Citrus Sinensis ID: 006191
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 657 | ||||||
| 255562966 | 710 | conserved hypothetical protein [Ricinus | 0.995 | 0.921 | 0.779 | 0.0 | |
| 224098930 | 714 | predicted protein [Populus trichocarpa] | 0.996 | 0.917 | 0.741 | 0.0 | |
| 225464071 | 715 | PREDICTED: uncharacterized membrane prot | 0.996 | 0.916 | 0.731 | 0.0 | |
| 224112181 | 712 | predicted protein [Populus trichocarpa] | 0.996 | 0.919 | 0.730 | 0.0 | |
| 356499845 | 698 | PREDICTED: uncharacterized membrane prot | 0.995 | 0.936 | 0.706 | 0.0 | |
| 359489011 | 717 | PREDICTED: uncharacterized membrane prot | 0.995 | 0.912 | 0.655 | 0.0 | |
| 449435324 | 712 | PREDICTED: uncharacterized membrane prot | 0.996 | 0.919 | 0.681 | 0.0 | |
| 449478649 | 712 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.996 | 0.919 | 0.680 | 0.0 | |
| 297841675 | 711 | hypothetical protein ARALYDRAFT_339179 [ | 0.996 | 0.921 | 0.636 | 0.0 | |
| 145337329 | 711 | Early-responsive to dehydration stress p | 0.996 | 0.921 | 0.627 | 0.0 |
| >gi|255562966|ref|XP_002522488.1| conserved hypothetical protein [Ricinus communis] gi|223538373|gb|EEF39980.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1061 bits (2743), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 515/661 (77%), Positives = 588/661 (88%), Gaps = 7/661 (1%)
Query: 1 MLVSALLTSVGINSGLCVLFFTLYSILRKQPSNYEVYVPRLLAKGSSNRRRRFNLEMLIP 60
MLVSALLTS+GINSGLCVLFF YSILRKQPSNYEVY PRLLA+G+S RR RFNLE LIP
Sbjct: 1 MLVSALLTSLGINSGLCVLFFVFYSILRKQPSNYEVYAPRLLAEGNSKRRSRFNLERLIP 60
Query: 61 SAGWVSRAWKHSEEDLLESSGLDAVVFMRVITFSLKVFLFAGIIGIFVILPVNAGGTEIY 120
S GW+S+AWK SEED+L SSGLDAVVFMR+ITFSLKVF FAGIIGIFV+LPVN GT++
Sbjct: 61 SPGWISKAWKLSEEDILLSSGLDAVVFMRLITFSLKVFSFAGIIGIFVLLPVNCLGTQLQ 120
Query: 121 EIDFADLPNNSLDVFTISNVNRGSHRLWVHFGAVYLVTIFVCYLLYSEYKYICVKRMDYF 180
+IDFADL +NSLDVFTISNVN GS LW+HF AVY+++IF+CYLLY+EYKYI KR+ YF
Sbjct: 121 KIDFADLSSNSLDVFTISNVNYGSKWLWMHFCAVYMISIFICYLLYNEYKYISSKRIAYF 180
Query: 181 YSSKPQPHQFTVLVRSIPVSAGSTIGDTVENFFKEFHPTTYLSHTVIHQTSNLCRLMDYA 240
YSSKPQPHQFT+LVR IPVS GS+I +TVE FF E+HPTTYLSH V+ ++SNL L+ A
Sbjct: 181 YSSKPQPHQFTILVRGIPVSVGSSISETVERFFTEYHPTTYLSHMVVRRSSNLRSLVTEA 240
Query: 241 KKLYGRLIHLQSDSNQEKNQQ-----RKVDLVDHYGKRLENIEENSRLERSEVSMARHEL 295
KKLY RL+HLQS+ + +K ++ VDLVDHY K+LE++E+N +LE+S++S E
Sbjct: 241 KKLYTRLLHLQSEPSHQKYRRIGLFGENVDLVDHYEKKLEDVEQNVKLEQSDLSFG-EET 299
Query: 296 QAAFVSFKSRYGAAIAFHMQQSTNPTDWLLEQAPEPNDVYWPFFSASFMRRWISKIVVVV 355
+AAFVSFKSRYGAA+AFH+QQS NPT W+ EQAPEP+DVYWPFFS+SFMRRWISK+VVVV
Sbjct: 300 RAAFVSFKSRYGAAVAFHLQQSVNPTQWVTEQAPEPDDVYWPFFSSSFMRRWISKLVVVV 359
Query: 356 ACILLTILFLIPVLVVQGLTNLNQLEIWFPFLKSILTIKFVSQVVTGYLPNLILLVFLKI 415
ACILLTILFLIPV+VVQGLTNL+QLEIWFPFLKSILTI FVSQV+TGYLP+LIL +FLKI
Sbjct: 360 ACILLTILFLIPVVVVQGLTNLSQLEIWFPFLKSILTITFVSQVITGYLPSLILQLFLKI 419
Query: 416 VPPVMEFLSSIQGYISHSDIQKSACNKVLWFMIWNIFFATVFSGSVLYQLNIVLDPKNIP 475
VPP+MEFLSSIQGYISHSDI+KSACNKVLWF IWNIFFATVFSGSVLYQ+NI LDPKNIP
Sbjct: 420 VPPIMEFLSSIQGYISHSDIEKSACNKVLWFTIWNIFFATVFSGSVLYQVNIFLDPKNIP 479
Query: 476 SRLGVAVPAQASFFIAYVVTSGWTGISSELFQIFPLICSLISKPFTKSKDDDFEVPAIHY 535
++L V+VPAQASFF+AYVVTSGWT SSELF+I PLICSL ++ K+ DD+ EVP+I Y
Sbjct: 480 AKLAVSVPAQASFFVAYVVTSGWTSTSSELFRIIPLICSLATR-CCKNPDDELEVPSIAY 538
Query: 536 HSELPRILLFGLLGITYFFLAPLILPFLLIYLCLAYIIYRNQFINVYEPKYETAGKFWPI 595
H ++PRIL FGLLGITYFFLAPLILPFLL+YLCLAYII+RNQF+NVY PKYETAGKFWPI
Sbjct: 539 HKDIPRILFFGLLGITYFFLAPLILPFLLVYLCLAYIIFRNQFMNVYAPKYETAGKFWPI 598
Query: 596 VHNSMIFSLVLMHAIAVGIFTIKKLSTASTLIFPLPVLTLLFNEYCRKRFLPNFIAYPAE 655
VHNSMIFSLVLMHAIA+GIFT+KKLSTASTLIFPLPVLTLLFNEYCRKRFLP FIAY AE
Sbjct: 599 VHNSMIFSLVLMHAIAIGIFTLKKLSTASTLIFPLPVLTLLFNEYCRKRFLPIFIAYSAE 658
Query: 656 V 656
V
Sbjct: 659 V 659
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224098930|ref|XP_002311322.1| predicted protein [Populus trichocarpa] gi|222851142|gb|EEE88689.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225464071|ref|XP_002269926.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224112181|ref|XP_002316110.1| predicted protein [Populus trichocarpa] gi|222865150|gb|EEF02281.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356499845|ref|XP_003518746.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359489011|ref|XP_002278752.2| PREDICTED: uncharacterized membrane protein YLR241W-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449435324|ref|XP_004135445.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449478649|ref|XP_004155380.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein YLR241W-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297841675|ref|XP_002888719.1| hypothetical protein ARALYDRAFT_339179 [Arabidopsis lyrata subsp. lyrata] gi|297334560|gb|EFH64978.1| hypothetical protein ARALYDRAFT_339179 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|145337329|ref|NP_177104.2| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis thaliana] gi|334183760|ref|NP_001185356.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis thaliana] gi|332196805|gb|AEE34926.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis thaliana] gi|332196806|gb|AEE34927.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 657 | ||||||
| TAIR|locus:2007126 | 711 | AT1G69450 [Arabidopsis thalian | 0.996 | 0.921 | 0.601 | 2.8e-215 | |
| TAIR|locus:2102117 | 703 | HYP1 "hypothetical protein 1" | 0.990 | 0.926 | 0.572 | 6.2e-204 | |
| TAIR|locus:2201876 | 762 | AT1G10090 "AT1G10090" [Arabido | 0.993 | 0.856 | 0.401 | 3.3e-134 | |
| TAIR|locus:2031735 | 806 | AT1G32090 "AT1G32090" [Arabido | 0.899 | 0.733 | 0.337 | 4.7e-103 | |
| TAIR|locus:2096991 | 712 | AT3G54510 [Arabidopsis thalian | 0.980 | 0.904 | 0.353 | 1.3e-102 | |
| TAIR|locus:2089850 | 756 | AT3G21620 "AT3G21620" [Arabido | 0.898 | 0.780 | 0.322 | 1.4e-101 | |
| TAIR|locus:2008860 | 771 | AT1G11960 "AT1G11960" [Arabido | 0.911 | 0.776 | 0.322 | 8.2e-99 | |
| TAIR|locus:2140210 | 785 | AT4G02900 [Arabidopsis thalian | 0.898 | 0.751 | 0.324 | 8.2e-99 | |
| TAIR|locus:504956093 | 1041 | RXW8 [Arabidopsis thaliana (ta | 0.748 | 0.472 | 0.401 | 4.5e-98 | |
| TAIR|locus:2120673 | 771 | AT4G22120 [Arabidopsis thalian | 0.933 | 0.795 | 0.329 | 6.6e-97 |
| TAIR|locus:2007126 AT1G69450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2080 (737.3 bits), Expect = 2.8e-215, P = 2.8e-215
Identities = 395/657 (60%), Positives = 500/657 (76%)
Query: 1 MLVSALLTSVGINSGLCVLFFTLYSILRKQPSNYEVYVPRLLAKGSSNRRRRFNLEMLIP 60
ML+SALL SVGINS LCVL F LYS+LRKQP NYEV++PR LA G+ RRR + IP
Sbjct: 1 MLLSALLMSVGINSCLCVLLFILYSVLRKQPRNYEVFLPRRLANGTYKRRRN-KVARYIP 59
Query: 61 SAGWVSRAWKHSEEDLLESSGLDAVVFMRVITFSLKVFLFAGIIGIFVILPVNAGGTEIY 120
S W+ ++W+ +E++L+ESSGLD VVFMR+ITFSLKVFLFAGIIG+FV+LPVN G ++
Sbjct: 60 SLKWIWKSWRPTEKELMESSGLDGVVFMRMITFSLKVFLFAGIIGVFVLLPVNCFGDQLT 119
Query: 121 EIDFADLPNNSLDVFTISNVNRGSHRLWVHFGAVYLVTIFVCYLLYSEYKYICVKRMDYF 180
ID+AD NSLD+F+++N+ S LWVHFGA+YLVT+FVC LLY E++YI +KR+++F
Sbjct: 120 VIDYADWSANSLDLFSVANLKVRSQWLWVHFGAIYLVTVFVCCLLYFEFRYIALKRIEHF 179
Query: 181 YSSKPQPHQFTVLVRSIPVSAGSTIGDTVENFFKEFHPTTYLSHTVIHQTSNLCRLMDYA 240
YSSKP+P QFT+LVR+IP S GS++ DTV+ FF E H +TY SH VIH+TS L ++D A
Sbjct: 180 YSSKPKPEQFTILVRNIPSSDGSSVSDTVDRFFGENHSSTYFSHVVIHRTSKLRSVVDKA 239
Query: 241 KKLYGRLIHLQS-DSNQEKNQQRKVDLVDHYGKRLENIEENSRLERSEVSMARHELQAAF 299
KKLY + H + + RK + HY L+ +E+N RL ++EVS E++AAF
Sbjct: 240 KKLYKEVKHKKPVKKTPMRFFSRKDNTEGHYESVLQEMEQNIRLGQAEVSAPGKEVRAAF 299
Query: 300 VSFKSRYGAAIAFHMQQSTNPTDWLLEQAPEPNDVYWPFFSASFMRRWISKIVVVVACIL 359
VSFKSRYGAA A HM QS NPT WL E APEP+DV+WPFFSASFM++W++KI+VV AC+L
Sbjct: 300 VSFKSRYGAATALHMPQSINPTYWLTEPAPEPHDVHWPFFSASFMQKWLAKILVVFACLL 359
Query: 360 LTILFLIPVLVVQGLTNLNQLEIWFPFLKSILTIKFVSQVVTGYLPNLILLVFLKIVPPV 419
LTILFL+PV++VQGLTNL LE FPFL IL++K VSQ++TGYLP+LIL LK+VPP
Sbjct: 360 LTILFLVPVVLVQGLTNLPALEFMFPFLSLILSMKVVSQIITGYLPSLILQTSLKVVPPT 419
Query: 420 MEFLSSIQGYISHSDIQKSACNKVLWFMIWNIFFATVFSGSVLYQLNIVLDPKNIPSRLG 479
MEFLSSIQG+I HSDIQKSACNKV+WF IWN+FFATVFSGS Y+L+++LDPK IP +L
Sbjct: 420 MEFLSSIQGHICHSDIQKSACNKVIWFTIWNVFFATVFSGSAFYKLSVILDPKQIPLKLA 479
Query: 480 VAVPAQASFFIAYVVTSGWTGISSELFQIFPLICSLISKPFTKSKDDDFEVPAIHYHSEL 539
VAVPAQASFFIAYVVT+GWT +ELF++ P + S I + F S +++F VP + YH +
Sbjct: 480 VAVPAQASFFIAYVVTTGWTDTLTELFRVVPFMVSYIKRSFEPSDENEFVVPPMRYHRDT 539
Query: 540 PRILLFGLLGITYFXXXXXXXXXXXXXXXXXXXXXRNQFINVYEPKYETAGKFWPIVHNS 599
PR+L FGLLGITYF RNQF+NVY PK++T G FWP++H +
Sbjct: 540 PRVLFFGLLGITYFFLAPLILPFILLYFILAYIIYRNQFMNVYAPKFDTGGMFWPMIHYT 599
Query: 600 MIFSLVLMHAIAVGIFTIKKLSTASTLIFPLPVLTLLFNEYCRKRFLPNFIAYPAEV 656
MIFSLVLM AIA+G+F +KK+ A+ L+ PLPV TLLFNE+CRKRF+P F YPAEV
Sbjct: 600 MIFSLVLMQAIAIGLFALKKMELATYLLVPLPVFTLLFNEFCRKRFMPIFTDYPAEV 656
|
|
| TAIR|locus:2102117 HYP1 "hypothetical protein 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201876 AT1G10090 "AT1G10090" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031735 AT1G32090 "AT1G32090" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2096991 AT3G54510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089850 AT3G21620 "AT3G21620" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008860 AT1G11960 "AT1G11960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140210 AT4G02900 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956093 RXW8 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120673 AT4G22120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 657 | |||
| pfam02714 | 325 | pfam02714, DUF221, Domain of unknown function DUF2 | 1e-102 | |
| COG5594 | 827 | COG5594, COG5594, Uncharacterized integral membran | 5e-70 | |
| pfam13967 | 151 | pfam13967, RSN1_TM, Late exocytosis, associated wi | 2e-42 |
| >gnl|CDD|190398 pfam02714, DUF221, Domain of unknown function DUF221 | Back alignment and domain information |
|---|
Score = 315 bits (809), Expect = e-102
Identities = 116/325 (35%), Positives = 177/325 (54%), Gaps = 7/325 (2%)
Query: 298 AFVSFKSRYGAAIAFHMQQSTNPTDWLLEQAPEPNDVYWPFFSASFMRRWISKIVVVVAC 357
AFV+FKS+ A +A Q NP W APEP D+ W S S RW+ +++V +
Sbjct: 1 AFVTFKSQAAAQMAAQALQHHNPLKWPTYLAPEPRDIIWENLSLSRWERWLRRLIVNLLL 60
Query: 358 ILLTILFLIPVLVVQGLTNLNQLEIWFPFLKSILTI-KFVSQVVTGYLPNLILLVFLKIV 416
LL I + IPV V L+NL L +PFLK IL + + +VTG LP L+L + + ++
Sbjct: 61 FLLIIFWAIPVAFVGLLSNLETLTKVWPFLKWILDLPPVLLGLVTGLLPTLLLSLLMALL 120
Query: 417 PPVMEFLSSIQGYISHSDIQKSACNKVLWFMIWNIFFATVFSGSVLYQLNIVLD-PKNIP 475
P ++ FLS +QG+ S SD++ S +K F++ N+F + + + ++D P +IP
Sbjct: 121 PIILRFLSKLQGHPSRSDVELSVQSKYFAFLVVNVFLVVTLASTASSLITEIIDNPTSIP 180
Query: 476 SRLGVAVPAQASFFIAYVVTSGWTGISSELFQIFPLICSLISKPFTKSKDDDFE-----V 530
+ L +P ++FFI+Y++ G +G + EL Q+ PLI I + F D
Sbjct: 181 TLLATNLPKASNFFISYILLQGLSGAAGELLQLGPLILYYIRRKFLDKTPRDKWERYTTP 240
Query: 531 PAIHYHSELPRILLFGLLGITYFFLAPLILPFLLIYLCLAYIIYRNQFINVYEPKYETAG 590
P+ Y + P LL +G+ Y +APLILPF L+Y L Y +Y+ Q + VY KYE+ G
Sbjct: 241 PSFDYGTVYPVFLLIFTIGLIYSVIAPLILPFGLVYFGLGYFVYKYQLLYVYVTKYESGG 300
Query: 591 KFWPIVHNSMIFSLVLMHAIAVGIF 615
FWP N ++ L L +G+F
Sbjct: 301 LFWPRALNRLLVGLYLFQLCLIGLF 325
|
This family consists of hypothetical transmembrane proteins none of which have any function, the aligned region is at 538 residues at maximum length. Length = 325 |
| >gnl|CDD|227881 COG5594, COG5594, Uncharacterized integral membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|222479 pfam13967, RSN1_TM, Late exocytosis, associated with Golgi transport | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 657 | |||
| COG5594 | 827 | Uncharacterized integral membrane protein [Functio | 100.0 | |
| KOG1134 | 728 | consensus Uncharacterized conserved protein [Gener | 100.0 | |
| PF02714 | 325 | DUF221: Domain of unknown function DUF221; InterPr | 100.0 | |
| PF13967 | 157 | RSN1_TM: Late exocytosis, associated with Golgi tr | 100.0 | |
| PF04547 | 452 | Anoctamin: Calcium-activated chloride channel; Int | 99.06 | |
| PF14703 | 85 | DUF4463: Domain of unknown function (DUF4463) | 97.98 | |
| KOG2513 | 647 | consensus Protein required for meiotic chromosome | 97.92 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 96.52 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 96.06 | |
| PLN03120 | 260 | nucleic acid binding protein; Provisional | 95.85 | |
| PLN03121 | 243 | nucleic acid binding protein; Provisional | 95.71 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 95.53 | |
| KOG0149 | 247 | consensus Predicted RNA-binding protein SEB4 (RRM | 95.38 | |
| KOG0144 | 510 | consensus RNA-binding protein CUGBP1/BRUNO (RRM su | 95.36 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 95.35 | |
| PF14259 | 70 | RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or | 95.22 | |
| PF00076 | 70 | RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or | 95.19 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 94.91 | |
| KOG0122 | 270 | consensus Translation initiation factor 3, subunit | 94.25 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 93.97 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 93.82 | |
| KOG0145 | 360 | consensus RNA-binding protein ELAV/HU (RRM superfa | 92.71 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 92.55 | |
| PF04059 | 97 | RRM_2: RNA recognition motif 2; InterPro: IPR00720 | 92.45 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 92.4 | |
| KOG0125 | 376 | consensus Ataxin 2-binding protein (RRM superfamil | 92.39 | |
| smart00362 | 72 | RRM_2 RNA recognition motif. | 92.11 | |
| KOG4211 | 510 | consensus Splicing factor hnRNP-F and related RNA- | 91.57 | |
| KOG4206 | 221 | consensus Spliceosomal protein snRNP-U1A/U2B [RNA | 91.2 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 89.94 | |
| cd00590 | 74 | RRM RRM (RNA recognition motif), also known as RBD | 89.27 | |
| KOG2514 | 861 | consensus Uncharacterized conserved protein [Funct | 89.21 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 88.64 | |
| KOG0127 | 678 | consensus Nucleolar protein fibrillarin NOP77 (RRM | 88.36 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 86.88 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 86.02 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 85.91 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 84.55 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 84.48 | |
| KOG0117 | 506 | consensus Heterogeneous nuclear ribonucleoprotein | 83.42 | |
| PF13893 | 56 | RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or | 82.57 | |
| PF07810 | 111 | TMC: TMC domain; InterPro: IPR012496 These sequenc | 80.4 |
| >COG5594 Uncharacterized integral membrane protein [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.9e-116 Score=950.66 Aligned_cols=640 Identities=28% Similarity=0.464 Sum_probs=585.1
Q ss_pred cHhHHHHHHHHHHHHHHHHHHHHHHHcCCCCCceeeccccccCCCC-CccccCccccccCcccchhHhhcCCHHHHHHhc
Q 006191 2 LVSALLTSVGINSGLCVLFFTLYSILRKQPSNYEVYVPRLLAKGSS-NRRRRFNLEMLIPSAGWVSRAWKHSEEDLLESS 80 (657)
Q Consensus 2 ~~~~~~~~l~~~~~~~~~~~~~F~~lR~~~~~~~iY~pr~~~~~~~-~~~~~~~~~~~~~~~~Wi~~~~~~~d~~i~~~~ 80 (657)
+.+++.|++.+++.++++++++|++||+| .+++|+||+..++.+ ++|. +.+.|+|||+.++++++|+.+++++
T Consensus 20 s~~~~~t~l~f~~~~~~~~l~~f~iLR~r--~k~lY~pr~~~~~~~~~~P~----~~~ss~~gWl~~L~~i~d~~~l~~a 93 (827)
T COG5594 20 STSAVITQLVFAGLIFLVFLILFLILRKR--WKRLYAPRTNFDGQNECLPE----PNPSSYWGWLEPLVKIPDEFLLQYA 93 (827)
T ss_pred chhhhHHHHHHHHHHHHHHHHHHHHHHHH--HhHhcCcceeecCCCcccCC----CCccchHHHHHHHHhCCHHHHHHHc
Confidence 47899999999999999999999999976 799999999988765 2222 2478999999999999999999999
Q ss_pred CCcHHHHHHHHHHHHHHHHHHHHHHHhhhheeeecCCCccccccCCCCCCCCccccccccCCCCchHHHHHHHHHHHHHH
Q 006191 81 GLDAVVFMRVITFSLKVFLFAGIIGIFVILPVNAGGTEIYEIDFADLPNNSLDVFTISNVNRGSHRLWVHFGAVYLVTIF 160 (657)
Q Consensus 81 GlDa~~flrflk~~~~~f~~~~~~~~~iLlPvn~~~~~~~~~~~~~~~~~~l~~~Ti~Ni~~~s~~lw~h~i~~~~~~~~ 160 (657)
|+|||+||||+|||++++++.|+++++||+|||++.++..+ +.....++++++|++|+++ ++++|+|++.+|++.++
T Consensus 94 GlD~y~fLrflkm~~~~~~i~sl~~ipIL~Pvn~~~~~~~~--gn~~s~s~l~~Ls~~Nv~~-~n~~~aHvf~~~~f~~~ 170 (827)
T COG5594 94 GLDGYFFLRFLKMLIKLLFILSLILIPILLPVNYHFQKATN--GNSDSESGLDKLSISNVSP-SNRLYAHVFLSWFFFGY 170 (827)
T ss_pred CcchhhHHHHHHHHHHHHHHHHHHHhHEeeeeeeccccccc--CCccchhhhhHhhhhcccC-CCceeeeeehhHHHHHH
Confidence 99999999999999999999999999999999987754432 1112468999999999986 78999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHcCCCC---------CCcceEEEEeccCCCCCCchHHHHHHHhhhhCCCcceeeEEEcccc
Q 006191 161 VCYLLYSEYKYICVKRMDYFYSSKP---------QPHQFTVLVRSIPVSAGSTIGDTVENFFKEFHPTTYLSHTVIHQTS 231 (657)
Q Consensus 161 ~~~~l~~e~~~~~~~R~~~l~~~~~---------~~~~~TVlV~~IP~~~~~~~~~~l~~~F~~~~p~~v~~v~~~~~~~ 231 (657)
++|.+++|++.+..+||++++++.+ +.++|||+++++|.+..+ .+++.++|++...+++.+..+|+|.+
T Consensus 171 vlfii~~el~~y~~lr~a~~~~p~y~qs~~~~~~~~ssRTvlis~LP~~~~~--~e~L~~~~~kl~~~~i~~~~l~~~~~ 248 (827)
T COG5594 171 VLFIIFRELRFYVVLRQAYLRSPLYQQSLLTLQNNLSSRTVLISGLPSELRS--DEELKELFDKLKVGEIDSDVLCRDLG 248 (827)
T ss_pred HHHHHHHHHHHHHHHHHHHHccHHHHHHHHhhccCCCCceEEeecCChhhcC--chhHHHHHhhcCeeeeccchhhhhhH
Confidence 9999999999999999999999852 348999999999985443 24589999999888888889999999
Q ss_pred hHHHHHHHHHHHHHHHhhh---------c-------cC--------------------CCCCC--C--------CCccCC
Q 006191 232 NLCRLMDYAKKLYGRLIHL---------Q-------SD--------------------SNQEK--N--------QQRKVD 265 (657)
Q Consensus 232 ~l~~l~~~~~~~~~~le~~---------~-------~~--------------------~~~rP--k--------~g~kvd 265 (657)
.++++.++|++..+|+|.. + ++ ..+|| | .|||||
T Consensus 249 ~l~~l~k~R~ki~~klE~~~~~~~~~~~K~~~~~~~K~~~~L~~~~~k~~~~~~~y~~~~~Rp~~~i~k~~~~i~gKkVd 328 (827)
T COG5594 249 TLQELYKERDKILKKLEKALNELLNKLLKKSHLKTNKKSGKLTPSRKKEFEILPEYVPDKKRPKHRIKKLNKGIFGKKVD 328 (827)
T ss_pred HHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhhHhhccCCCCCCCcccccchhhhhhccccccchhhhhhhhhhhccceec
Confidence 9999999999998888721 0 00 02377 1 589999
Q ss_pred hHHHHHHHHHHHHHHHHHHHhhhhhcCCCCcEEEEEecCHHHHHHHHHhcccCCCCCce-eccCCCCCCcccCCCCCchH
Q 006191 266 LVDHYGKRLENIEENSRLERSEVSMARHELQAAFVSFKSRYGAAIAFHMQQSTNPTDWL-LEQAPEPNDVYWPFFSASFM 344 (657)
Q Consensus 266 ~i~~~~~~l~~l~~~I~~~~~~~~~~~~~~~~AFVtF~s~~~a~~~~q~~~~~~~~~~~-v~~AP~P~DIiW~NL~~~~~ 344 (657)
+|||+++|+.+++++|++.|+..++.. .+++|||||+|+..||+|+|.+..+++.... ++.||+|+||+|+|+..+++
T Consensus 329 aI~y~s~~l~~l~~~i~~~r~~~~~~t-~~~~~FItFkSq~~Aq~~aQ~~~~sr~~~~~~v~iapaPnDi~W~Nl~ls~~ 407 (827)
T COG5594 329 AIDYYSAKLTKLDAEIENARKSLYENT-PTKSGFITFKSQASAQIAAQSQIYSRVLGKLKVEIAPAPNDIIWDNLRLSRK 407 (827)
T ss_pred HHHHHHHHHHHHHHHHHHHHhCccccC-ccccEEEEEehhHHHHHHHHhhhhhhhhcceeeeecCCccccccccchHHHH
Confidence 999999999999999999999876643 3779999999999999999999888886655 99999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcchhhhHhHhhhhhhhhh-hhhHHHHHHhhHHHHHHHHHHHHHHHHHHHH
Q 006191 345 RRWISKIVVVVACILLTILFLIPVLVVQGLTNLNQLEIWFPFLKSILT-IKFVSQVVTGYLPNLILLVFLKIVPPVMEFL 423 (657)
Q Consensus 345 ~r~~R~~~~~~~~~~l~~~~~iPv~~i~~l~~~~~l~~~~~~l~~~~~-~~~~~~~i~~~lpslil~i~n~llp~i~~~l 423 (657)
+|..|++.++++.++++++|++|||+++.++|++++.+.+||++.+.+ .|+++++++|+||++++.+++.++|++++++
T Consensus 408 ~r~~k~~~~ni~~il~II~w~~pVa~v~~i~Nl~~l~~~~p~l~~il~~~~~l~~iltglLptv~~~~l~~ivP~fir~L 487 (827)
T COG5594 408 ERLFKRISANILFILLIILWAFPVAFVGTISNLNTLSSLWPFLKFILKDPPFLAGILTGLLPTVALSLLMSIVPYFIRWL 487 (827)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcchhHhhhhHHHHHHHhccHHHHHHHHhhhhHHHHHHHHHHhHHHHHHH
Confidence 999999999999999999999999999999999999999999999955 5699999999999999999999999999999
Q ss_pred HHhcCCcchhHHHHHhhhhhHHHHHHHHHHHHhchhhHHHHHHHhc-CCCChHHHHhhhCCcchHHHHHHHHHHhhhhhh
Q 006191 424 SSIQGYISHSDIQKSACNKVLWFMIWNIFFATVFSGSVLYQLNIVL-DPKNIPSRLGVAVPAQASFFIAYVVTSGWTGIS 502 (657)
Q Consensus 424 s~~eg~~t~S~~~~s~~~k~f~f~~~n~~lv~~l~~~~~~~~~~~~-~~~~i~~~l~~~lp~~s~ffi~yii~~~~~~~~ 502 (657)
+.+||..|+|+.|..++.|+|.|+++|.|+|.++++++.+.+.+.. +|.+++.++++++|++|+||++|+++||+++++
T Consensus 488 s~~qG~~S~se~E~~~~~k~~~f~fv~~FlV~Tl~s~fss~v~~~~ke~~s~~~llA~~lpk~SnFfi~~iilqgl~~~~ 567 (827)
T COG5594 488 SYMQGLVSYSEEEIYVQNKYFAFLFVNLFLVVTLASSFSSIVWSLLKEPTSIMTLLANNLPKASNFFISYIILQGLSGFP 567 (827)
T ss_pred HHhcCccchHHHHHHHHhhhhhheeeeehheeeehhHHHHHHHHHhcChHhHHHHHHhccHHHHHHHHHHHHHhcccccc
Confidence 9999999999999999999999999999999999988776666666 899999999999999999999999999999999
Q ss_pred HHhHhhHHHHHHHhhcccCCCCCCC-----CCCCCcCcccchhhHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHH
Q 006191 503 SELFQIFPLICSLISKPFTKSKDDD-----FEVPAIHYHSELPRILLFGLLGITYFFLAPLILPFLLIYLCLAYIIYRNQ 577 (657)
Q Consensus 503 ~~ll~~~~l~~~~~~~~~~~~T~r~-----~~~~~f~~~~~y~~~l~~~~i~l~Ys~i~Pli~~~~~~~f~~~y~v~Ky~ 577 (657)
++|+|+++|+.+.+..++.++|||+ ..++.|+||..||+.+.+++|+++||+++|+|+.||+++|++.|+++||+
T Consensus 568 ~~LLqi~~Ll~~~vl~kf~~~TpR~k~nr~~~~~~f~~G~v~P~~~~l~~I~icYSiisPlILlf~~v~F~~~ylaykY~ 647 (827)
T COG5594 568 GTLLQIVPLLLSLVLGKFKDSTPRQKWNRLETPPSFQFGTVLPQPILLFTITICYSIISPLILLFGAVYFILNYLAYKYN 647 (827)
T ss_pred hHHHHHHHHHHHHhhhhhcCCChHHHHhhccCCCccccccccchhHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999988888999996 57899999999999999999999999999999999999999999999999
Q ss_pred hceeecCCCCCccccHHHHHHHHHHHHHHHHHHHHHHHHhccccccceehhhHHHHHHHHHHHHhcccccccccCC
Q 006191 578 FINVYEPKYETAGKFWPIVHNSMIFSLVLMHAIAVGIFTIKKLSTASTLIFPLPVLTLLFNEYCRKRFLPNFIAYP 653 (657)
Q Consensus 578 llyvy~~~~es~G~~~~~~~~~~~~~l~~~q~~~~g~~~~~~~~~~~~~~~~l~~~t~~f~~~~~~~f~~~~~~~p 653 (657)
++|+++.++||||++||+|++|+++|+++||+||+|+|++.++|+.+++++|++.+|++||++|+++|.|+..++-
T Consensus 648 l~Yv~~~~~es~G~~w~~al~qiivGl~l~qv~l~glf~~~k~~~ls~~~~p~~~~Tvi~~~~~~~~f~pl~~~ik 723 (827)
T COG5594 648 LIYVSNHSPESGGGYWPRALFQIIVGLYLFQVCLLGLFSLAKGWGLSVLLFPLIVFTVIFHYYFKKMFDPLSKYIK 723 (827)
T ss_pred hhhccCCCcccCCCccHHHHHHHHHHHHHHHHHHHHHHHhcCcceeEeehHHHHHHHHHHHHHHHHhhccccccee
Confidence 9999999999999999999999999999999999999999999999999999999999999999999998865554
|
|
| >KOG1134 consensus Uncharacterized conserved protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF02714 DUF221: Domain of unknown function DUF221; InterPro: IPR003864 This domain is found in a family of hypothetical transmembrane proteins none of which have any known function, the aligned region is at 538 residues at maximum length | Back alignment and domain information |
|---|
| >PF13967 RSN1_TM: Late exocytosis, associated with Golgi transport | Back alignment and domain information |
|---|
| >PF04547 Anoctamin: Calcium-activated chloride channel; InterPro: IPR007632 This family contains the anoctamin/TMEM16 proteins which are thought to be calcium-dependent chloride channel [] | Back alignment and domain information |
|---|
| >PF14703 DUF4463: Domain of unknown function (DUF4463) | Back alignment and domain information |
|---|
| >KOG2513 consensus Protein required for meiotic chromosome segregation [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >PLN03120 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN03121 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >PF14259 RRM_6: RNA recognition motif (a | Back alignment and domain information |
|---|
| >PF00076 RRM_1: RNA recognition motif | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00362 RRM_2 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability | Back alignment and domain information |
|---|
| >KOG2514 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13893 RRM_5: RNA recognition motif | Back alignment and domain information |
|---|
| >PF07810 TMC: TMC domain; InterPro: IPR012496 These sequences are similar to a region conserved amongst various protein products of the transmembrane channel-like (TMC) gene family, such as Transmembrane channel-like protein 3 (Q7TN63 from SWISSPROT) and EVIN2 (Q8IU68 from SWISSPROT) - this region is termed the TMC domain [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 657 | |||
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 97.4 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 97.33 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 97.26 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 97.21 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 97.2 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 97.19 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 97.17 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 97.15 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 97.1 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 97.08 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 97.06 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 97.05 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 97.04 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 97.04 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 97.03 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 97.02 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 97.02 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 96.99 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 96.99 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 96.99 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 96.99 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 96.97 | |
| 2diu_A | 96 | KIAA0430 protein; structural genomics, RRM domain, | 96.97 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 96.96 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 96.95 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 96.92 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 96.91 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 96.9 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 96.87 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 96.86 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 96.85 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 96.84 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 96.83 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 96.83 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 96.83 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 96.81 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 96.8 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 96.8 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 96.8 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 96.8 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 96.76 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 96.75 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 96.74 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 96.73 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 96.72 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 96.71 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 96.69 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 96.69 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 96.68 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 96.68 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 96.68 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 96.68 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 96.67 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 96.65 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 96.63 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 96.62 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 96.62 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 96.61 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 96.61 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 96.6 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 96.6 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 96.58 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 96.58 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 96.58 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 96.58 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 96.57 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 96.56 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 96.55 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 96.53 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 96.51 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 96.5 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 96.49 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 96.48 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 96.48 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 96.47 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 96.46 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 96.45 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 96.45 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 96.44 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 96.43 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 96.43 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 96.43 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 96.41 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 96.41 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 96.41 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 96.37 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 96.36 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 96.36 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 96.34 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 96.34 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 96.34 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 96.33 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 96.32 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 96.31 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 96.28 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 96.28 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 96.27 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 96.26 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 96.25 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 96.24 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 96.23 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 96.21 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 96.21 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 96.21 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 96.2 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 96.18 | |
| 2dnl_A | 114 | Cytoplasmic polyadenylation element binding protei | 96.16 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 96.15 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 96.15 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 96.13 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 96.13 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 96.11 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 96.11 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 96.08 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 96.08 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 96.07 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 96.07 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 96.07 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 96.07 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 96.06 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 96.06 | |
| 2pe8_A | 105 | Splicing factor 45; RRM, protein binding; 2.00A {H | 96.04 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 96.04 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 96.02 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 96.02 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 96.01 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 96.0 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 95.97 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 95.97 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 95.95 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 95.94 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 95.91 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 95.91 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 95.88 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 95.87 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 95.86 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 95.86 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 95.85 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 95.83 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 95.82 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 95.81 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 95.78 | |
| 2m2b_A | 131 | RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio | 95.75 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 95.69 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 95.65 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 95.59 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 95.58 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 95.52 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 95.49 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 95.47 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 95.47 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 95.47 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 95.43 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 95.43 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 95.4 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 95.39 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 95.35 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 95.31 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 95.31 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 95.24 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 95.07 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 95.06 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 94.93 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 94.91 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 94.91 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 94.86 | |
| 3ue2_A | 118 | Poly(U)-binding-splicing factor PUF60; RNA recogni | 94.8 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 94.77 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 94.64 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 94.32 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 93.22 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 94.16 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 94.14 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 94.04 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 94.01 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 93.86 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 93.83 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 93.55 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 93.42 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 93.23 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 92.99 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 92.91 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 92.84 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 92.8 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 92.66 | |
| 2dit_A | 112 | HIV TAT specific factor 1 variant; structural geno | 92.53 | |
| 1jmt_A | 104 | Splicing factor U2AF 35 kDa subunit; RRM, RNA spli | 92.29 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 92.0 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 91.81 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 91.8 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 91.75 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 91.68 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 91.6 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 91.16 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 90.22 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 90.16 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 89.51 | |
| 3s6e_A | 114 | RNA-binding protein 39; ferredoxin-like, structura | 88.62 | |
| 2dhx_A | 104 | Poly (ADP-ribose) polymerase family, member 10 var | 87.06 | |
| 3v4m_A | 105 | Splicing factor U2AF 65 kDa subunit; canonical RNA | 87.02 | |
| 2d9o_A | 100 | DNAJ (HSP40) homolog, subfamily C, member 17; RRM | 86.82 |
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=97.40 E-value=0.00095 Score=55.43 Aligned_cols=83 Identities=13% Similarity=0.133 Sum_probs=60.7
Q ss_pred CcceEEEEeccCCCCCCchHHHHHHHhhhhCCCcceeeEEEcccchHHHHHHHHHHHHHHHhhhccCCCCCCCCCccCCh
Q 006191 187 PHQFTVLVRSIPVSAGSTIGDTVENFFKEFHPTTYLSHTVIHQTSNLCRLMDYAKKLYGRLIHLQSDSNQEKNQQRKVDL 266 (657)
Q Consensus 187 ~~~~TVlV~~IP~~~~~~~~~~l~~~F~~~~p~~v~~v~~~~~~~~l~~l~~~~~~~~~~le~~~~~~~~rPk~g~kvd~ 266 (657)
+..+||.|.|||.+.+ .++|+++|+++ |.|.++.+.+|.
T Consensus 3 ~~~~~l~v~nlp~~~t---~~~l~~~f~~~--G~v~~v~i~~~~------------------------------------ 41 (95)
T 2dnz_A 3 SGSSGLYVGSLHFNIT---EDMLRGIFEPF--GKIDNIVLMKDS------------------------------------ 41 (95)
T ss_dssp SCCCEEEEESCCTTCC---HHHHHHHHTTT--SCEEEEEEECCS------------------------------------
T ss_pred CCCcEEEEeCCCCCCC---HHHHHHHHHhc--CCEeEEEEeecC------------------------------------
Confidence 4568999999999766 47899999987 567777765531
Q ss_pred HHHHHHHHHHHHHHHHHHHhhhhhcCCCCcEEEEEecCHHHHHHHHHhcccC--CCCCceeccCCCCCC
Q 006191 267 VDHYGKRLENIEENSRLERSEVSMARHELQAAFVSFKSRYGAAIAFHMQQST--NPTDWLLEQAPEPND 333 (657)
Q Consensus 267 i~~~~~~l~~l~~~I~~~~~~~~~~~~~~~~AFVtF~s~~~a~~~~q~~~~~--~~~~~~v~~AP~P~D 333 (657)
...+..+.|||+|++.++|..|.+.++.. +...++|+.|.++.+
T Consensus 42 -----------------------~~~~~~g~afV~f~~~~~a~~A~~~l~g~~~~g~~l~V~~a~~~~~ 87 (95)
T 2dnz_A 42 -----------------------DTGRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERLD 87 (95)
T ss_dssp -----------------------SSCCCCSEEEEEESCHHHHHHHHHHHTTCCSSSSCCEEEESSCCCC
T ss_pred -----------------------CCCceeeEEEEEECCHHHHHHHHHHhCCCeeCCcEEEEEEcccccC
Confidence 00123689999999999999999876554 345677777665443
|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A | Back alignment and structure |
|---|
| >2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A | Back alignment and structure |
|---|
| >2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 657 | |||
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 97.59 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 97.55 | |
| d1b7fa2 | 85 | Sex-lethal protein {Drosophila melanogaster [TaxId | 97.5 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 97.49 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 97.47 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 97.41 | |
| d1l3ka1 | 84 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 97.41 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 97.38 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 97.35 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 97.33 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 97.31 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 97.31 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 97.31 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 97.29 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 97.28 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 97.28 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 97.26 | |
| d1hd0a_ | 75 | Heterogeneous nuclear ribonucleoprotein d0 {Human | 97.21 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 97.21 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 97.2 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 97.16 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 97.16 | |
| d1x4ha1 | 98 | RNA-binding protein 28 {Mouse (Mus musculus) [TaxI | 97.15 | |
| d1uawa_ | 77 | Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | 97.15 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 97.12 | |
| d2cqda1 | 103 | RNA-binding region containing protein 1 {Human (Ho | 97.12 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 97.1 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 97.1 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 97.0 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 97.0 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 96.99 | |
| d2cqca1 | 83 | Arginine/serine-rich splicing factor 10 {Human (Ho | 96.96 | |
| d1zh5a2 | 85 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 96.93 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 96.9 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 96.89 | |
| d1x0fa1 | 75 | Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s | 96.88 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 96.87 | |
| d2msta_ | 75 | Neural RNA-binding protein Musashi-1 {Mouse (Mus m | 96.85 | |
| d1x4fa1 | 99 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 96.84 | |
| d2ghpa2 | 75 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 96.83 | |
| d1x4ba1 | 103 | Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu | 96.81 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 96.78 | |
| d1wf0a_ | 88 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 96.76 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 96.75 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 96.74 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 96.72 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 96.68 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 96.65 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 96.64 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 96.62 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 96.6 | |
| d1wi8a_ | 104 | Eukaryotic translation initiation factor 4B {Human | 96.6 | |
| d1l3ka2 | 79 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 96.59 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 96.52 | |
| d2cq1a1 | 88 | Polypyrimidine tract-binding protein 2, PTBP2 {Hum | 96.52 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 96.51 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 96.5 | |
| d1whya_ | 97 | Putative RNA-binding protein 15B, Rbm15b {Mouse (M | 96.45 | |
| d1x5oa1 | 101 | RNA-binding motif, single-stranded-interacting pro | 96.44 | |
| d2cq4a1 | 101 | RNA binding protein 23 {Human (Homo sapiens) [TaxI | 96.43 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 96.43 | |
| d1x4ea1 | 72 | RNA-binding motif, single-stranded-interacting pro | 96.41 | |
| d1weza_ | 102 | Heterogeneous nuclear ribonucleoprotein H' {Human | 96.36 | |
| d1wg5a_ | 104 | Heterogeneous nuclear ribonucleoprotein H' {Human | 96.29 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 96.2 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 96.14 | |
| d1wexa_ | 104 | Heterogeneous nuclear ribonucleoprotein L-like {Mo | 96.12 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 96.11 | |
| d2disa1 | 96 | Hypothetical protein FLJ20273 {Human (Homo sapiens | 96.09 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 95.76 | |
| d2cpya1 | 103 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 95.65 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 95.59 | |
| d1x4da1 | 89 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 95.58 | |
| d2adba1 | 108 | Polypyrimidine tract-binding protein {Human (Homo | 95.32 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 95.22 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 94.99 | |
| d1wela1 | 112 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 94.78 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 94.57 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 94.27 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 92.4 | |
| d1u2fa_ | 90 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 92.31 | |
| d2cq2a1 | 101 | Alkylation repair AlkB homolog 8, ALKBH8 {Human (H | 91.41 | |
| d1wwha1 | 81 | Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 | 90.01 | |
| d2dita1 | 99 | HIV Tat-specific factor 1 {Human (Homo sapiens) [T | 89.55 | |
| d1owxa_ | 113 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 88.87 | |
| d1o0pa_ | 104 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 85.02 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | U2 | 83.2 |
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: Sex-lethal protein species: Drosophila melanogaster [TaxId: 7227]
Probab=97.59 E-value=6.2e-05 Score=59.24 Aligned_cols=78 Identities=13% Similarity=0.182 Sum_probs=57.4
Q ss_pred cceEEEEeccCCCCCCchHHHHHHHhhhhCCCcceeeEEEcccchHHHHHHHHHHHHHHHhhhccCCCCCCCCCccCChH
Q 006191 188 HQFTVLVRSIPVSAGSTIGDTVENFFKEFHPTTYLSHTVIHQTSNLCRLMDYAKKLYGRLIHLQSDSNQEKNQQRKVDLV 267 (657)
Q Consensus 188 ~~~TVlV~~IP~~~~~~~~~~l~~~F~~~~p~~v~~v~~~~~~~~l~~l~~~~~~~~~~le~~~~~~~~rPk~g~kvd~i 267 (657)
++.||.|.|||.+.++ ++|+++|+++ |.|.++.+++|.
T Consensus 1 s~t~l~V~nLp~~~t~---~~l~~~F~~~--G~v~~~~i~~~~------------------------------------- 38 (82)
T d1b7fa1 1 SNTNLIVNYLPQDMTD---RELYALFRAI--GPINTCRIMRDY------------------------------------- 38 (82)
T ss_dssp CCSEEEEECCCTTCCH---HHHHHHHHTT--SCEEEEECCEET-------------------------------------
T ss_pred CCCEEEEeCCCCCCCH---HHHHHHHHHh--CCcceeeeeeec-------------------------------------
Confidence 4568999999997764 7899999988 567776664431
Q ss_pred HHHHHHHHHHHHHHHHHHhhhhhcCCCCcEEEEEecCHHHHHHHHHhcccCC--CCCceeccCC
Q 006191 268 DHYGKRLENIEENSRLERSEVSMARHELQAAFVSFKSRYGAAIAFHMQQSTN--PTDWLLEQAP 329 (657)
Q Consensus 268 ~~~~~~l~~l~~~I~~~~~~~~~~~~~~~~AFVtF~s~~~a~~~~q~~~~~~--~~~~~v~~AP 329 (657)
...++.|.|||+|.+.++|+.|.+.++... ...++|+.|.
T Consensus 39 ----------------------~~g~~~g~afV~f~~~~~A~~ai~~lng~~~~g~~l~v~~a~ 80 (82)
T d1b7fa1 39 ----------------------KTGYSYGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYAR 80 (82)
T ss_dssp ----------------------TTTEECSEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECC
T ss_pred ----------------------ccCCccccceEEECCHHHHHHHHHHhCCCEECCEEEEEEEcC
Confidence 001236899999999999999999876543 3456677764
|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|