjct: 462 LRELDLSNNNLTGEVPEFLATIKPLLVIHLRGNNLRGSVPQALQDR 507

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1

>sp\|Q9ZQR3\|Y2451_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510 OS=Arabidopsis thaliana GN=At2g14510 PE=2 SV=1	Back alignment and function description

>sp\|Q9LIG2\|RLK6_ARATH Receptor-like protein kinase At3g21340 OS=Arabidopsis thaliana GN=At3g21340 PE=1 SV=1	Back alignment and function description

>sp\|Q9SNA3\|Y3463_ARATH Putative receptor-like protein kinase At3g46340 OS=Arabidopsis thaliana GN=At3g46340 PE=3 SV=1	Back alignment and function description

>sp\|Q9FN94\|RLK7_ARATH Receptor-like protein kinase At5g59670 OS=Arabidopsis thaliana GN=At5g59670 PE=1 SV=1	Back alignment and function description

>sp\|C0LGG3\|Y5182_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51820 OS=Arabidopsis thaliana GN=At1g51820 PE=2 SV=1	Back alignment and function description

>sp\|O81069\|Y2899_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g28990 OS=Arabidopsis thaliana GN=At2g28990 PE=2 SV=1	Back alignment and function description

>sp\|C0LGD9\|Y1756_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07560 OS=Arabidopsis thaliana GN=At1g07560 PE=2 SV=1	Back alignment and function description

>sp\|Q9FZB1\|Y5188_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51880 OS=Arabidopsis thaliana GN=At1g51880 PE=2 SV=1	Back alignment and function description

>sp\|Q9SI06\|Y5573_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana GN=At2g04300 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		663
224079175		596	predicted protein [Populus trichocarpa]	0.898	1.0	0.800	0.0
255536757		629	serine-threonine protein kinase, plant-t	0.903	0.952	0.788	0.0
359483663		624	PREDICTED: putative leucine-rich repeat	0.904	0.961	0.777	0.0
15217901		626	receptor like protein 4 [Arabidopsis tha	0.906	0.960	0.755	0.0
6560758		697	F3M18.23 [Arabidopsis thaliana]	0.903	0.859	0.753	0.0
449457751		621	PREDICTED: putative leucine-rich repeat	0.920	0.982	0.745	0.0
449457749		625	PREDICTED: putative leucine-rich repeat	0.904	0.96	0.752	0.0
356557713		631	PREDICTED: putative leucine-rich repeat	0.933	0.980	0.710	0.0
449511662		621	PREDICTED: putative leucine-rich repeat	0.918	0.980	0.742	0.0
449511656		625	PREDICTED: putative leucine-rich repeat	0.904	0.96	0.750	0.0

>gi\|224079175\|ref\|XP_002305781.1\| predicted protein [Populus trichocarpa] gi\|222848745\|gb\|EEE86292.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score = 1007 bits (2604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/597 (80%), Positives = 527/597 (88%), Gaps = 1/597 (0%)

Query: 67  MRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCY 126
           MRISCGAR N+H+ PTNTLW+KDFAYTGGIPANATRPS+I+PPLKTLRYFPLS GP NCY
Sbjct: 1   MRISCGARLNVHTAPTNTLWYKDFAYTGGIPANATRPSYISPPLKTLRYFPLSSGPNNCY 60

Query: 127 IINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVF 186
            INRVPKGHY VR+FFGL    +FD+EPLFDIS+EGTQIYSLKSGW++HDD+ F EALVF
Sbjct: 61  NINRVPKGHYTVRVFFGLDGHRNFDNEPLFDISIEGTQIYSLKSGWTNHDDQVFTEALVF 120

Query: 187 LRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKF 246
           L DGT SICFHSTGHGDPAILS+EILQ++D+AYYFG  W +G+ILRTA RLSCGNGKPKF
Sbjct: 121 LTDGTASICFHSTGHGDPAILSIEILQMEDRAYYFGPAWVQGIILRTAARLSCGNGKPKF 180

Query: 247 DVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQ 306
           DVDYSGDHWGGDRFW+PI +FGQ +D  RSTES IK+AS APN+YPEALYQTALVSTD+Q
Sbjct: 181 DVDYSGDHWGGDRFWSPIKTFGQGSDLARSTESGIKKASNAPNYYPEALYQTALVSTDTQ 240

Query: 307 PDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYT 366
           PDL YTMDVDPNRNYSIWLHFAEID+++T  G+RVFDILING +AF+ VD+VKMSGDRYT
Sbjct: 241 PDLAYTMDVDPNRNYSIWLHFAEIDSSVTAAGKRVFDILINGVVAFEDVDIVKMSGDRYT 300

Query: 367 ALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLD 426
           ALVLNTTV V+GR LT+ LHPK GSHAIINAIEVFEI+  ESKT  EEVRALQ LK++L 
Sbjct: 301 ALVLNTTVTVSGRILTIGLHPKEGSHAIINAIEVFEILTAESKTSLEEVRALQSLKSALS 360

Query: 427 LPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQ 486
           LP RFGWNGDPCVPQ+HPW+GADC FD+TS KW IDGL LDNQGLRGF PN IS+L HLQ
Sbjct: 361 LPLRFGWNGDPCVPQEHPWNGADCHFDKTSSKWFIDGLSLDNQGLRGFFPNDISRLHHLQ 420

Query: 487 SINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGR 546
           +INLS NSIRGA+P S+GTI  L VLDLSYN FNGSIPESLGQLT+LRRLNLNGN+LSGR
Sbjct: 421 NINLSDNSIRGAVPPSIGTIPGLVVLDLSYNSFNGSIPESLGQLTSLRRLNLNGNSLSGR 480

Query: 547 VPAALGGRLLHRASFNFTDNAGLCGIPGLRACGPHLSTSAKIGIGFGVLGLIFLLIICSM 606
           VPAALGGRLLH ASFNFTDNAGLCGIPGLR CGPHLS   KIGI FG      L++ICSM
Sbjct: 481 VPAALGGRLLHGASFNFTDNAGLCGIPGLRTCGPHLSAGEKIGIAFGTSVGFLLMVICSM 540

Query: 607 VWWKRRQNILRAQQIAARGAPYAKARTHLSHDIQLARHYNHHGNARTAAENGPSLLS 663
            WWKRRQNILRAQQIA RGAPYAKART LSHDIQ+ RHY+ HGNARTAAENGPSLLS
Sbjct: 541 CWWKRRQNILRAQQIAERGAPYAKARTQLSHDIQMTRHYS-HGNARTAAENGPSLLS 596

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255536757\|ref\|XP_002509445.1\| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi\|223549344\|gb\|EEF50832.1\| serine-threonine protein kinase, plant-type, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359483663\|ref\|XP_002279791.2\| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Vitis vinifera] gi\|297740416\|emb\|CBI30598.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|15217901\|ref\|NP_174156.1\| receptor like protein 4 [Arabidopsis thaliana] gi\|332192839\|gb\|AEE30960.1\| receptor like protein 4 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|6560758\|gb\|AAF16758.1\|AC010155_11 F3M18.23 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|449457751\|ref\|XP_004146611.1\| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform 2 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449457749\|ref\|XP_004146610.1\| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform 1 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356557713\|ref\|XP_003547157.1\| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Glycine max]	Back alignment and taxonomy information

>gi\|449511662\|ref\|XP_004164020.1\| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform 2 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449511656\|ref\|XP_004164019.1\| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform 1 [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		663
TAIR\|locus:2032221		626	RLP4 "receptor like protein 4"	0.906	0.960	0.744	4.1e-255
TAIR\|locus:2031175		628	AT1G25570 [Arabidopsis thalian	0.800	0.845	0.373	1.3e-84
TAIR\|locus:2083023		517	AT3G05990 [Arabidopsis thalian	0.413	0.529	0.354	5.7e-35
TAIR\|locus:2094103		519	AT3G19230 [Arabidopsis thalian	0.636	0.813	0.274	3.9e-33
TAIR\|locus:2055160		886	AT2G14440 [Arabidopsis thalian	0.696	0.521	0.288	4.5e-32
TAIR\|locus:2028446		888	AT1G49100 [Arabidopsis thalian	0.618	0.461	0.272	9.8e-32
TAIR\|locus:2017572		882	AT1G51790 [Arabidopsis thalian	0.656	0.493	0.283	4.6e-29
TAIR\|locus:2078171		883	AT3G46400 [Arabidopsis thalian	0.696	0.523	0.263	9.8e-29
TAIR\|locus:2059804		892	AT2G04300 [Arabidopsis thalian	0.713	0.530	0.259	1.7e-28
TAIR\|locus:2055165		868	AT2G14510 [Arabidopsis thalian	0.689	0.526	0.269	2e-28

TAIR\|locus:2032221 RLP4 "receptor like protein 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2456 (869.6 bits), Expect = 4.1e-255, P = 4.1e-255
 Identities = 448/602 (74%), Positives = 513/602 (85%)

Query:    63 APFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGP 122
             AP+A+RISCGAR+N+ +PPT  LWFKD AYTGG+PANAT P++ITPPLKTLRYFP+SEGP
Sbjct:    25 APYALRISCGARKNVRTPPTYALWFKDIAYTGGVPANATTPTYITPPLKTLRYFPISEGP 84

Query:   123 ENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAE 182
              NCY I RVPKGHY+VRIFFGLV   SFD EPLFDIS+EGTQI SLKSGWS  DD+ FAE
Sbjct:    85 NNCYNIVRVPKGHYSVRIFFGLVDQPSFDKEPLFDISIEGTQISSLKSGWSSQDDQVFAE 144

Query:   183 ALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNG 242
             AL+FL  GT +ICFHSTGHGDPAILS+EILQVDDKAY FG+GWG+G+ILRTATRL+CG G
Sbjct:   145 ALIFLLGGTATICFHSTGHGDPAILSIEILQVDDKAYSFGEGWGQGVILRTATRLTCGTG 204

Query:   243 KPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVS 302
             K +FD DY GDHWGGDRFWN + SFG++AD  RSTE +IK+AS +PNFYPE LYQ+ALVS
Sbjct:   205 KSRFDEDYRGDHWGGDRFWNRMRSFGKSADSPRSTEETIKKASVSPNFYPEGLYQSALVS 264

Query:   303 TDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSG 362
             TD QPDL Y++DV+PNRNYS+WLHFAEIDNTIT  G+RVFD++INGD  F+ VD++KMSG
Sbjct:   265 TDDQPDLTYSLDVEPNRNYSVWLHFAEIDNTITAEGKRVFDVVINGDTFFEDVDIIKMSG 324

Query:   363 DRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLK 422
              RY ALVLN TV V+GRTLTV L PK G HAIINAIEVFEII  E KTL +EV ALQ +K
Sbjct:   325 GRYAALVLNATVTVSGRTLTVVLQPKAGGHAIINAIEVFEIITAEFKTLRDEVSALQKMK 384

Query:   423 NSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKL 482
              +L LP RFGWNGDPCVP QHPWSGA+CQ D+ + +W IDGL LDNQGL+GFLPN ISKL
Sbjct:   385 KALGLPSRFGWNGDPCVPPQHPWSGANCQLDKNTSRWFIDGLDLDNQGLKGFLPNDISKL 444

Query:   483 RHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNT 542
             +HLQSINLS N+IRG IP+SLG++ SLEVLDLSYN FNGSIPE+LG+LT+LR LNLNGN+
Sbjct:   445 KHLQSINLSENNIRGGIPASLGSVTSLEVLDLSYNSFNGSIPETLGELTSLRILNLNGNS 504

Query:   543 LSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRACGPHLSTSAKXXXXXXXXXXXXXXX 602
             LSG+VPAA+GGRLLHRASFNFTDNAGLCGIPGL ACGPHLS+ AK               
Sbjct:   505 LSGKVPAAVGGRLLHRASFNFTDNAGLCGIPGLPACGPHLSSGAKIGIAFGVSLAFLLIV 564

Query:   603 XCSMVWWKRRQNILRAQQIAARGAPYAKARTHLSHDIQLARH-YNHHGNARTAAENGPSL 661
              C+M+WWKRRQNILRAQQIAARGAPYAK RTH+SHDIQ++RH +N+HG ARTA ENGPSL
Sbjct:   565 ACAMIWWKRRQNILRAQQIAARGAPYAKKRTHVSHDIQMSRHGHNNHGQARTAVENGPSL 624

Query:   662 LS 663
             LS
Sbjct:   625 LS 626

GO:0005886 "plasma membrane" evidence=ISM

GO:0007165 "signal transduction" evidence=IC

GO:0005768 "endosome" evidence=IDA

GO:0005794 "Golgi apparatus" evidence=IDA

GO:0005802 "trans-Golgi network" evidence=IDA

TAIR\|locus:2031175 AT1G25570 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2083023 AT3G05990 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2094103 AT3G19230 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2055160 AT2G14440 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2028446 AT1G49100 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2017572 AT1G51790 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2078171 AT3G46400 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2059804 AT2G04300 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2055165 AT2G14510 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		663
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	0.0
pfam12819		335	pfam12819, Malectin_like, Carbohydrate-binding pro	5e-71
pfam11721		164	pfam11721, Malectin, Di-glucose binding within end	1e-16
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	4e-13
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	6e-13
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	7e-13
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-12
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-12
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-11
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	4e-11
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	5e-11
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	9e-10
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-09
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-09
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-09
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-08
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	1e-07
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	3e-07
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	7e-07
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-05
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	4e-04
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	6e-04
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	0.002
pfam12799		43	pfam12799, LRR_4, Leucine Rich repeats (2 copies)	0.002

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

 Score = 1149 bits (2975), Expect = 0.0
 Identities = 484/602 (80%), Positives = 529/602 (87%), Gaps = 1/602 (0%)

Query: 63  APFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGP 122
            PF MRISCGAR N+ + PTNTLW+KDFAYTGGIPANATRPSFI PPLKTLRYFPLS+GP
Sbjct: 22  EPFTMRISCGARVNVRTAPTNTLWYKDFAYTGGIPANATRPSFIAPPLKTLRYFPLSDGP 81

Query: 123 ENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAE 182
           ENCY INRVPKGHY+VR+FFGLV   +FD EPLFD+SVEGTQI SLKSGWS HD++ FAE
Sbjct: 82  ENCYNINRVPKGHYSVRVFFGLVAEPNFDSEPLFDVSVEGTQISSLKSGWSSHDEQVFAE 141

Query: 183 ALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNG 242
           ALVFL DG+ SICFHSTGHGDPAILS+EILQVDDKAY FG  WG+G+ILRTA RLSCG G
Sbjct: 142 ALVFLTDGSASICFHSTGHGDPAILSIEILQVDDKAYNFGPSWGQGVILRTAKRLSCGAG 201

Query: 243 KPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVS 302
           K KFD DYSGDHWGGDRFWN + +FG  +DQ  STE+ IK+AS APNFYPE+LYQ+ALVS
Sbjct: 202 KSKFDEDYSGDHWGGDRFWNRMQTFGSGSDQAISTENVIKKASNAPNFYPESLYQSALVS 261

Query: 303 TDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSG 362
           TD+QPDL YTMDVDPNRNYS+WLHFAEIDN+IT  G+RVFD+LINGD AF+ VD+VKMSG
Sbjct: 262 TDTQPDLSYTMDVDPNRNYSVWLHFAEIDNSITAEGKRVFDVLINGDTAFKDVDIVKMSG 321

Query: 363 DRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLK 422
           +RYTALVLN TVAV+GRTLT+ L PK G+HAIINAIEVFEII  ESKTL EEV ALQ LK
Sbjct: 322 ERYTALVLNKTVAVSGRTLTIVLQPKKGTHAIINAIEVFEIITAESKTLLEEVSALQTLK 381

Query: 423 NSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKL 482
           +SL LP RFGWNGDPCVPQQHPWSGADCQFD T  KW IDGLGLDNQGLRGF+PN ISKL
Sbjct: 382 SSLGLPLRFGWNGDPCVPQQHPWSGADCQFDSTKGKWFIDGLGLDNQGLRGFIPNDISKL 441

Query: 483 RHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNT 542
           RHLQSINLSGNSIRG IP SLG+I SLEVLDLSYN FNGSIPESLGQLT+LR LNLNGN+
Sbjct: 442 RHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNS 501

Query: 543 LSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRACGPHLSTSAKIGIGFGVLGLIFLLI 602
           LSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRACGPHLS  AKIGI FGV      L+
Sbjct: 502 LSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRACGPHLSVGAKIGIAFGVSVAFLFLV 561

Query: 603 ICSMVWWKRRQNILRAQQIAARGAPYAKARTHLSHDIQLARHY-NHHGNARTAAENGPSL 661
           IC+M WWKRRQNILRAQ+IAAR APYAKARTH S D+Q+ RH+  +HG+ARTAAENGPSL
Sbjct: 562 ICAMCWWKRRQNILRAQRIAAREAPYAKARTHFSRDVQMTRHHRQNHGSARTAAENGPSL 621

Query: 662 LS 663
           LS
Sbjct: 622 LS 623

Length = 623

>gnl\|CDD\|221790 pfam12819, Malectin_like, Carbohydrate-binding protein of the ER	Back alignment and domain information

>gnl\|CDD\|221187 pfam11721, Malectin, Di-glucose binding within endoplasmic reticulum	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		663
PLN03150		623	hypothetical protein; Provisional	100.0
PF12819		347	Malectin_like: Carbohydrate-binding protein of the	100.0
PLN03150		623	hypothetical protein; Provisional	99.83
PF11721		174	Malectin: Di-glucose binding within endoplasmic re	99.78
PF11721		174	Malectin: Di-glucose binding within endoplasmic re	99.47
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.45
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.42
PF12819		347	Malectin_like: Carbohydrate-binding protein of the	98.83
KOG0617		264	consensus Ras suppressor protein (contains leucine	98.81
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.59
KOG0617		264	consensus Ras suppressor protein (contains leucine	98.55
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.44
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.37
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.36
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.35
KOG0472		565	consensus Leucine-rich repeat protein [Function un	98.32
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.29
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.29
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.18
KOG3593		355	consensus Predicted receptor-like serine/threonine	98.12
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.08
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	97.9
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.87
KOG0472		565	consensus Leucine-rich repeat protein [Function un	97.85
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	97.83
PLN03210		1153	Resistant to P. syringae 6; Provisional	97.79
KOG4237		498	consensus Extracellular matrix protein slit, conta	97.77
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.74
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	97.72
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.68
PLN03210		1153	Resistant to P. syringae 6; Provisional	97.67
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	97.65
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	97.64
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	97.63
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	97.62
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	97.6
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.55
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.52
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.5
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	97.49
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	97.49
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.28
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.22
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	97.08
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	96.7
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	96.16
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	95.97
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	95.96
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	95.93
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	95.7
PF08263		43	LRRNT_2: Leucine rich repeat N-terminal domain; In	95.62
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	95.38
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.33
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	94.99
KOG2982		418	consensus Uncharacterized conserved protein [Funct	94.64
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	94.07
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	93.61
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	93.06
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	93.04
KOG0473		326	consensus Leucine-rich repeat protein [Function un	92.56
KOG2982		418	consensus Uncharacterized conserved protein [Funct	91.84
PRK15386		426	type III secretion protein GogB; Provisional	89.88
KOG2123		388	consensus Uncharacterized conserved protein [Funct	89.37
PF01102		122	Glycophorin_A: Glycophorin A; InterPro: IPR001195	88.57
PRK15386		426	type III secretion protein GogB; Provisional	88.55
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	87.42
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	85.88
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	85.29
KOG0473		326	consensus Leucine-rich repeat protein [Function un	85.25
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	83.53
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	83.34
PF08693		40	SKG6: Transmembrane alpha-helix domain; InterPro:	83.27
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	82.74
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	82.16
smart00370		26	LRR Leucine-rich repeats, outliers.	81.09
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	81.09
KOG2123		388	consensus Uncharacterized conserved protein [Funct	80.87

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

Probab=100.00  E-value=3.5e-107  Score=929.41  Aligned_cols=606  Identities=80%  Similarity=1.314  Sum_probs=517.8

Q ss_pred             eeeccCCCcEEEccCCCCCCcCCCCCceeeccCCccCCccccccCCCCCCCCcceeeeccCCCCCCceEEEeecCCceEE
Q 006035           58 FCFNAAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYN  137 (663)
Q Consensus        58 ~~~~~~~~~~~IdCG~~~~~~~d~~g~~w~~D~~~~~g~~~~~~~~~~~~~~y~t~R~F~~~~g~~~cY~~~~~~~g~yl  137 (663)
                      ..+++++++++||||+++++++|.+||+|++|..+++|.......+....++|+|+|+||..+|+++||+||++++|+|+
T Consensus        17 ~~~~~~~~~~~I~CGs~~~~~~d~~~~~w~~D~~~~~~~~~~~~~~~~~~~~~~t~R~F~~~~g~~~cY~~~~~~~g~yl   96 (623)
T PLN03150         17 SLASPEPFTMRISCGARVNVRTAPTNTLWYKDFAYTGGIPANATRPSFIAPPLKTLRYFPLSDGPENCYNINRVPKGHYS   96 (623)
T ss_pred             ccccCCCccEEEeCCCCCCcccCCCCCEEcCCcccccCccccccCcccccchhhccccCCcccccccceEeeecCCCcEE
Confidence            34566778999999999876456789999999877765544444444556789999999976788999999999999999


Q ss_pred             EEEEEeCcCCCCCCCCCcEEEEECCeEEEEeecCCCCCCCceEEEEEEEeeCCeEEEEEEeCCCCCceEEEEEEEEcCCc
Q 006035          138 VRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDK  217 (663)
Q Consensus       138 vRl~F~~~~y~~~~~~~~Fdv~~~~~~~~tv~~~~~~~~~~~~~E~i~~~~~~~l~vcf~~~~~~~pfIsaIEl~~l~~~  217 (663)
                      ||+||+||+||+.++.|.|||++|++.|.+|+.+|+.....++||++++++++.++|||+|++.++||||+|||||+|+.
T Consensus        97 VRl~F~~~~y~~~~~~~~Fdv~~~~~~~~tv~~~~~~~~~~v~~E~i~~~~~~~l~vcf~~~~~~~pFIs~iEv~~l~~~  176 (623)
T PLN03150         97 VRVFFGLVAEPNFDSEPLFDVSVEGTQISSLKSGWSSHDEQVFAEALVFLTDGSASICFHSTGHGDPAILSIEILQVDDK  176 (623)
T ss_pred             EEEEeecCCcCCCCCCCceEEEECcEEEEEEecCcccCCCcEEEEEEEEecCCcEEEEEecCCCCCCceeEEEEEEcCcc
Confidence            99999999999999999999999999999999988776778999999999999999999999999999999999999999


Q ss_pred             ccccCCCccccceEEEEEeeccCCCCCCCCCCCCCCCCCCCCcccCCCCCCCCCccccccccceecCCCCCCCChHHHHh
Q 006035          218 AYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQ  297 (663)
Q Consensus       218 ~y~~~~~~~~~~~l~~~~RiN~Gg~~~~~~~~~~~D~~~~DR~W~~~~~~~~~~~~~~~t~~~i~~~~~~~~~~P~~Vy~  297 (663)
                      +|..+.+...+.+|+++||+||||....+.+||+||+|++||+|.+|..+....+..+++...|+++.+.++.+|+.|||
T Consensus       177 ~y~~~~~~~~~~~L~~~~R~n~G~~~~~~~~d~~~D~~~~dR~W~~d~~~~~~~~~~~st~~~I~~~~~~~~~~P~~Vyq  256 (623)
T PLN03150        177 AYNFGPSWGQGVILRTAKRLSCGAGKSKFDEDYSGDHWGGDRFWNRMQTFGSGSDQAISTENVIKKASNAPNFYPESLYQ  256 (623)
T ss_pred             cccccccccCceEEEEEEEEEecCcccccccCCCCCcccCccccCcCcccCCCcccccccccccccccCCCccChHHHhh
Confidence            99754322346789999999999987777799999999999999998765444456667777787665667789999999


Q ss_pred             hccccCCCCCceEEEEecCCCCcEEEEEEEeeccCCCCCcceEEEEEEECCeecccCCccccccCCceEEEEEEEEEeec
Q 006035          298 TALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVN  377 (663)
Q Consensus       298 TAr~~~~~~~nlt~~~~v~~~~~y~vrLhFaEi~~~~~~~~~R~F~V~ing~~~~~~~di~~~~~~~~~~~~~~~~v~~~  377 (663)
                      |||++.+...+++|.|++++++.|+|||||||++......++|+|||||||+.+.+++|+...+|..+.++++++.+.++
T Consensus       257 TA~~~~~~~~~lty~~~v~~~~~Y~VrLhFaEi~~~~~~~~~R~F~V~ing~~~~~~~di~~~~g~~~~~~~~~~~v~~~  336 (623)
T PLN03150        257 SALVSTDTQPDLSYTMDVDPNRNYSVWLHFAEIDNSITAEGKRVFDVLINGDTAFKDVDIVKMSGERYTALVLNKTVAVS  336 (623)
T ss_pred             hhccccCCCCceEEEeecCCCCCEEEEEEEEeccCccCCCceEEEEEEECCEEeecccChhhhcCCcccceEEEeEEeec
Confidence            99998766678999999999999999999999975455668999999999999999999998888777889999988887


Q ss_pred             CeeEEEEEccCCCCHHHHHHHhhhhhhhhcccCchHHHHHHHHhhhcCCCCCCCCCCCCCCCCCCCCCCCcccccCCCCc
Q 006035          378 GRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSH  457 (663)
Q Consensus       378 ~~~l~i~~~p~~~s~piLNaiEi~~~~~~~~~~~~~d~~aL~~~k~~~~~~~~~~W~~~pC~p~~~~w~gv~C~~~~~~~  457 (663)
                      ++.++|+|+|..+++|+||||||+++...+..+.+.|+.+|+.+|..+.++...+|+++||.|..+.|.|+.|..+....
T Consensus       337 ~g~l~isl~p~~~s~pilNaiEI~~~~~~~~~t~~~~~~aL~~~k~~~~~~~~~~W~g~~C~p~~~~w~Gv~C~~~~~~~  416 (623)
T PLN03150        337 GRTLTIVLQPKKGTHAIINAIEVFEIITAESKTLLEEVSALQTLKSSLGLPLRFGWNGDPCVPQQHPWSGADCQFDSTKG  416 (623)
T ss_pred             CCeEEEEEeeCCCCcceeeeeeeeeccccccccCchHHHHHHHHHHhcCCcccCCCCCCCCCCcccccccceeeccCCCC
Confidence            88899999999888899999999999887778899999999999998876644589999999888899999997544333


Q ss_pred             cceEeEEEccCCCCcccCCccccCCCcCCcccCcCccccccCCCCCCCCCCCcEEeCCCCCCCCCCcccccCCCCCCEEe
Q 006035          458 KWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLN  537 (663)
Q Consensus       458 ~~~l~~L~Ls~n~l~g~~p~~~~~L~~L~~L~Ls~N~l~g~ip~~~~~L~~L~~LdLs~N~l~g~iP~~l~~l~~L~~L~  537 (663)
                      ..+++.|+|++|+|.|.+|..++.|++|+.|+|++|+|.|.+|..++.|++|+.|||++|+|+|.+|+.++++++|+.|+
T Consensus       417 ~~~v~~L~L~~n~L~g~ip~~i~~L~~L~~L~Ls~N~l~g~iP~~~~~l~~L~~LdLs~N~lsg~iP~~l~~L~~L~~L~  496 (623)
T PLN03150        417 KWFIDGLGLDNQGLRGFIPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGSIPESLGQLTSLRILN  496 (623)
T ss_pred             ceEEEEEECCCCCccccCCHHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECCCCCCCCCCchHHhcCCCCCEEE
Confidence            45799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCcCCccCCchhhhccCCCCEEeccCCCCCCCCCCCCCCCCCCCCceEEEEchhHHHHHHHHHHHHHHHHHHHhhHHH
Q 006035          538 LNGNTLSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRACGPHLSTSAKIGIGFGVLGLIFLLIICSMVWWKRRQNILR  617 (663)
Q Consensus       538 Ls~N~lsg~iP~~~~~~l~~L~~l~l~~N~~lc~~p~~~~c~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~rr~~~~~  617 (663)
                      |++|+|+|.+|..+.....++..+++.+|+.+|+.|....|..+.....++++++++++++++++++.+++++||++..+
T Consensus       497 Ls~N~l~g~iP~~l~~~~~~~~~l~~~~N~~lc~~p~l~~C~~~~~~~~~i~~~~~~~~~~l~~~~~~~~~~~~r~~~~~  576 (623)
T PLN03150        497 LNGNSLSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRACGPHLSVGAKIGIAFGVSVAFLFLVICAMCWWKRRQNILR  576 (623)
T ss_pred             CcCCcccccCChHHhhccccCceEEecCCccccCCCCCCCCcccCCCceEEEEEhHHHHHHHHHHHHHhhheeehhhhcc
Confidence            99999999999998876567788999999999999888889766666666776666665554445555555555554443


Q ss_pred             HHhhhccCCccccccccchhhhhhhcCCC-CCCCccccCCCCCCCCC
Q 006035          618 AQQIAARGAPYAKARTHLSHDIQLARHYN-HHGNARTAAENGPSLLS  663 (663)
Q Consensus       618 ~~~~~~~~~~~~~~r~~~~~eiq~atnnf-~~~~~~~~~~~~~~~~~  663 (663)
                      .+....+..++.+.|....+++|+|+..+ +++++|+++|+||++++
T Consensus       577 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  623 (623)
T PLN03150        577 AQRIAAREAPYAKARTHFSRDVQMTRHHRQNHGSARTAAENGPSLLS  623 (623)
T ss_pred             hhhhhcccCcchhcccceeeeccchhhhccccccccccccCCCcCCC
Confidence            33212334555666667788999999864 67779999999999986

>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan []	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan	Back alignment and domain information

>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan []	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG3593 consensus Predicted receptor-like serine/threonine kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		663
3rgx_A		768	Structural Insight Into Brassinosteroid Perception		3e-13
3riz_A		772	Crystal Structure Of The Plant Steroid Receptor Bri		3e-13
1ogq_A		313	The Crystal Structure Of Pgip (Polygalacturonase In		2e-08
3rfs_A		272	Design Of A Binding Scaffold Based On Variable Lymp		1e-04

>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768

Back alignment and structure

Iteration: 1

Score = 73.9 bits (180), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 48/146 (32%), Positives = 71/146 (48%), Gaps = 7/146 (4%) Query: 436 DPCVPQQHPWSG-ADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNS 494 +PC + G FD +D + L G++P I + +L +NL N Sbjct: 611 NPCNITSRVYGGHTSPTFDNNGSMMFLD---MSYNMLSGYIPKEIGSMPYLFILNLGHND 667 Query: 495 IRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGR 554 I G+IP +G + L +LDLS N +G IP+++ LT L ++L+ N LSG +P G+ Sbjct: 668 ISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM--GQ 725 Query: 555 LLHRASFNFTDNAGLCGIPGLRACGP 580 F +N GLCG P L C P Sbjct: 726 FETFPPAKFLNNPGLCGYP-LPRCDP 750

PyMOL of 3rgx

>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772

Back alignment and structure

>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313

Back alignment and structure

>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		663
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	6e-28
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-27
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	8e-24
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-21
2jwp_A		174	Malectin, MGC80075; sugar binding, sugar binding p	1e-27
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-25
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-24
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-23
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-22
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-22
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-22
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-21
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-21
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-20
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-20
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-20
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-18
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-18
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-16
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-15
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-12
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-19
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-17
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-17
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-16
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-15
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	9e-15
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-14
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-14
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-12
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-12
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-10
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	7e-10
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-09
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	8e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-18
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-15
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-15
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	6e-15
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	7e-15
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	8e-14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-13
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-13
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-13
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-13
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-12
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	9e-12
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-11
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-11
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-11
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	8e-07
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-18
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-18
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-17
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-15
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	6e-11
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-16
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-15
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-15
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-14
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-14
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-14
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-14
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-08
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-16
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-09
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	7e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-14
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-13
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-13
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-12
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-12
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-12
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-12
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	8e-12
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	8e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-04
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-14
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-13
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-13
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-13
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-11
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-11
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-11
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-11
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-14
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-14
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-13
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-13
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-12
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-12
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-11
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	9e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-05
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	4e-12
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-11
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-10
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-12
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	9e-12
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-10
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-12
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	7e-11
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	8e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	7e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	9e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-05
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	7e-12
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	7e-12
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-10
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	8e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	5e-07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	5e-05
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	8e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-11
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-11
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-08
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-08
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-08
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-11
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	6e-10
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-10
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	5e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-06
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	8e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-10
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-09
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	5e-09
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	7e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-10
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	8e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	9e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-08
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-08
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-08
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-08
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	4e-10
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-09
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	5e-09
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-08
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	5e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-10
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	5e-09
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	7e-09
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	6e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	5e-10
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	8e-09
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	9e-10
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	7e-09
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-07
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	7e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-09
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	8e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	1e-08
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	5e-07
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	7e-04
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-08
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	5e-07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-06
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-06
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-06
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-08
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-08
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	5e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	7e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	5e-08
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	7e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	9e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-07
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	4e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-05
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	5e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	1e-07
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-07
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	2e-07
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	8e-05
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	4e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	6e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	7e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	7e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-07
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	8e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	6e-07
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-05
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	2e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	8e-07
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	9e-06
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	5e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	5e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	7e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	5e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	6e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-06
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	7e-06
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-05
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	6e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	7e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	8e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	9e-05
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	3e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	4e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-05
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	5e-05
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	3e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	5e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	8e-04
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	4e-06
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	9e-06
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-05
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	1e-04
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-04
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-04
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	4e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	8e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	4e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-04
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	4e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	6e-06
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	1e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	6e-06
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	6e-06
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	9e-06
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-05
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	4e-05
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-04
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	6e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-05
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	5e-04
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	6e-04
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	8e-06
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	1e-05
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-05
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	1e-04
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	9e-06
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	1e-05
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	1e-04
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	6e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	5e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	5e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	8e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-05
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	3e-04
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-05
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	6e-04
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	4e-05
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	5e-04
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	6e-05
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	8e-05
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-04
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	4e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	1e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	3e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	3e-04
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	2e-04
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	4e-04

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

 Score =  113 bits (286), Expect = 6e-28
 Identities = 37/115 (32%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 464 LGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSI 523
           + L    L G         ++ Q I+L+ NS+   +   +G   +L  LDL  N   G++
Sbjct: 202 VDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYGTL 260

Query: 524 PESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRAC 578
           P+ L QL  L  LN++ N L G +P   GG L       + +N  LCG P L AC
Sbjct: 261 PQGLTQLKFLHSLNVSFNNLCGEIPQ--GGNLQRFDVSAYANNKCLCGSP-LPAC 312

PyMOL of 1ogq

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Length = 174	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		663
2jwp_A		174	Malectin, MGC80075; sugar binding, sugar binding p	99.93
2jwp_A		174	Malectin, MGC80075; sugar binding, sugar binding p	99.83
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.69
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.63
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.61
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.53
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.48
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.48
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.47
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.47
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.43
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.42
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.4
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.38
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.37
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.36
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.36
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.34
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.33
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.32
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.32
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.32
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.32
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.3
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.28
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.26
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.23
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.22
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.22
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.22
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.21
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.21
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.2
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.2
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.19
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.19
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.17
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.16
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.16
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.15
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.15
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.15
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.14
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.13
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.12
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.12
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.1
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.1
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.09
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.08
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.08
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.08
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.08
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.07
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.06
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.03
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.03
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.03
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.02
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.02
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.01
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.01
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.0
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.99
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	98.98
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	98.98
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.98
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.98
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	98.97
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.97
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.96
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.96
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.96
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.96
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	98.96
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.96
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.95
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	98.95
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.94
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	98.94
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.94
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.93
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.93
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.93
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.93
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	98.92
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.91
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	98.91
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	98.91
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	98.9
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	98.85
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	98.85
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	98.84
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.83
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	98.81
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	98.81
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.8
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	98.77
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	98.74
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.73
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.71
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.68
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.67
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	98.67
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	98.66
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	98.64
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.64
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.63
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.62
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	98.6
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.59
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.59
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	98.58
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.57
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.56
1o6v_A		466	Internalin A; bacterial infection, extracellular r	98.55
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	98.55
1o6v_A		466	Internalin A; bacterial infection, extracellular r	98.53
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	98.51
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	98.5
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	98.45
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.45
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	98.43
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.43
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.42
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	98.36
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	98.36
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.23
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.21
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.16
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	98.02
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	97.94
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.83
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	97.81
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	97.62
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	97.57
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	97.48
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.42
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	97.28
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	97.09
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	97.04
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	96.93
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.81
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	96.51
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	96.12
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.9
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	95.83
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	95.61
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	95.03
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	94.85
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	94.76
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	91.81
2ks1_B		44	Epidermal growth factor receptor; ERBB1, ERBB2, tr	89.92
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	89.42
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	88.46
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	88.41
2l2t_A		44	Receptor tyrosine-protein kinase ERBB-4; transmemb	86.33
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	85.07
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	84.42
2jwa_A		44	Receptor tyrosine-protein kinase ERBB-2; transmemb	84.07
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	82.46

>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A*	Back alignment and structure

Probab=99.93  E-value=1.1e-26  Score=223.22  Aligned_cols=154  Identities=18%  Similarity=0.202  Sum_probs=114.1

Q ss_pred             EEEEeeccCCCCCCCCCCCCCCCCCCCCcccCCCCCCCCCccccccccceecCCCCCCCChHHHHhhccccCCCCCceEE
Q 006035          232 RTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQY  311 (663)
Q Consensus       232 ~~~~RiN~Gg~~~~~~~~~~~D~~~~DR~W~~~~~~~~~~~~~~~t~~~i~~~~~~~~~~P~~Vy~TAr~~~~~~~nlt~  311 (663)
                      |++|||||||+...   |    .  .+|.|.+|..+...+... .....+..  .....+|..||||||.+..   +++|
T Consensus         5 ~~~~~INcGg~~~~---d----~--~gr~w~~D~~~~~~g~~~-~~~~~~~~--~~~~~~~~~lY~TaR~~~~---~~tY   69 (174)
T 2jwp_A            5 KVIWAVNAGGESHV---D----V--HGIHYRKDPLEGRVGRAS-DYGMKLPI--LRSNPEDQVLYQTERYNED---SFGY   69 (174)
T ss_dssp             HEEEEEEETSSSEE---E----T--TTEEECSSCSSTTCCCCC-CCCTTSCC--SSSCHHHHHTTTCCCCCCS---CEEE
T ss_pred             cEEEEEECCCCCcc---C----C--CCCEEcCCcCcccCCccc-ccccceEe--cccCCCCchhhhhhccCCC---CeEE
Confidence            67999999998642   2    2  278888876432111110 00111111  1123468899999999764   4999


Q ss_pred             EEecCCCCcEEEEEEEeeccCCCCCcceEEEEEEECCeecccCCccccccCCceEEEEEEEEEe-------------ecC
Q 006035          312 TMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVA-------------VNG  378 (663)
Q Consensus       312 ~~~v~~~~~y~vrLhFaEi~~~~~~~~~R~F~V~ing~~~~~~~di~~~~~~~~~~~~~~~~v~-------------~~~  378 (663)
                      .|+++++|+|+|||||||+..  .+.++|+|||+|||++++++|||..++|+ ..++++++.+.             +.+
T Consensus        70 ~f~v~~~G~Y~VrLhF~ei~~--~~~~~rvFdV~ing~~~l~~fdi~~~ag~-~~~~~~~~~~~v~~~~l~i~~~~~~~~  146 (174)
T 2jwp_A           70 DIPIKEEGEYVLVLKFAEVYF--AQSQQKVFDVRVNGHTVVKDLDIFDRVGH-STAHDEIIPISIKKGKLSVQGEVSTFT  146 (174)
T ss_dssp             EEECCSCEEEEEEEEEECCSC--CCSSSSCEEEEETTEEEEEEECHHHHHSS-SSCEEEEEEEEEETTEEEETTEEEECC
T ss_pred             EEEeCCCeEEEEEEEEecccc--CCCCCeEeEEEECCEEeecCcCHHHhhCC-CeeEEEEEEEEEecCceeeeeeecccC
Confidence            999999999999999999975  45799999999999999999999998876 45666766654             356


Q ss_pred             eeEEEEEccCCCCHHHHHHHhhhhh
Q 006035          379 RTLTVTLHPKGGSHAIINAIEVFEI  403 (663)
Q Consensus       379 ~~l~i~~~p~~~s~piLNaiEi~~~  403 (663)
                      ++|+|+|.|.....|+||||||++.
T Consensus       147 g~L~I~f~p~~~~~a~inaIEI~~~  171 (174)
T 2jwp_A          147 GKLSVEFVKGYYDNPKVCALFIMKG  171 (174)
T ss_dssp             SEEEEEEECSSSCSSSEEEEEEESS
T ss_pred             CeEEEEEeccCCCCcEEEEEEEEeC
Confidence            7899999987666799999999874

PyMOL of 2jwp

>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		663
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-13
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	7e-10
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	7e-04
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	7e-04
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	0.001
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	2e-12
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	9e-08
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	2e-09
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	4e-06
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	6e-06
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	8e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	1e-08
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	1e-07
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-07
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	4e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.003
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	5e-08
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	4e-07
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	4e-04
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	4e-06
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	3e-04
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	8e-06
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	9e-05
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	1e-04
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	9e-06
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	9e-05
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	3e-04
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	4e-05
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	5e-05
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	5e-04
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	6e-05
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	6e-04
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	0.002

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 70.4 bits (171), Expect = 2e-13
 Identities = 25/125 (20%), Positives = 42/125 (33%), Gaps = 7/125 (5%)

Query: 418 LQVLKNS-LDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLP 476
           L  LK     + +     G   +                S+   +  L L    +    P
Sbjct: 265 LTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP 324

Query: 477 NGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRL 536
             +S L  LQ +  + N +     SSL  + ++  L   +N  +   P  L  LT + +L
Sbjct: 325 --VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQL 378

Query: 537 NLNGN 541
            LN  
Sbjct: 379 GLNDQ 383

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		663
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.75
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.46
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.28
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.16
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.14
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.14
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.14
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.14
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.95
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.87
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.83
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.79
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.71
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.71
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.65
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.46
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.44
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.36
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.36
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.26
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.25
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.24
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.18
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	98.16
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.16
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	97.89
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	97.89
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	97.87
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	97.82
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.52
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	97.31
d2o14a1		146	Hypothetical protein YxiM {Bacillus subtilis [TaxI	97.29
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	97.24
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.16
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	97.01
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	96.79
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	96.78
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	96.7
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	96.66
d2o14a1		146	Hypothetical protein YxiM {Bacillus subtilis [TaxI	96.42
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	94.98
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	94.03
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	88.46

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.75  E-value=5.3e-19  Score=182.70  Aligned_cols=155  Identities=26%  Similarity=0.498  Sum_probs=135.5

Q ss_pred             CchHHHHHHHHhhhcCCCCCC-CCCC--CCCCCCCCCCCCCcccccCCCCccceEeEEEccCCCCcc--cCCccccCCCc
Q 006035          410 TLPEEVRALQVLKNSLDLPHR-FGWN--GDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRG--FLPNGISKLRH  484 (663)
Q Consensus       410 ~~~~d~~aL~~~k~~~~~~~~-~~W~--~~pC~p~~~~w~gv~C~~~~~~~~~~l~~L~Ls~n~l~g--~~p~~~~~L~~  484 (663)
                      +.++|..||++||+++.++.. .+|.  +|+|.   +.|.||+|+...  ...+|+.|+|+++++.|  .+|+.+++|++
T Consensus         3 c~~~e~~aLl~~k~~~~~~~~l~sW~~~~d~C~---~~w~gv~C~~~~--~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~   77 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCN---RTWLGVLCDTDT--QTYRVNNLDLSGLNLPKPYPIPSSLANLPY   77 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCGGGTTCCTTSCTTT---TCSTTEEECCSS--SCCCEEEEEEECCCCSSCEECCGGGGGCTT
T ss_pred             CCHHHHHHHHHHHHHCCCCCcCCCCCCCCCCCC---CcCCCeEEeCCC--CcEEEEEEECCCCCCCCCCCCChHHhcCcc
Confidence            678999999999999887642 4795  46664   469999997533  23479999999999998  58999999999


Q ss_pred             CCcccCcC-ccccccCCCCCCCCCCCcEEeCCCCCCCCCCcccccCCCCCCEEeccCCcCCccCCchhhhccCCCCEEec
Q 006035          485 LQSINLSG-NSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFNF  563 (663)
Q Consensus       485 L~~L~Ls~-N~l~g~ip~~~~~L~~L~~LdLs~N~l~g~iP~~l~~l~~L~~L~Ls~N~lsg~iP~~~~~~l~~L~~l~l  563 (663)
                      |+.|+|++ |+++|.+|..|++|++|++|||++|++.+..|..+..+..|+.++++.|++.+.+|..+.. +..++.+++
T Consensus        78 L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~-l~~L~~l~l  156 (313)
T d1ogqa_          78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISS-LPNLVGITF  156 (313)
T ss_dssp             CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGG-CTTCCEEEC
T ss_pred             ccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhcc-Ccccceeec
Confidence            99999997 8999999999999999999999999999999998999999999999999999999998876 788999999


Q ss_pred             cCCCCCC
Q 006035          564 TDNAGLC  570 (663)
Q Consensus       564 ~~N~~lc  570 (663)
                      ++|....
T Consensus       157 ~~n~l~~  163 (313)
T d1ogqa_         157 DGNRISG  163 (313)
T ss_dssp             CSSCCEE
T ss_pred             ccccccc
Confidence            9987543

PyMOL of d1ogqa_

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure