Citrus Sinensis ID: 006120

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660
MVSEASSSSIVDERAIESQKKQRTAAWAVSPNHGIVFDDTWKIVDDLEILVKRLKAKQAKDGKLKGDNSDAFSDAGWSRELGTSAEISEKRVFWEESTHDYAVFVKELGVLRNRADGARSREEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGNCLYVLGRYREAKEEYLLALEAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKPGHVDALYNLGGLYMDLGAGETEEAKKALKEALKMTNRVELHDAVSHLKQLQKKKSKGNRGTNGEGGFDIVEPSKFKTVGERTTVRQDLANALEIRAFQKITRLSRCDVELLKKEMSETDVPVSYSGGGGPQKSIRKPNLEEILRKFLHFLKPETFQGAVKAINERILSVLDETGSARVDLGMFYAILAPICSGSPEKRKRVAFDALLWRPVNEGSTQVRKVDAVRYIKLLRAVYIPSHGVSEMMEVHGEADSSMVSLSEFLVMFDDPDWGFGIMSTLMKLEAGDRNRHGRHVCSVCRYPIIGSRFKEMKSHFSLCSQCYSEGKVPPTFKQDEYKFKEYGSESEAMKDKCICFTSQSHNAS
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccHHHHHHHcHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHcccccHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccHHHcHHHHHHHHHHHHHHccccccHHHHHHHcccccHHHccHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHHcccHHHHHHHHHHHccccccccc
ccccccccccccHHHHHHHHHHccHHHHccccccEEEccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccEEEcccccccHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcHcccccHHHHHHHHHHHHHccccccccccEcHHHHHHHHHHHHHEEccccccHHHHHHcccccccEEcHHHHHHHcccccccccHHHHHHHHccccccccccEEEEEEEccEEcccHHHHHccccccccccccccccccccHcHEEEEccccHHHHHHHHcEEccccccccc
mvseassssivdERAIESQKKQRTAawavspnhgivfddtwkIVDDLEILVKRLKAKqakdgklkgdnsdafsdagwsrelgtsaeisEKRVFWEESTHDYAVFVKELGVlrnradgarsreeaFDGHMAIGRVLYEHQLFKEALVSFKRacelqptdvrphfragncLYVLGRYREAKEEYLLALEAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIfikpdyadAHCDLASALHAMGEDERAIEVFQKAidlkpghvDALYNLGglymdlgagETEEAKKALKEALKMTNRVELHDAVSHLKQLQKkkskgnrgtngeggfdivepskfktvgeRTTVRQDLANALEIRAFQKITRLSRCDVELLKKEmsetdvpvsysggggpqksirkpNLEEILRKFLHFLKPETFQGAVKAINERILSVLDetgsarvdLGMFYAILapicsgspekrKRVAFDAllwrpvnegstqvrKVDAVRYIKLLRAVYipshgvsemMEVHGEADSSMVSLSEFLvmfddpdwgfgIMSTLMKleagdrnrhgrhvcsvcrypiigsrfkEMKSHFslcsqcysegkvpptfkqdeykfkeygseseamkdkcicftsqshnas
mvseassssivdeRAIESQKKqrtaawavspnhgivfddtwKIVDDLEILVKRLKakqakdgklkgdnsdafsdagwsrelgtsaeISEKRVFWEESTHDYAVFVKELGVLRNRADGARSREEAFDGHMAIGRVLYEHQLFKEALVSFKRACelqptdvrphfraGNCLYVLGRYREAKEEYLLALEAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKPGHVDALYNLGGLYMDLGAGETEEAKKALKEALKMTNRVELHDAVSHLkqlqkkkskgnrgtngeggfdivepskfktvgerttVRQDLANAleirafqkitrlsrcDVELLKKemsetdvpvsysggggpqksirKPNLEEILRKFLHFLKPETFQGAVKAINERILSVLDETGSARVDLGMFYAILApicsgspeKRKRVAFDALlwrpvnegstqvrkvdAVRYIKLLRAVYIPSHGVSEMMEVHGEADSSMVSLSEFLVMFDDPDWGFGIMSTLMKLeagdrnrhgrhvCSVCRYPIIGSRFKEMKSHFSLCSQCYSegkvpptfkqDEYKFKEYgseseamkdkCICFTSQSHNAS
MVSEASSSSIVDERAIESQKKQRTAAWAVSPNHGIVFDDTWKIVDDLEILVKRLKAKQAKDGKLKGDNSDAFSDAGWSRELGTSAEISEKRVFWEESTHDYAVFVKELGVLRNRADGARSREEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGNCLYVLGRYReakeeyllaleaaeTGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKPGHVDALYNLGGLYMDlgageteeakkalkealkMTNRVELHDAVshlkqlqkkkskGNRGTNGEGGFDIVEPSKFKTVGERTTVRQDLANALEIRAFQKITRLSRCDVELLKKEMSETDVPVSYSGGGGPQKSIRKPNLEEILRKFLHFLKPETFQGAVKAINERILSVLDETGSARVDLGMFYAILAPICSGSPEKRKRVAFDALLWRPVNEGSTQVRKVDAVRYIKLLRAVYIPSHGVSEMMEVHGEADSSMVSLSEFLVMFDDPDWGFGIMSTLMKLEAGDRNRHGRHVCSVCRYPIIGSRFKEMKSHFSLCSQCYSEGKVPPTFKQDEYKFKEYGSESEAMKDKCICFTSQSHNAS
************************AAWAVSPNHGIVFDDTWKIVDDLEILVKRLK*******************************ISEKRVFWEESTHDYAVFVKELGVLR********************RVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGNCLYVLGRYREAKEEYLLALEAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKPGHVDALYNLGGLYMDLGA********************************************************FKTVGERTTVRQDLANALEIRAFQKITRLSRCDVELL***************************LEEILRKFLHFLKPETFQGAVKAINERILSVLDETGSARVDLGMFYAILAPICSGSPEKRKRVAFDALLWRPVNEGSTQVRKVDAVRYIKLLRAVYIPSHGVSEMMEVHG****SMVSLSEFLVMFDDPDWGFGIMSTLMKLEAGDRNRHGRHVCSVCRYPIIGSRFKEMKSHFSLCSQCYSEGKVP**F*******************KCICF********
**SEASSSSIVDERAIESQKKQRTAAWAVSPNHGIVFDDTWKIVDDLEILVKRLKAKQAKDGKLKGDNSDAFSDAGWSRELGTSAEISEKRVFWEESTHDYAVFVKELGVLRNRADGARSREEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGNCLYVLGRYREAKEEYLLALEAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKPGHVDALYNLGGLYMDLGAGETEEAKKALKEALKMTNRVELHDAVSHLKQLQKKKSKGNRGTNGEGGFDIVEPSKFKTVGERTTVRQDLANALEIRAFQKITRLSRCDVELLKKEMSETDVPVSYSGGGGPQKSIRKPNLEEILRKFLHFLKPETFQGAVKAINERILSVLDETGSARVDLGMFYAILAPICSGSPEKRKRVAFDALLWRPVNEGSTQVRKVDAVRYIKLLRAVYIPSHGVSEMMEVHGEADSSMVSLSEFLVMFDDPDWGFGIMSTLMKLEAGDRNRHGRHVCSVCRYPIIGSRFKEMKSHFSLCSQCYSEGKVPPTFKQDEYKFKEYGSESEAMKDKCIC**S******
***************************AVSPNHGIVFDDTWKIVDDLEILVKRLKA************SDAFSDAGWSRELGTSAEISEKRVFWEESTHDYAVFVKELGVLRNRADGARSREEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGNCLYVLGRYREAKEEYLLALEAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKPGHVDALYNLGGLYMDLGAGETEEAKKALKEALKMTNRVELHDAVS****************NGEGGFDIVEPSKFKTVGERTTVRQDLANALEIRAFQKITRLSRCDVELLKKEMS****************SIRKPNLEEILRKFLHFLKPETFQGAVKAINERILSVLDETGSARVDLGMFYAILAPICSGSPEKRKRVAFDALLWRPVNEGSTQVRKVDAVRYIKLLRAVYIPSHGVSEMMEVHGEADSSMVSLSEFLVMFDDPDWGFGIMSTLMKLEAGDRNRHGRHVCSVCRYPIIGSRFKEMKSHFSLCSQCYSEGKVPPTFKQDEYKFKEYGSESEAMKDKCICF********
**************AIESQKKQRTAAWAVSPNHGIVFDDTWKIVDDLEILVKRLKAKQAKDGKLKGDNSDAFSDAGWSRELGTSAEISEKRVFWEESTHDYAVFVKELGVLRNRADGARSREEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGNCLYVLGRYREAKEEYLLALEAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKPGHVDALYNLGGLYMDLGAGETEEAKKALKEALKMTNRVELHDAVSHLKQLQKKKSKGNRGTNGEGGFDIVEPSKFKTVGERTTVRQDLANALEIRAFQKITRLSRCDVELLKKEMSETDVPVSYSGGGGPQKSIRKPNLEEILRKFLHFLKPETFQGAVKAINERILSVLDETGSARVDLGMFYAILAPICSGSPEKRKRVAFDALLWRPVNEGSTQVRKVDAVRYIKLLRAVYIPSHGVSEMMEVHGEADSSMVSLSEFLVMFDDPDWGFGIMSTLMKLEAGDRNRHGRHVCSVCRYPIIGSRFKEMKSHFSLCSQCYSEGKVPPTFKQDEYKFKEYGSESEAMKDKCICFTS******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSEASSSSIVDERAIESQKKQRTAAWAVSPNHGIVFDDTWKIVDDLEILVKRLKAKQAKDGKLKGDNSDAFSDAGWSRELGTSAEISEKRVFWEESTHDYAVFVKELGVLRNRADGARSREEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGNCLYVLGRYREAKEEYLLALEAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKPGHVDALYNLGGLYMDLGAGETEEAKKALKEALKMTNRVELHDAVSHLKQLQKKKSKGNRGTNGEGGFDIVEPSKFKTVGERTTVRQDLANALEIRAFQKITRLSRCDVELLKKEMSETDVPVSYSGGGGPQKSIRKPNLEEILRKFLHFLKPETFQGAVKAINERILSVLDETGSARVDLGMFYAILAPICSGSPEKRKRVAFDALLWRPVNEGSTQVRKVDAVRYIKLLRAVYIPSHGVSEMMEVHGEADSSMVSLSEFLVMFDDPDWGFGIMSTLMKLEAGDRNRHGRHVCSVCRYPIIGSRFKEMKSHFSLCSQCYSEGKVPPTFKQDEYKFKEYGSESEAMKDKCICFTSQSHNAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query660 2.2.26 [Sep-21-2011]
O23052808 Uncharacterized TPR repea yes no 0.989 0.808 0.772 0.0
Q8S8L9802 Uncharacterized TPR repea no no 0.995 0.819 0.757 0.0
Q27HV0 1046 UDP-N-acetylglucosamine-- yes no 0.271 0.171 0.299 1e-14
P81436 1046 UDP-N-acetylglucosamine-- yes no 0.271 0.171 0.299 1e-14
O15294 1046 UDP-N-acetylglucosamine-- yes no 0.271 0.171 0.299 1e-14
Q8CGY8 1046 UDP-N-acetylglucosamine-- yes no 0.271 0.171 0.299 1e-14
P56558 1036 UDP-N-acetylglucosamine-- yes no 0.271 0.172 0.299 1e-14
O18158 1151 UDP-N-acetylglucosamine-- yes no 0.412 0.236 0.273 3e-14
Q8BRH0920 Transmembrane and TPR rep no no 0.345 0.247 0.264 5e-10
Q9M8Y0 977 Probable UDP-N-acetylgluc no no 0.318 0.214 0.235 5e-10
>sp|O23052|Y1515_ARATH Uncharacterized TPR repeat-containing protein At1g05150 OS=Arabidopsis thaliana GN=At1g05150 PE=1 SV=1 Back     alignment and function desciption
 Score = 1112 bits (2876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/693 (77%), Positives = 609/693 (87%), Gaps = 40/693 (5%)

Query: 5   ASSSSIVDERAIESQKKQRTAAWAVSPNHGIVFDDTWKIVDDLEILVKRLKAKQAKDGKL 64
           ASSSSI DERA+E+QKKQRTAAWAVSPNHGIVFD+TWK+VDDLEILVKRLK+KQ KDGKL
Sbjct: 110 ASSSSITDERAVEAQKKQRTAAWAVSPNHGIVFDETWKLVDDLEILVKRLKSKQEKDGKL 169

Query: 65  KGDNS----DAFSDAGWSRELGTSAEISEKRVFWEESTHDYAVFVKELGVLRNRADGARS 120
           K DN+    DAFSDAGWSRELG S+EISEKR++WEES+HDY VFVKELGVLR++ADGARS
Sbjct: 170 KADNNNNNVDAFSDAGWSRELGPSSEISEKRIYWEESSHDYGVFVKELGVLRSKADGARS 229

Query: 121 REEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGNCLYVLGRYREAKE 180
           REEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHF+AGNCLYVLG+ +E+K+
Sbjct: 230 REEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFKAGNCLYVLGKCKESKD 289

Query: 181 EYLLALEAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKL 240
           E+LLALEAAE+GGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRE+AILCPTHFRALKL
Sbjct: 290 EFLLALEAAESGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYREAAILCPTHFRALKL 349

Query: 241 LGSALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKP 300
           LGSALFGVGEYRAAVKALEEAI++KPDYADAHCDLAS+LH+MGEDERAIEVFQ+AIDLKP
Sbjct: 350 LGSALFGVGEYRAAVKALEEAIYLKPDYADAHCDLASSLHSMGEDERAIEVFQRAIDLKP 409

Query: 301 GHVDALYNLGGLYMD--------------------------------LGAGETEEAKKAL 328
           GHVDALYNLGGLYMD                                LGAGETEEAK+AL
Sbjct: 410 GHVDALYNLGGLYMDLGRFQRASEMYTRVLTVWPNHWRAQLNKAVSLLGAGETEEAKRAL 469

Query: 329 KEALKMTNRVELHDAVSHLKQLQ-KKKSKGNRGTNGEGGFDIVEPSKFKTVGERTTVRQD 387
           KEALK+TNRVELHDA+SHLK LQ KK      G  GEG F +VEPSKFKTVGE+TT+R D
Sbjct: 470 KEALKLTNRVELHDAISHLKHLQKKKGKNNGNGNGGEGPFIVVEPSKFKTVGEKTTLRPD 529

Query: 388 LANALEIRAFQKITRLSRCDVELLKKEMSETDVPVSYSGGGGPQKSIRKPNLEEILRKFL 447
           LA AL+IRAFQ++TRL +CDVE ++KEM + DVPVSYSG GGP KSIRKPNLEEILR+ L
Sbjct: 530 LATALQIRAFQRVTRLGKCDVEAVRKEMRDNDVPVSYSGSGGPTKSIRKPNLEEILRRLL 589

Query: 448 HFLKPETFQGAVKAINERILSVLDETGSARVDLGMFYAILAPICSGSPEKRKRVAFDALL 507
             LKP+TFQGA+KAINE+IL++LD++GS RVD+GMFYA++AP+C G  +KRKRVAFDALL
Sbjct: 590 SSLKPDTFQGAIKAINEKILALLDDSGSGRVDMGMFYAVIAPLCGGHSDKRKRVAFDALL 649

Query: 508 WRPVNEGSTQVRKVDAVRYIKLLRAVYIPSHGVSEMMEVHG--EADSSM-VSLSEFLVMF 564
           WRPVNEGS+Q+ K DAV+YIKLLRA+YIPSHG+SEM+EVHG  EA+SS+ V+ ++FL MF
Sbjct: 650 WRPVNEGSSQITKTDAVKYIKLLRAIYIPSHGMSEMLEVHGEEEAESSVTVTFNQFLAMF 709

Query: 565 DDPDWGFGIMSTLMKLEAGDRNRHGRHVCSVCRYPIIGSRFKEMKSHFSLCSQCYSEGKV 624
           DDPDWGFGIMST++KLEA DRNRHG  VCSVCRYP+IGSRFKE+K+ FSLC+QCY EGKV
Sbjct: 710 DDPDWGFGIMSTILKLEANDRNRHGNQVCSVCRYPVIGSRFKEVKARFSLCNQCYGEGKV 769

Query: 625 PPTFKQDEYKFKEYGSESEAMKDKCICFTSQSH 657
           PP+FKQ+EYKF+EY SE+EAMK KC+CF+ QSH
Sbjct: 770 PPSFKQEEYKFREYESEAEAMKAKCVCFSMQSH 802

Arabidopsis thaliana (taxid: 3702)
>sp|Q8S8L9|Y2245_ARATH Uncharacterized TPR repeat-containing protein At2g32450 OS=Arabidopsis thaliana GN=At2g32450 PE=1 SV=1 Back     alignment and function description
>sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 Back     alignment and function description
>sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 Back     alignment and function description
>sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 Back     alignment and function description
>sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 Back     alignment and function description
>sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 Back     alignment and function description
>sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BRH0|TMTC3_MOUSE Transmembrane and TPR repeat-containing protein 3 OS=Mus musculus GN=Tmtc3 PE=2 SV=2 Back     alignment and function description
>sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query660
224062053 797 predicted protein [Populus trichocarpa] 0.992 0.821 0.835 0.0
224085786 797 predicted protein [Populus trichocarpa] 0.993 0.823 0.832 0.0
255538832 804 tetratricopeptide repeat protein, tpr, p 0.996 0.818 0.839 0.0
449449561 798 PREDICTED: uncharacterized TPR repeat-co 1.0 0.827 0.803 0.0
449511777 798 PREDICTED: uncharacterized TPR repeat-co 1.0 0.827 0.803 0.0
359492186 799 PREDICTED: uncharacterized TPR repeat-co 0.986 0.814 0.809 0.0
147806293 799 hypothetical protein VITISV_011396 [Viti 0.986 0.814 0.809 0.0
356534892 802 PREDICTED: uncharacterized TPR repeat-co 0.992 0.816 0.810 0.0
357439791 832 TPR repeat-containing protein, putative 0.992 0.787 0.802 0.0
302142595 778 unnamed protein product [Vitis vinifera] 0.981 0.832 0.807 0.0
>gi|224062053|ref|XP_002300731.1| predicted protein [Populus trichocarpa] gi|222842457|gb|EEE80004.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1198 bits (3100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/687 (83%), Positives = 616/687 (89%), Gaps = 32/687 (4%)

Query: 4   EASSSSIVDERAIESQKKQRTAAWAVSPNHGIVFDDTWKIVDDLEILVKRLKAKQAKDGK 63
           EASSSSIVDER IESQKKQRTA WAVSPNHGIVFDDTWKIVDDLEIL+KRLKAKQAKDGK
Sbjct: 109 EASSSSIVDERVIESQKKQRTADWAVSPNHGIVFDDTWKIVDDLEILIKRLKAKQAKDGK 168

Query: 64  LKGDNSDAFSDAGWSRELGTSAEISEKRVFWEESTHDYAVFVKELGVLRNRADGARSREE 123
            K DN DAFSDAGWSRELG S+EIS+KRVFWEES  DYA+FVKELGVLR+RADGARSREE
Sbjct: 169 YKADNFDAFSDAGWSRELGPSSEISDKRVFWEESGSDYALFVKELGVLRSRADGARSREE 228

Query: 124 AFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGNCLYVLGRYREAKEEYL 183
           AFDGHMAIGRVLY+HQLFKEALVSFKRACELQP DVRPHFRAGNCLYVLG+Y+EAKEE+L
Sbjct: 229 AFDGHMAIGRVLYDHQLFKEALVSFKRACELQPVDVRPHFRAGNCLYVLGKYKEAKEEFL 288

Query: 184 LALEAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLGS 243
           LALEAAE GGNQW YLLPQIYVNLGIALEGEGMVLSACEYYRE+AILCPTHFRALKLLGS
Sbjct: 289 LALEAAEAGGNQWGYLLPQIYVNLGIALEGEGMVLSACEYYREAAILCPTHFRALKLLGS 348

Query: 244 ALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKPGHV 303
           ALFGVGEY+AAVKALEEAIF+KPD+ADAHCDLASALHAMG+DE+AIEVFQKAIDLKPGHV
Sbjct: 349 ALFGVGEYKAAVKALEEAIFMKPDFADAHCDLASALHAMGDDEKAIEVFQKAIDLKPGHV 408

Query: 304 DALYNLGGLYMD--------------------------------LGAGETEEAKKALKEA 331
           DALYNLGGLYMD                                LGAGETEEAKKALKEA
Sbjct: 409 DALYNLGGLYMDLGRFQRASEMYTRVLAVWPNHWRAQLNRAVSLLGAGETEEAKKALKEA 468

Query: 332 LKMTNRVELHDAVSHLKQLQKKKSKGNRGTNGEGGFDIVEPSKFKTVGERTTVRQDLANA 391
           LK+TNRVELHDA+SHLKQ+QKKK KGN G NGEG F IVEPSKFK + ++TT+RQDLANA
Sbjct: 469 LKLTNRVELHDAISHLKQIQKKKVKGNGGANGEGVFVIVEPSKFKRLNDKTTLRQDLANA 528

Query: 392 LEIRAFQKITRLSRCDVELLKKEMSETDVPVSYSGGGGPQKSIRKPNLEEILRKFLHFLK 451
           L+IRAFQ+ITRLSRCDVELLKKEMSE DVPVSYSGGG P+KSIRKPNLEE+LR+ L+FLK
Sbjct: 529 LQIRAFQRITRLSRCDVELLKKEMSENDVPVSYSGGGVPEKSIRKPNLEEVLRRLLNFLK 588

Query: 452 PETFQGAVKAINERILSVLDETGSARVDLGMFYAILAPICSGSPEKRKRVAFDALLWRPV 511
           PETFQGAVKAINERILSV DETG  RVDLGMFYAILAPICSG+PEKRKRVAFDALLWRPV
Sbjct: 589 PETFQGAVKAINERILSVFDETGQGRVDLGMFYAILAPICSGNPEKRKRVAFDALLWRPV 648

Query: 512 NEGSTQVRKVDAVRYIKLLRAVYIPSHGVSEMMEVHGEADSSMVSLSEFLVMFDDPDWGF 571
           +E  +Q++  DAV +IK LRA+Y+PSHGVSEM+EVHGEADSSMVS  EFLVMFDDPDWGF
Sbjct: 649 SESGSQIKAADAVTFIKFLRAIYVPSHGVSEMLEVHGEADSSMVSFKEFLVMFDDPDWGF 708

Query: 572 GIMSTLMKLEAGDRNRHGRHVCSVCRYPIIGSRFKEMKSHFSLCSQCYSEGKVPPTFKQD 631
           GIMSTLMKLE+GDRNRHG +VCSVCRYPIIGSRFKE+KSHFSLC+QCYSEGKVPP FKQD
Sbjct: 709 GIMSTLMKLESGDRNRHGHYVCSVCRYPIIGSRFKEIKSHFSLCNQCYSEGKVPPAFKQD 768

Query: 632 EYKFKEYGSESEAMKDKCICFTSQSHN 658
           EY FKEYGSE+EAMKDKC C   QSHN
Sbjct: 769 EYIFKEYGSEAEAMKDKCTCLPLQSHN 795

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224085786|ref|XP_002307696.1| predicted protein [Populus trichocarpa] gi|222857145|gb|EEE94692.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255538832|ref|XP_002510481.1| tetratricopeptide repeat protein, tpr, putative [Ricinus communis] gi|223551182|gb|EEF52668.1| tetratricopeptide repeat protein, tpr, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449449561|ref|XP_004142533.1| PREDICTED: uncharacterized TPR repeat-containing protein At1g05150-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449511777|ref|XP_004164050.1| PREDICTED: uncharacterized TPR repeat-containing protein At1g05150-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359492186|ref|XP_002280691.2| PREDICTED: uncharacterized TPR repeat-containing protein At1g05150-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147806293|emb|CAN76555.1| hypothetical protein VITISV_011396 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356534892|ref|XP_003535985.1| PREDICTED: uncharacterized TPR repeat-containing protein At1g05150-like [Glycine max] Back     alignment and taxonomy information
>gi|357439791|ref|XP_003590173.1| TPR repeat-containing protein, putative [Medicago truncatula] gi|355479221|gb|AES60424.1| TPR repeat-containing protein, putative [Medicago truncatula] Back     alignment and taxonomy information
>gi|302142595|emb|CBI19798.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query660
TAIR|locus:2207255808 AT1G05150 "AT1G05150" [Arabido 0.471 0.384 0.853 1.9e-145
TAIR|locus:2060206802 AT2G32450 "AT2G32450" [Arabido 0.474 0.390 0.844 2.5e-145
UNIPROTKB|F1NX56 1035 OGT "Uncharacterized protein" 0.265 0.169 0.299 2.1e-11
UNIPROTKB|A5D7G1 1036 OGT "OGT protein" [Bos taurus 0.265 0.168 0.294 4.5e-11
RGD|62060 1036 Ogt "O-linked N-acetylglucosam 0.265 0.168 0.294 4.5e-11
UNIPROTKB|E2QSQ5 1046 OGT "Uncharacterized protein" 0.265 0.167 0.294 4.6e-11
UNIPROTKB|O15294 1046 OGT "UDP-N-acetylglucosamine-- 0.265 0.167 0.294 4.6e-11
UNIPROTKB|F1RSV2 1046 OGT "UDP-N-acetylglucosamine-- 0.265 0.167 0.294 4.6e-11
UNIPROTKB|Q27HV0 1046 OGT "UDP-N-acetylglucosamine-- 0.265 0.167 0.294 4.6e-11
UNIPROTKB|P81436 1046 OGT "UDP-N-acetylglucosamine-- 0.265 0.167 0.294 4.6e-11
TAIR|locus:2207255 AT1G05150 "AT1G05150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1421 (505.3 bits), Expect = 1.9e-145, P = 1.9e-145
 Identities = 269/315 (85%), Positives = 291/315 (92%)

Query:     5 ASSSSIVDERAIESQKKQRTAAWAVSPNHGIVFDDTWKIVDDLEILVKRLKAKQAKDGKL 64
             ASSSSI DERA+E+QKKQRTAAWAVSPNHGIVFD+TWK+VDDLEILVKRLK+KQ KDGKL
Sbjct:   110 ASSSSITDERAVEAQKKQRTAAWAVSPNHGIVFDETWKLVDDLEILVKRLKSKQEKDGKL 169

Query:    65 KGDNS----DAFSDAGWSRELGTSAEISEKRVFWEESTHDYAVFVKELGVLRNRADGARS 120
             K DN+    DAFSDAGWSRELG S+EISEKR++WEES+HDY VFVKELGVLR++ADGARS
Sbjct:   170 KADNNNNNVDAFSDAGWSRELGPSSEISEKRIYWEESSHDYGVFVKELGVLRSKADGARS 229

Query:   121 REEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGNCLYVLGRYRXXXX 180
             REEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHF+AGNCLYVLG+ +    
Sbjct:   230 REEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFKAGNCLYVLGKCKESKD 289

Query:   181 XXXXXXXXXXTGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKL 240
                       +GGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRE+AILCPTHFRALKL
Sbjct:   290 EFLLALEAAESGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYREAAILCPTHFRALKL 349

Query:   241 LGSALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKP 300
             LGSALFGVGEYRAAVKALEEAI++KPDYADAHCDLAS+LH+MGEDERAIEVFQ+AIDLKP
Sbjct:   350 LGSALFGVGEYRAAVKALEEAIYLKPDYADAHCDLASSLHSMGEDERAIEVFQRAIDLKP 409

Query:   301 GHVDALYNLGGLYMD 315
             GHVDALYNLGGLYMD
Sbjct:   410 GHVDALYNLGGLYMD 424
GO:0005509 "calcium ion binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005886 "plasma membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0007020 "microtubule nucleation" evidence=RCA
GO:0009086 "methionine biosynthetic process" evidence=RCA
GO:0005768 "endosome" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISM
TAIR|locus:2060206 AT2G32450 "AT2G32450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NX56 OGT "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7G1 OGT "OGT protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|62060 Ogt "O-linked N-acetylglucosamine (GlcNAc) transferase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2QSQ5 OGT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O15294 OGT "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RSV2 OGT "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q27HV0 OGT "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P81436 OGT "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O23052Y1515_ARATHNo assigned EC number0.77200.98930.8081yesno
Q8S8L9Y2245_ARATHNo assigned EC number0.75710.99540.8192nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.1__459__AT1G05150.1
annotation not avaliable (809 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query660
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-19
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 7e-17
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-15
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 3e-15
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-13
pfam1341469 pfam13414, TPR_11, TPR repeat 6e-12
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 8e-11
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-10
pfam1341469 pfam13414, TPR_11, TPR repeat 6e-10
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-08
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-08
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-08
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 2e-08
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 2e-08
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 6e-08
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 9e-08
TIGR02552135 TIGR02552, LcrH_SycD, type III secretion low calci 1e-07
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-07
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-06
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-06
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 2e-06
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 4e-06
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-05
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-05
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 1e-05
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-05
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 4e-05
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 5e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-05
cd0224946 cd02249, ZZ, Zinc finger, ZZ type 5e-05
COG4700251 COG4700, COG4700, Uncharacterized protein conserve 9e-05
TIGR02552135 TIGR02552, LcrH_SycD, type III secretion low calci 1e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 2e-04
TIGR02795117 TIGR02795, tol_pal_ybgF, tol-pal system protein Yb 2e-04
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 3e-04
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 3e-04
smart01043145 smart01043, BTAD, Bacterial transcriptional activa 3e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 7e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.002
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.002
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 0.002
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 0.002
COG2956389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 0.003
pfam1342844 pfam13428, TPR_14, Tetratricopeptide repeat 0.003
smart0029144 smart00291, ZnF_ZZ, Zinc-binding domain, present i 0.003
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.004
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.004
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information 
 Score = 81.7 bits (202), Expect = 7e-19
 Identities = 39/97 (40%), Positives = 65/97 (67%), Gaps = 2/97 (2%)

Query: 237 ALKLLGSALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAI 296
           AL  LG+  + +G+Y  A++  E+A+ + PD ADA+ +LA+A + +G+ E A+E ++KA+
Sbjct: 2   ALLNLGNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKAL 61

Query: 297 DLKPGHVDALYNLGGLYMDLGAGETEEAKKALKEALK 333
           +L P +  A YNLG  Y  L  G+ EEA +A ++AL+
Sbjct: 62  ELDPDNAKAYYNLGLAYYKL--GKYEEALEAYEKALE 96

Length = 100
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|233924 TIGR02552, LcrH_SycD, type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|239069 cd02249, ZZ, Zinc finger, ZZ type Back     alignment and domain information
>gnl|CDD|227044 COG4700, COG4700, Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>gnl|CDD|233924 TIGR02552, LcrH_SycD, type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|188247 TIGR02795, tol_pal_ybgF, tol-pal system protein YbgF Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|198111 smart01043, BTAD, Bacterial transcriptional activator domain Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|222121 pfam13428, TPR_14, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197633 smart00291, ZnF_ZZ, Zinc-binding domain, present in Dystrophin, CREB-binding protein Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 660
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.93
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.92
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.92
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.91
KOG1126638 consensus DNA-binding cell division cycle control 99.9
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.89
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.88
KOG1126638 consensus DNA-binding cell division cycle control 99.88
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.88
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.87
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.87
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.87
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.86
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 99.85
PRK11189296 lipoprotein NlpI; Provisional 99.83
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.82
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.82
KOG0547606 consensus Translocase of outer mitochondrial membr 99.81
PRK12370553 invasion protein regulator; Provisional 99.81
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.8
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.8
KOG0547606 consensus Translocase of outer mitochondrial membr 99.8
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.8
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.79
KOG1129478 consensus TPR repeat-containing protein [General f 99.78
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.78
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.78
PRK12370553 invasion protein regulator; Provisional 99.77
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.77
KOG1125579 consensus TPR repeat-containing protein [General f 99.77
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.76
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.75
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.75
KOG1129478 consensus TPR repeat-containing protein [General f 99.75
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.75
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.73
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.73
KOG1125579 consensus TPR repeat-containing protein [General f 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
PLN02789320 farnesyltranstransferase 99.71
KOG2003840 consensus TPR repeat-containing protein [General f 99.71
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.71
PRK11189296 lipoprotein NlpI; Provisional 99.71
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.71
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.68
PLN02789320 farnesyltranstransferase 99.68
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.68
KOG2003840 consensus TPR repeat-containing protein [General f 99.67
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.67
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.66
KOG2076895 consensus RNA polymerase III transcription factor 99.66
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.65
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.64
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.64
PRK14574822 hmsH outer membrane protein; Provisional 99.63
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.61
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.61
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.6
KOG2076895 consensus RNA polymerase III transcription factor 99.6
PRK15359144 type III secretion system chaperone protein SscB; 99.58
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.58
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.58
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.55
PRK15359144 type III secretion system chaperone protein SscB; 99.55
PRK10370198 formate-dependent nitrite reductase complex subuni 99.52
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.52
PF13844 468 Glyco_transf_41: Glycosyl transferase family 41; P 99.51
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.5
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.5
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.49
PRK14574 822 hmsH outer membrane protein; Provisional 99.49
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.47
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.47
PRK10370198 formate-dependent nitrite reductase complex subuni 99.46
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.46
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.45
PLN032181060 maturation of RBCL 1; Provisional 99.45
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.44
KOG1128777 consensus Uncharacterized conserved protein, conta 99.43
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.42
PLN032181060 maturation of RBCL 1; Provisional 99.42
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.41
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.41
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.38
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.38
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.38
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.37
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.35
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.35
KOG0553304 consensus TPR repeat-containing protein [General f 99.33
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.33
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.33
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.32
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.31
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.31
KOG0553304 consensus TPR repeat-containing protein [General f 99.29
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.26
KOG1128777 consensus Uncharacterized conserved protein, conta 99.25
PLN03077857 Protein ECB2; Provisional 99.25
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.24
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.23
PLN03077857 Protein ECB2; Provisional 99.22
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.21
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.2
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.17
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.17
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.16
PRK04841903 transcriptional regulator MalT; Provisional 99.15
KOG1941518 consensus Acetylcholine receptor-associated protei 99.14
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.11
PRK04841903 transcriptional regulator MalT; Provisional 99.11
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.11
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.1
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.1
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.07
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.04
KOG1941518 consensus Acetylcholine receptor-associated protei 99.03
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.03
KOG2376652 consensus Signal recognition particle, subunit Srp 99.01
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.01
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.01
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.99
KOG1915677 consensus Cell cycle control protein (crooked neck 98.97
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.96
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.95
PRK11906458 transcriptional regulator; Provisional 98.94
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.94
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.94
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.94
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.93
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.93
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.93
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.92
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.92
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.92
KOG2376652 consensus Signal recognition particle, subunit Srp 98.9
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.9
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.89
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.89
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.88
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.86
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.86
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.85
KOG4648536 consensus Uncharacterized conserved protein, conta 98.85
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.84
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.83
KOG1915677 consensus Cell cycle control protein (crooked neck 98.82
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.8
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.8
PRK11906458 transcriptional regulator; Provisional 98.8
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.77
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.75
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.75
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.72
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.71
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.71
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.69
PRK15331165 chaperone protein SicA; Provisional 98.69
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.69
PRK10803263 tol-pal system protein YbgF; Provisional 98.68
PRK15331165 chaperone protein SicA; Provisional 98.67
PF12688120 TPR_5: Tetratrico peptide repeat 98.66
PRK10803263 tol-pal system protein YbgF; Provisional 98.64
COG4700251 Uncharacterized protein conserved in bacteria cont 98.63
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.63
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.62
COG3898531 Uncharacterized membrane-bound protein [Function u 98.57
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.55
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.55
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.54
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.53
PF12688120 TPR_5: Tetratrico peptide repeat 98.52
COG4700251 Uncharacterized protein conserved in bacteria cont 98.49
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.48
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.47
KOG4234271 consensus TPR repeat-containing protein [General f 98.46
PF1337173 TPR_9: Tetratricopeptide repeat 98.45
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.45
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.44
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.43
KOG4648536 consensus Uncharacterized conserved protein, conta 98.41
KOG4234271 consensus TPR repeat-containing protein [General f 98.4
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.39
PF1337173 TPR_9: Tetratricopeptide repeat 98.38
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.38
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.37
KOG4555175 consensus TPR repeat-containing protein [Function 98.37
KOG1585308 consensus Protein required for fusion of vesicles 98.37
KOG1586288 consensus Protein required for fusion of vesicles 98.34
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.32
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.31
KOG4555175 consensus TPR repeat-containing protein [Function 98.3
PF13512142 TPR_18: Tetratricopeptide repeat 98.29
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.27
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.26
PF13512142 TPR_18: Tetratricopeptide repeat 98.26
KOG1586288 consensus Protein required for fusion of vesicles 98.25
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.25
KOG1585308 consensus Protein required for fusion of vesicles 98.23
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.23
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.21
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.19
PF0056946 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc 98.12
KOG2610491 consensus Uncharacterized conserved protein [Funct 98.08
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.08
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.06
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.02
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.02
KOG2471696 consensus TPR repeat-containing protein [General f 97.92
smart0029144 ZnF_ZZ Zinc-binding domain, present in Dystrophin, 97.88
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.85
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.83
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.83
COG3898531 Uncharacterized membrane-bound protein [Function u 97.8
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.79
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.77
PF1342844 TPR_14: Tetratricopeptide repeat 97.73
KOG2471696 consensus TPR repeat-containing protein [General f 97.72
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.71
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.7
PF1342844 TPR_14: Tetratricopeptide repeat 97.66
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.66
cd0233449 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger pr 97.63
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.63
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.63
cd0234243 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger pre 97.63
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.62
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.59
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.57
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.55
PF1343134 TPR_17: Tetratricopeptide repeat 97.55
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.47
cd0233645 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present 97.46
PF1343134 TPR_17: Tetratricopeptide repeat 97.45
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.41
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.41
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.41
cd0234445 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present 97.38
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.35
cd0233849 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger pre 97.3
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.3
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.28
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.28
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.26
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.25
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.24
cd0233945 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger pre 97.23
KOG1550552 consensus Extracellular protein SEL-1 and related 97.22
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.22
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.19
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.18
cd0234043 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre 97.13
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.13
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.11
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.08
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.07
KOG1550552 consensus Extracellular protein SEL-1 and related 96.98
cd0234549 ZZ_dah Zinc finger, ZZ type. Zinc finger present i 96.98
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.98
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.97
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.95
cd0234148 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present 96.94
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.93
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.91
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.88
KOG1914656 consensus mRNA cleavage and polyadenylation factor 96.85
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 96.82
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 96.76
cd0224946 ZZ Zinc finger, ZZ type. Zinc finger present in dy 96.56
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.55
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.55
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.52
KOG0530318 consensus Protein farnesyltransferase, alpha subun 96.48
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.41
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.38
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.37
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.35
KOG4507886 consensus Uncharacterized conserved protein, conta 96.29
KOG1914656 consensus mRNA cleavage and polyadenylation factor 96.16
KOG0530318 consensus Protein farnesyltransferase, alpha subun 96.14
KOG1258577 consensus mRNA processing protein [RNA processing 96.07
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.98
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 95.86
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.84
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.79
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 95.76
KOG4507 886 consensus Uncharacterized conserved protein, conta 95.73
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.71
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.7
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.69
cd0233549 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present 95.64
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 95.61
KOG3783546 consensus Uncharacterized conserved protein [Funct 95.55
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.54
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.48
KOG1258577 consensus mRNA processing protein [RNA processing 95.48
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 95.46
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.42
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.39
cd0233741 ZZ_CBP Zinc finger, ZZ type. Zinc finger present i 95.39
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.32
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.29
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.18
PRK10941269 hypothetical protein; Provisional 95.17
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.13
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.08
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.01
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.01
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.96
PRK10941269 hypothetical protein; Provisional 94.94
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 94.93
COG5159421 RPN6 26S proteasome regulatory complex component [ 94.85
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 94.71
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.68
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.68
KOG1463411 consensus 26S proteasome regulatory complex, subun 94.68
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.66
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.64
KOG4301 434 consensus Beta-dystrobrevin [Cytoskeleton] 94.57
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.57
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 94.55
KOG4814872 consensus Uncharacterized conserved protein [Funct 94.46
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 94.44
cd0234348 ZZ_EF Zinc finger, ZZ type. Zinc finger present in 94.35
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.27
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.01
KOG4814872 consensus Uncharacterized conserved protein [Funct 93.87
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 93.7
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.67
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 93.66
KOG1463411 consensus 26S proteasome regulatory complex, subun 93.64
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 93.51
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.41
KOG20411189 consensus WD40 repeat protein [General function pr 93.35
KOG20411189 consensus WD40 repeat protein [General function pr 93.27
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.19
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.1
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.06
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 93.05
KOG1310758 consensus WD40 repeat protein [General function pr 93.02
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 92.98
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.9
KOG1310758 consensus WD40 repeat protein [General function pr 92.76
KOG2422665 consensus Uncharacterized conserved protein [Funct 92.64
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 92.62
KOG15381081 consensus Uncharacterized conserved protein WDR10, 92.52
KOG2581493 consensus 26S proteasome regulatory complex, subun 92.47
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 92.45
PF1286294 Apc5: Anaphase-promoting complex subunit 5 92.41
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 92.21
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 92.14
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 92.13
KOG4582278 consensus Uncharacterized conserved protein, conta 91.91
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.85
KOG4014248 consensus Uncharacterized conserved protein (conta 91.79
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.74
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 91.64
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 91.59
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 91.54
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 91.5
COG5159421 RPN6 26S proteasome regulatory complex component [ 91.46
KOG3364149 consensus Membrane protein involved in organellar 91.34
KOG15381081 consensus Uncharacterized conserved protein WDR10, 91.21
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 90.44
KOG3783546 consensus Uncharacterized conserved protein [Funct 90.05
COG5191435 Uncharacterized conserved protein, contains HAT (H 89.36
KOG3364149 consensus Membrane protein involved in organellar 89.18
KOG0529421 consensus Protein geranylgeranyltransferase type I 89.14
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 88.73
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 87.52
COG2912269 Uncharacterized conserved protein [Function unknow 87.38
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.27
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 86.95
COG2912269 Uncharacterized conserved protein [Function unknow 86.94
COG3629280 DnrI DNA-binding transcriptional activator of the 86.46
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 86.27
KOG0529421 consensus Protein geranylgeranyltransferase type I 86.16
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 86.12
COG3629280 DnrI DNA-binding transcriptional activator of the 86.06
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 85.5
COG1747711 Uncharacterized N-terminal domain of the transcrip 84.8
COG5191435 Uncharacterized conserved protein, contains HAT (H 84.09
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 84.02
KOG2422665 consensus Uncharacterized conserved protein [Funct 83.81
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 83.81
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 83.26
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 82.85
COG1747711 Uncharacterized N-terminal domain of the transcrip 82.78
KOG4286 966 consensus Dystrophin-like protein [Cell motility; 82.62
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.55
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.37
COG4941415 Predicted RNA polymerase sigma factor containing a 82.29
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 81.56
COG4455273 ImpE Protein of avirulence locus involved in tempe 81.09
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 80.63
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.3e-51  Score=419.53  Aligned_cols=551  Identities=15%  Similarity=0.145  Sum_probs=392.2

Q ss_pred             HhhhcCCcchhhccCchHHHHhccCchhhHHHHHHHHHHHHhhccCCcCCchHHhhhHHHHH---------------HhC
Q 006120           18 SQKKQRTAAWAVSPNHGIVFDDTWKIVDDLEILVKRLKAKQAKDGKLKGDNSDAFSDAGWSR---------------ELG   82 (660)
Q Consensus        18 ~~~~~~p~~~~~~~~lg~~y~~~~~~~~al~~~~~~~~~a~~~~~~l~~~~~~a~~~~~~~~---------------~l~   82 (660)
                      .-.+.+|-..++|.|+|.++-+.|++.+++..+..+++        +.+++.+++..++..+               .+.
T Consensus       107 ~a~r~~~q~ae~ysn~aN~~kerg~~~~al~~y~~aie--------l~p~fida~inla~al~~~~~~~~a~~~~~~alq  178 (966)
T KOG4626|consen  107 LAIRKNPQGAEAYSNLANILKERGQLQDALALYRAAIE--------LKPKFIDAYINLAAALVTQGDLELAVQCFFEALQ  178 (966)
T ss_pred             hhhhccchHHHHHHHHHHHHHHhchHHHHHHHHHHHHh--------cCchhhHHHhhHHHHHHhcCCCcccHHHHHHHHh
Confidence            34566888899999999999999999999999999988        6777777776665443               334


Q ss_pred             CchHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhhccCcHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHH
Q 006120           83 TSAEISEKRVFWEESTHDYAVFVKELGVLRNRADGARSREEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPH  162 (660)
Q Consensus        83 ~~~~~~~~~~~l~~~~~~~g~~~~Al~~l~~a~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~  162 (660)
                      ..|....+...+|.+....|...+|-..|.+++...+..   +.+|.++|.++..+|+...|+..|+++++++|+.++++
T Consensus       179 lnP~l~ca~s~lgnLlka~Grl~ea~~cYlkAi~~qp~f---AiawsnLg~~f~~~Gei~~aiq~y~eAvkldP~f~dAY  255 (966)
T KOG4626|consen  179 LNPDLYCARSDLGNLLKAEGRLEEAKACYLKAIETQPCF---AIAWSNLGCVFNAQGEIWLAIQHYEEAVKLDPNFLDAY  255 (966)
T ss_pred             cCcchhhhhcchhHHHHhhcccchhHHHHHHHHhhCCce---eeeehhcchHHhhcchHHHHHHHHHHhhcCCCcchHHH
Confidence            466666777777888888888888888888888765533   47788888888888888888888888888888888888


Q ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHHhccCCCchhchHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCcHHHHHHHH
Q 006120          163 FRAGNCLYVLGRYREAKEEYLLALEAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLG  242 (660)
Q Consensus       163 ~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg  242 (660)
                      ++||++|...+.+++|+.+|.+|+.+.|.        .+.++.++|.+|..+|..+-|+..|++++++.|..++++.++|
T Consensus       256 iNLGnV~ke~~~~d~Avs~Y~rAl~lrpn--------~A~a~gNla~iYyeqG~ldlAI~~Ykral~~~P~F~~Ay~Nla  327 (966)
T KOG4626|consen  256 INLGNVYKEARIFDRAVSCYLRALNLRPN--------HAVAHGNLACIYYEQGLLDLAIDTYKRALELQPNFPDAYNNLA  327 (966)
T ss_pred             hhHHHHHHHHhcchHHHHHHHHHHhcCCc--------chhhccceEEEEeccccHHHHHHHHHHHHhcCCCchHHHhHHH
Confidence            88888888888888888888888888888        7888888888888888888888888888888888888888888


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhCCChHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHhcCCCHH
Q 006120          243 SALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKPGHVDALYNLGGLYMDLGAGETE  322 (660)
Q Consensus       243 ~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~La~~~~~~~~g~~~  322 (660)
                      ..+...|+..+|+.+|.+++.+.|+.+++.+|||.+|.++|++++|...|.++++..|..+.++.+||.+|.++  |+++
T Consensus       328 nALkd~G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa~nNLa~i~kqq--gnl~  405 (966)
T KOG4626|consen  328 NALKDKGSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNNLASIYKQQ--GNLD  405 (966)
T ss_pred             HHHHhccchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhhhhhhhhHHHHHHhc--ccHH
Confidence            88888888888888888888888888888888888888888888888888888888888888888888888877  8888


Q ss_pred             HHHHHHHHHHcccCCh-hHHHHHHHHHH-------HHHHhccCCCCCCCCCCccccCcchHHhhchhhhhhhhHHHHhcC
Q 006120          323 EAKKALKEALKMTNRV-ELHDAVSHLKQ-------LQKKKSKGNRGTNGEGGFDIVEPSKFKTVGERTTVRQDLANALEI  394 (660)
Q Consensus       323 eA~~~~~~al~l~p~~-~~~~~~~~l~~-------l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~al~~  394 (660)
                      +|+.+|++++++.|.. +....++.-.+       ......++....+...+...-.++++...|+...|...|..+|.+
T Consensus       406 ~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~AeAhsNLasi~kDsGni~~AI~sY~~aLkl  485 (966)
T KOG4626|consen  406 DAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAEAHSNLASIYKDSGNIPEAIQSYRTALKL  485 (966)
T ss_pred             HHHHHHHHHHhcCchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHHHHhhHHHHhhccCCcHHHHHHHHHHHcc
Confidence            8888888888888762 22222222111       111111222222222233333456677778888888999999886


Q ss_pred             HHHHH-------HHHHhccCHHHHHH-----------Hhh-------CCCcccccc------------------------
Q 006120          395 RAFQK-------ITRLSRCDVELLKK-----------EMS-------ETDVPVSYS------------------------  425 (660)
Q Consensus       395 ~~~~~-------~~~~~~~~~~~~~~-----------~l~-------~~~~~~~~~------------------------  425 (660)
                      ++...       ..-...|+|....+           ++.       .|.....++                        
T Consensus       486 kPDfpdA~cNllh~lq~vcdw~D~d~~~~kl~sivrdql~~~rlpsvhP~hsm~ypl~~~~~~aia~k~a~~c~~~~~~~  565 (966)
T KOG4626|consen  486 KPDFPDAYCNLLHCLQIVCDWTDYDKRMKKLVSIVRDQLEKNRLPSVHPHHSMLYPLSHILRKAIAAKHANLCLDKVHVL  565 (966)
T ss_pred             CCCCchhhhHHHHHHHHHhcccchHHHHHHHHHHHHHHHhhhcCCccCcccccccccchHHHHHHHHHHhhhhHHHHHhc
Confidence            64311       11111233333222           221       111000000                        


Q ss_pred             -CCCC-CCCCccCcchHHHHHhhhccCCCcchHHHHHHHHHHhhhhccCCCcccccchhhhhhhcccCCCCHHHHHHhhh
Q 006120          426 -GGGG-PQKSIRKPNLEEILRKFLHFLKPETFQGAVKAINERILSVLDETGSARVDLGMFYAILAPICSGSPEKRKRVAF  503 (660)
Q Consensus       426 -~~~~-~~~~ir~~~~~~~~~~~iGY~S~df~~H~v~~l~~~~l~~hDr~g~~~fev~~y~~~~~~~~~~~~~~r~r~~~  503 (660)
                       .+.. ..+.+..    +..|+||||||+||.+||++|||++++.+|||+   +|||++|  ++.++++..+|.++-...
T Consensus       566 ~k~pyth~~~l~~----~~~rlrIGYvSsDFgnHp~Shlmqsv~gmHdr~---kveVfcY--als~~d~t~fR~kv~~e~  636 (966)
T KOG4626|consen  566 GKPPYTHPDNLKV----KEGRLRIGYVSSDFGNHPTSHLMQSVPGMHDRS---KVEVFCY--ALSVNDGTNFRDKVMKEA  636 (966)
T ss_pred             cCCCCCChhhCCC----CcCceEEEeecccccCCchHHHhccCcCcCCcc---ceEEEEE--EeecCCCchHHHHHHhhc
Confidence             0000 0111111    112344999999999999999999999999999   9999999  889999999999999999


Q ss_pred             hhhcccccCCCC----ccchhccHHHHHHHhHHHhccCCCchhhhhhhcc-CCCcccchhHHhhh---------ccC---
Q 006120          504 DALLWRPVNEGS----TQVRKVDAVRYIKLLRAVYIPSHGVSEMMEVHGE-ADSSMVSLSEFLVM---------FDD---  566 (660)
Q Consensus       504 d~~~~~~~~~~~----a~~i~~D~~~~l~dL~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~---------~~~---  566 (660)
                      +  +|.+++..+    |.+|+.|.|+||+.|-   |.|.|.+.  |+.+- +.+.+|+|.+|+.+         .||   
T Consensus       637 e--hf~Dls~i~~~kiA~~I~qD~I~ILvnln---GyTkgarn--eifAlrPAPIQv~wlGyPgTtGa~~mDYiITDs~t  709 (966)
T KOG4626|consen  637 E--HFVDLSQIPCNKIADKIRQDKIHILVNLN---GYTKGARN--EIFALRPAPIQVMWLGYPGTTGATFMDYIITDSVT  709 (966)
T ss_pred             c--ceeehhcCChHHHHHHHhhcCceEEEecc---cccccccc--ceeeccCCceeEEeecCCCCCCCceeeEEeecccC
Confidence            9  777777766    9999999999999885   56666654  43331 23333333332222         122   


Q ss_pred             --CCCcchhhhhhhhcc----cCcccc--------CCCccccccccccccccc
Q 006120          567 --PDWGFGIMSTLMKLE----AGDRNR--------HGRHVCSVCRYPIIGSRF  605 (660)
Q Consensus       567 --~~~~~~~~~~~~~~~----~~~~~~--------~~~~~~~~~~~~~~~~~~  605 (660)
                        +++...-.+.||.|.    -||..-        |++|+|+.=.+|.+--=|
T Consensus       710 sPl~~a~~ysEkLv~lPh~ffi~d~~qk~~~~~dpn~kP~r~~y~Lp~d~vvf  762 (966)
T KOG4626|consen  710 SPLELAQQYSEKLVYLPHCFFIGDHKQKNQDVLDPNNKPTRSQYGLPEDAVVF  762 (966)
T ss_pred             ChHHHHHHHHHHHhhCCceEEecCcccccccccCCCCCCCCCCCCCCCCeEEE
Confidence              122222333344332    366655        788999999988764433

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00569 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>cd02334 ZZ_dystrophin Zinc finger, ZZ type Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>cd02336 ZZ_RSC8 Zinc finger, ZZ type Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>cd02344 ZZ_HERC2 Zinc finger, ZZ type Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd02345 ZZ_dah Zinc finger, ZZ type Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd02249 ZZ Zinc finger, ZZ type Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>cd02335 ZZ_ADA2 Zinc finger, ZZ type Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>cd02337 ZZ_CBP Zinc finger, ZZ type Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4301 consensus Beta-dystrobrevin [Cytoskeleton] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>cd02343 ZZ_EF Zinc finger, ZZ type Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query660
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 3e-13
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 3e-08
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-11
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-11
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 6e-11
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 6e-11
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 9e-10
3pe3_A 723 Structure Of Human O-Glcnac Transferase And Its Com 8e-09
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 7e-07
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 3e-04
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure 
Iteration: 1

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 87/197 (44%), Gaps = 28/197 (14%)
Query: 125 FDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGN--CLY--------VLGR 174
            D ++ +G VL E ++F  A+ ++ RA  L P     H   GN  C+Y         +  
Sbjct: 203 LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVH---GNLACVYYEQGLIDLAIDT 259
Query: 175 YRXXXXXXXXXXXXXXTGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTH 234
           YR                        P  Y NL  AL+ +G V  A + Y  +  LCPTH
Sbjct: 260 YRRAIELQPH---------------FPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTH 304
Query: 235 FRALKLLGSALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQK 294
             +L  L +     G    AV+   +A+ + P++A AH +LAS L   G+ + A+  +++
Sbjct: 305 ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKE 364
Query: 295 AIDLKPGHVDALYNLGG 311
           AI + P   DA  N+G 
Sbjct: 365 AIRISPTFADAYSNMGN 381
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query660
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-42
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-42
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-42
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-41
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-41
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-39
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-26
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-41
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-37
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-28
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-24
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-41
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-37
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-31
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-27
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-39
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-31
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-28
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-26
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-19
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-38
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-29
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 6e-27
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-37
4eqf_A365 PEX5-related protein; accessory protein, tetratric 9e-34
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-30
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-27
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-19
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-36
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-36
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-36
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-22
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-36
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-31
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-29
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-24
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-20
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-10
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-36
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-23
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-35
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-33
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-33
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-28
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-22
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-22
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-13
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-06
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-35
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-34
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-34
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-31
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-31
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-29
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-28
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-16
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-35
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-28
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-27
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-27
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-17
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-35
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-35
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-34
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-31
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-22
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-35
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-33
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-33
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-33
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-30
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-28
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-26
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-16
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-25
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-12
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-34
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-31
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-30
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-26
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-22
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-20
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-20
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-15
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-13
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-33
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 9e-32
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-26
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-22
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-33
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-30
2gw1_A514 Mitochondrial precursor proteins import receptor; 9e-21
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-19
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-16
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-14
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-13
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-30
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 9e-27
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-30
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-29
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-28
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-26
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-29
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-28
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-28
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-26
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-26
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-26
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-24
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-21
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-17
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-13
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-13
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-29
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-25
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-23
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-21
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-21
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-06
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-29
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 6e-24
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 9e-24
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-21
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-13
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-29
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-23
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 9e-14
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 8e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-28
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-27
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-27
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-26
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-16
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-15
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-24
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-20
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 9e-13
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-24
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-23
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-22
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-23
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-16
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-12
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 5e-23
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 5e-17
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-08
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 8e-19
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-09
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-21
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 8e-19
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-16
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-15
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-20
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 8e-17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-12
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-11
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-20
2kat_A115 Uncharacterized protein; NESG, structure, structur 8e-19
2kat_A115 Uncharacterized protein; NESG, structure, structur 5e-10
2kat_A115 Uncharacterized protein; NESG, structure, structur 8e-10
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-07
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 9e-20
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-13
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-11
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 7e-06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-19
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 8e-16
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 7e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-09
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-19
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-12
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-09
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-19
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 7e-18
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 5e-16
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-15
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-07
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 9e-19
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-13
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 4e-12
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-18
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-18
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-13
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-12
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-10
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 4e-18
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-17
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 5e-18
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 5e-18
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-15
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 6e-18
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 7e-14
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 6e-17
3k9i_A117 BH0479 protein; putative protein binding protein, 6e-15
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-11
3k9i_A117 BH0479 protein; putative protein binding protein, 6e-08
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-07
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 7e-17
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-11
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-07
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-16
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-14
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-05
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-16
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-15
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-15
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 8e-15
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-10
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 5e-10
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-07
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 9e-15
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 1e-05
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 9e-15
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 9e-05
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 7e-04
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-14
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 4e-08
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 5e-05
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-07
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 8e-05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 8e-14
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 5e-13
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 6e-12
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 3e-10
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-09
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 3e-05
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-04
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-13
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-12
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 6e-08
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-13
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 5e-13
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-05
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 4e-12
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 7e-10
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 8e-10
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 7e-12
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 9e-09
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-04
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 8e-12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-09
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-11
3q49_B137 STIP1 homology and U box-containing protein 1; E3 7e-05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 4e-04
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-11
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-05
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 5e-11
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 5e-07
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 6e-11
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 9e-06
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 5e-04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 6e-11
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 3e-06
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 6e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-10
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 8e-08
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 4e-05
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 3e-04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 2e-09
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 4e-08
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 2e-08
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 3e-08
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 5e-08
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 9e-07
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 4e-05
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 7e-04
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 8e-04
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 6e-08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 1e-07
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 4e-04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-07
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 5e-07
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 3e-06
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 8e-07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 1e-05
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 1e-06
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 1e-04
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 1e-06
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 4e-05
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 3e-06
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 4e-06
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 2e-05
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 2e-05
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 6e-05
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 4e-06
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 6e-06
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 3e-04
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 7e-06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 8e-05
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 1e-04
2dip_A98 Zinc finger SWIM domain-containing protein 2; ZZ d 9e-06
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 1e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 1e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 2e-04
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 2e-05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 3e-05
2fc7_A82 ZZZ3 protein; structure genomics, ZZ domain, struc 2e-05
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 3e-04
2e5r_A63 Dystrobrevin alpha; ZZ domain, structural genomics 3e-04
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 4e-04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 6e-04
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 8e-04
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 8e-04
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 9e-04
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
 Score =  157 bits (400), Expect = 1e-42
 Identities = 50/207 (24%), Positives = 80/207 (38%), Gaps = 10/207 (4%)

Query: 127 GHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGNCLYVLGRYREAKEEYLLAL 186
           G M +    Y+   F+ A     +    +P +        +  +   R   +     LA+
Sbjct: 1   GPMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAI 60

Query: 187 EAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLGSALF 246
           +            L + Y NLG   +  G +  A E+YR +  L P        L +AL 
Sbjct: 61  KQNPL--------LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALV 112

Query: 247 GVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKPGHVDAL 306
             G+   AV+A   A+   PD      DL + L A+G  E A   + KAI+ +P    A 
Sbjct: 113 AAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAW 172

Query: 307 YNLGGLYMDLGAGETEEAKKALKEALK 333
            NLG ++     GE   A    ++A+ 
Sbjct: 173 SNLGCVFNAQ--GEIWLAIHHFEKAVT 197
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Length = 129 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 Length = 98 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 Length = 82 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Length = 104 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Length = 273 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query660
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.94
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.94
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.94
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.93
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.93
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.93
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.93
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.93
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.93
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.92
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.92
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.91
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.91
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.91
3u4t_A272 TPR repeat-containing protein; structural genomics 99.91
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.91
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.9
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.9
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.9
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.9
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.89
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.89
3u4t_A272 TPR repeat-containing protein; structural genomics 99.89
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.89
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.89
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.89
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.89
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.89
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.88
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.88
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.87
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.87
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.87
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.87
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.86
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.86
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.86
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.86
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.86
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.86
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.85
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.85
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.84
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.84
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.84
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.84
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.83
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.83
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.83
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.82
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.82
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.81
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.8
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.79
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.79
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.79
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.79
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.78
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.78
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.78
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.78
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.78
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.77
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.77
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.76
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.76
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.76
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.76
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.76
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.75
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.74
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.74
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.73
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.73
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.73
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.72
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.71
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.7
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.7
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.7
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.7
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.69
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.69
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.69
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.68
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.68
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.66
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.66
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.66
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.65
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.64
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.63
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.62
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.61
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.61
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.6
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.6
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.6
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.6
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.59
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.59
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.59
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.58
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.57
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.56
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.56
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.56
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.56
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.55
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.54
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.54
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.54
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.53
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.53
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.53
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.52
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.52
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.5
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.5
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.5
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.5
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.5
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.5
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.5
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.49
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.49
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.49
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.48
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.47
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.45
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.45
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.45
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.45
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.45
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.45
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.44
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.43
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.43
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.43
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.43
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.42
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.42
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.42
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.42
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.42
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.41
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.4
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.4
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.39
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.39
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.38
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.37
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.37
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.36
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.36
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.35
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.35
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.35
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.35
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.35
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.34
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.32
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.32
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.32
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.32
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.32
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.3
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.3
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.29
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.29
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.28
3k9i_A117 BH0479 protein; putative protein binding protein, 99.26
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.25
3k9i_A117 BH0479 protein; putative protein binding protein, 99.23
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.23
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.1
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.05
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.04
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.03
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.01
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.01
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.97
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.97
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.96
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.96
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.84
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.84
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.81
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.8
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.69
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.69
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.69
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.61
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.59
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.55
3q3e_A 631 HMW1C-like glycosyltransferase; N-glycosylation; 2 98.48
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.43
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.43
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.41
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.39
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.39
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.38
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.36
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.35
2e5r_A63 Dystrobrevin alpha; ZZ domain, structural genomics 98.34
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.29
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.28
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.22
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 98.22
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 98.1
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.85
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.66
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.6
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.38
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.16
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.07
2fc7_A82 ZZZ3 protein; structure genomics, ZZ domain, struc 96.93
2dip_A98 Zinc finger SWIM domain-containing protein 2; ZZ d 96.9
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.79
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.58
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.49
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.27
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.24
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.2
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.05
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.05
1tot_A52 CREB-binding protein; zinc binding, CBP, TAZ2, tra 95.69
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 95.44
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.39
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.04
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.03
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 94.85
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.79
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 94.76
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 94.08
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 93.95
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 93.89
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.89
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 93.66
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 93.3
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 92.52
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 91.7
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.04
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 90.72
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 90.66
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 90.1
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 90.03
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 89.98
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 88.74
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 88.31
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 87.45
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 87.38
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 87.3
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
Probab=100.00  E-value=3.5e-39  Score=367.24  Aligned_cols=352  Identities=16%  Similarity=0.157  Sum_probs=256.8

Q ss_pred             hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHhccCCCchhchHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCC
Q 006120          154 LQPTDVRPHFRAGNCLYVLGRYREAKEEYLLALEAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPT  233 (660)
Q Consensus       154 ~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~  233 (660)
                      ..|+++.++.++|.++..+|++++|+..|+++++++|+        .+.++.++|.++..+|++++|+.+|+++++++|+
T Consensus         4 s~P~~a~al~nLG~~~~~~G~~~eAi~~~~kAl~l~P~--------~~~a~~nLg~~l~~~g~~~eA~~~~~~Al~l~P~   75 (723)
T 4gyw_A            4 SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPE--------FAAAHSNLASVLQQQGKLQEALMHYKEAIRISPT   75 (723)
T ss_dssp             --CHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSC--------CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT
T ss_pred             CCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC--------CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC
Confidence            45788889999999999999999999999999999988        7888999999999999999999999999999999


Q ss_pred             cHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhCCChHHHHHHHHHHHHhCCCCHHHHHHHHHHH
Q 006120          234 HFRALKLLGSALFGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKPGHVDALYNLGGLY  313 (660)
Q Consensus       234 ~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~La~~~  313 (660)
                      ++.++.++|.++..+|++++|++.|+++++++|+++.+|.++|.+|..+|++++|+..|+++++++|+++.++.++|.++
T Consensus        76 ~~~a~~nLg~~l~~~g~~~~A~~~~~kAl~l~P~~~~a~~~Lg~~~~~~g~~~eAi~~~~~Al~l~P~~~~a~~~L~~~l  155 (723)
T 4gyw_A           76 FADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCL  155 (723)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSCCHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHhhhhhHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCHHHHHHHHHHHHcccCChhHHHHHHHHHHHHHHhccCCCCCCCCCCccccCcchHHhhchhhhhhhhHHHHhc
Q 006120          314 MDLGAGETEEAKKALKEALKMTNRVELHDAVSHLKQLQKKKSKGNRGTNGEGGFDIVEPSKFKTVGERTTVRQDLANALE  393 (660)
Q Consensus       314 ~~~~~g~~~eA~~~~~~al~l~p~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~al~  393 (660)
                      ..+  |++++|.+.+++++++.|+...              .......  .+..           .........+..++.
T Consensus       156 ~~~--g~~~~A~~~~~kal~l~~~~~~--------------~~~l~~~--~~~~-----------~l~~~~~~~~~~aia  206 (723)
T 4gyw_A          156 QIV--CDWTDYDERMKKLVSIVADQLE--------------KNRLPSV--HPHH-----------SMLYPLSHGFRKAIA  206 (723)
T ss_dssp             HHT--TCCTTHHHHHHHHHHHHHHHHH--------------TTCCCSS--CTTG-----------GGGSCCCHHHHHHHH
T ss_pred             Hhc--ccHHHHHHHHHHHHHhChhHHh--------------hccCccc--chhh-----------hhhhhcCHHHHHHHH
Confidence            988  9999999999999887654110              0000000  0000           000001111111110


Q ss_pred             CHHHHHHHHHhccCHHHHHHHhhCC-C-ccccccCCCCCCCCccCcchHHHHHhhhccCCCcchHHHHHHHHHHhhhhcc
Q 006120          394 IRAFQKITRLSRCDVELLKKEMSET-D-VPVSYSGGGGPQKSIRKPNLEEILRKFLHFLKPETFQGAVKAINERILSVLD  471 (660)
Q Consensus       394 ~~~~~~~~~~~~~~~~~~~~~l~~~-~-~~~~~~~~~~~~~~ir~~~~~~~~~~~iGY~S~df~~H~v~~l~~~~l~~hD  471 (660)
                          ......       ........ . ....+.....+.++||           |||||+||++|||++|+.++|++||
T Consensus       207 ----~r~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~klr-----------IGyvS~df~~H~v~~~~~~~~~~~d  264 (723)
T 4gyw_A          207 ----ERHGNL-------CLDKINVLHKPPYEHPKDLKLSDGRLR-----------VGYVSSDFGNHPTSHLMQSIPGMHN  264 (723)
T ss_dssp             ----HHHHHH-------HHHHHHTTTCCCCCCCCSSTTTTTCEE-----------EEEEESCSSSSHHHHHHTTHHHHSC
T ss_pred             ----HHHHHh-------hhhhhhcccCccccCccccccccccce-----------eeeechhhccCcHHHHHHHHHHHhc
Confidence                000000       11111111 1 1111222334567788           9999999999999999999999999


Q ss_pred             CCCcccccchhhhhhhcccCCCCHHHHHHhhhhhhcccccCCC-C----ccchhccHHHHHHHhHHHhccCCCchhhhhh
Q 006120          472 ETGSARVDLGMFYAILAPICSGSPEKRKRVAFDALLWRPVNEG-S----TQVRKVDAVRYIKLLRAVYIPSHGVSEMMEV  546 (660)
Q Consensus       472 r~g~~~fev~~y~~~~~~~~~~~~~~r~r~~~d~~~~~~~~~~-~----a~~i~~D~~~~l~dL~~~~~~~~~~~~~~~~  546 (660)
                      ++   +|||++|  ++++.+.+.++.|++..++  +|+++.+. +    +++|++|.||||+||..   .|.|.+.  ++
T Consensus       265 ~~---~fei~~y--~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~d~~~a~~i~~d~iDIlidl~g---~t~~~r~--~i  332 (723)
T 4gyw_A          265 PD---KFEVFCY--ALSPDDGTNFRVKVMAEAN--HFIDLSQIPCNGKAADRIHQDGIHILVNMNG---YTKGARN--EL  332 (723)
T ss_dssp             TT---TEEEEEE--ESSCCCSCHHHHHHHHHSS--EEEEGGGCCCHHHHHHHHHHTTCSEEEESCS---SBTTCCT--HH
T ss_pred             cC---ceeEEEE--EcCCCCccHHHHHHHHhhc--cccccccCCcHHHHHHHHHhccceeEEeccC---CCCCCcc--hh
Confidence            99   9999999  8898888889999999999  66666554 1    78899999999999974   3344442  22


Q ss_pred             hcc-CCCcccchhHHhhhccCCCCcchhhhh
Q 006120          547 HGE-ADSSMVSLSEFLVMFDDPDWGFGIMST  576 (660)
Q Consensus       547 ~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~  576 (660)
                      ..- ..+++|||-+|.-.---+...|.|-..
T Consensus       333 ~a~r~APvQv~~lG~p~TtG~~~iDY~i~D~  363 (723)
T 4gyw_A          333 FALRPAPIQAMWLGYPGTSGALFMDYIITDQ  363 (723)
T ss_dssp             HHTCCSSEEEECSSCSSCCCCTTCCEEEECT
T ss_pred             hhcCCCCceeeeccCCCCCCCCcCCEEEeCC
Confidence            222 445555555554433333334444333
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1tot_A CREB-binding protein; zinc binding, CBP, TAZ2, transferase; NMR {Mus musculus} SCOP: g.44.1.6 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 660
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-32
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-29
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-21
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-16
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-15
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-19
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-17
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-06
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 4e-17
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 4e-06
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 5e-06
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-14
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-13
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 8e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-06
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-12
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-11
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-10
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 0.002
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-11
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 2e-10
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 2e-04
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 3e-11
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-09
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-06
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 8e-06
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 4e-11
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 3e-10
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 4e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 6e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-06
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 5e-04
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-10
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-08
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-05
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 4e-04
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 4e-10
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 3e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-09
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-09
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-09
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 8e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-09
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 9e-05
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-04
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 1e-08
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 6e-08
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 0.002
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 3e-08
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 6e-07
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 3e-07
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 3e-07
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 6e-07
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-05
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 6e-04
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 2e-06
d2dipa185 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing p 2e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-04
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 3e-05
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 2e-04
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 6e-04
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 0.003
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  127 bits (320), Expect = 1e-32
 Identities = 56/192 (29%), Positives = 89/192 (46%), Gaps = 8/192 (4%)

Query: 126 DGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGNCLYVLGRYREAKEEYLLA 185
           D ++ +G VL E ++F  A+ ++ RA  L P     H       Y  G    A + Y  A
Sbjct: 204 DAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRA 263

Query: 186 LEAAETGGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLGSAL 245
           +E             P  Y NL  AL+ +G V  A + Y  +  LCPTH  +L  L +  
Sbjct: 264 IELQPH--------FPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIK 315

Query: 246 FGVGEYRAAVKALEEAIFIKPDYADAHCDLASALHAMGEDERAIEVFQKAIDLKPGHVDA 305
              G    AV+   +A+ + P++A AH +LAS L   G+ + A+  +++AI + P   DA
Sbjct: 316 REQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADA 375

Query: 306 LYNLGGLYMDLG 317
             N+G    ++ 
Sbjct: 376 YSNMGNTLKEMQ 387
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query660
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.95
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.94
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.92
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.9
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.88
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.86
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.85
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.75
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.74
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.72
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.7
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.66
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.66
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.59
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.59
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.58
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.55
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.55
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.54
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.53
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.49
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.43
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.43
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.43
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.41
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.39
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.38
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.38
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.37
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.36
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.36
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.35
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.34
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.34
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.3
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.26
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.24
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.2
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.05
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.01
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.01
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.99
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.95
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.79
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.78
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.78
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.72
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.99
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.92
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.8
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.72
d2dipa185 Zinc finger ZZ-type-containing protein 2 {Human (H 97.66
d2fc7a169 Zinc finger ZZ-type-containing protein 3, ZZZ3 {Hu 97.18
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.71
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.02
d1tota152 CREB-binding protein, CBP {Mouse (Mus musculus) [T 94.99
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 92.13
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 90.53
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 89.04
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 86.09
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 85.76
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 82.67
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=3.2e-26  Score=238.42  Aligned_cols=283  Identities=19%  Similarity=0.176  Sum_probs=251.7

Q ss_pred             hhhcCCcchhhccCchHHHHhccCchhhHHHHHHHHHHHHhhccCCcCCchHHhhhHHHHHHhCCchHHHHhHHHHHHHH
Q 006120           19 QKKQRTAAWAVSPNHGIVFDDTWKIVDDLEILVKRLKAKQAKDGKLKGDNSDAFSDAGWSRELGTSAEISEKRVFWEEST   98 (660)
Q Consensus        19 ~~~~~p~~~~~~~~lg~~y~~~~~~~~al~~~~~~~~~a~~~~~~l~~~~~~a~~~~~~~~~l~~~~~~~~~~~~l~~~~   98 (660)
                      ..+.+|....++..+|.+|.+.+++.+|+..+.++++        ..|....+                   +..++.++
T Consensus        25 ~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~--------~~p~~~~a-------------------~~~l~~~~   77 (388)
T d1w3ba_          25 LWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIK--------QNPLLAEA-------------------YSNLGNVY   77 (388)
T ss_dssp             HHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--------HCTTCHHH-------------------HHHHHHHH
T ss_pred             HHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH--------hCCCCHHH-------------------HHHHHHHh
Confidence            3456899999999999999999999999999999988        34544433                   34445556


Q ss_pred             HHHHHHHHHHHHHHHHHhhccCc---------------------------------------------------------
Q 006120           99 HDYAVFVKELGVLRNRADGARSR---------------------------------------------------------  121 (660)
Q Consensus        99 ~~~g~~~~Al~~l~~a~~~~~~~---------------------------------------------------------  121 (660)
                      ...|++++|+..+..+.+..+..                                                         
T Consensus        78 ~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  157 (388)
T d1w3ba_          78 KERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKAC  157 (388)
T ss_dssp             HHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHH
T ss_pred             hhhccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHH
Confidence            66666666666665554433211                                                         


Q ss_pred             --------HHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHhccCC
Q 006120          122 --------EEAFDGHMAIGRVLYEHQLFKEALVSFKRACELQPTDVRPHFRAGNCLYVLGRYREAKEEYLLALEAAETGG  193 (660)
Q Consensus       122 --------~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~  193 (660)
                              +....++..+|..+...|++++|...++++++.+|+++.++..+|.++...|++++|+..++++....|.  
T Consensus       158 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~--  235 (388)
T d1w3ba_         158 YLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPN--  235 (388)
T ss_dssp             HHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTT--
T ss_pred             HHHhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhh--
Confidence                    1123677888999999999999999999999999999999999999999999999999999999999988  


Q ss_pred             CchhchHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHH
Q 006120          194 NQWAYLLPQIYVNLGIALEGEGMVLSACEYYRESAILCPTHFRALKLLGSALFGVGEYRAAVKALEEAIFIKPDYADAHC  273 (660)
Q Consensus       194 ~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~  273 (660)
                            .+..+..+|.++...|++++|+..|+++++++|+++.++..+|.++...|++++|+..+++++...|.+...+.
T Consensus       236 ------~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~  309 (388)
T d1w3ba_         236 ------HAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLN  309 (388)
T ss_dssp             ------CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHH
T ss_pred             ------HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhh
Confidence                  77889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCChHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHcccCCh
Q 006120          274 DLASALHAMGEDERAIEVFQKAIDLKPGHVDALYNLGGLYMDLGAGETEEAKKALKEALKMTNRV  338 (660)
Q Consensus       274 ~la~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~La~~~~~~~~g~~~eA~~~~~~al~l~p~~  338 (660)
                      .+|.++...|++++|+..|+++++++|+++.++..+|.++..+  |++++|+.+|+++++++|+.
T Consensus       310 ~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~--g~~~~A~~~~~~al~l~P~~  372 (388)
T d1w3ba_         310 NLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQ--GKLQEALMHYKEAIRISPTF  372 (388)
T ss_dssp             HHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTT--TCCHHHHHHHHHHHTTCTTC
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHc--CCHHHHHHHHHHHHHhCCCC
Confidence            9999999999999999999999999999999999999999998  99999999999999999974
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure