Citrus Sinensis ID: 006206

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------
MELLRPSLLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMNVIGSSINANNLQDGKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQVSTGNGSSKGDKKHVGKIVGITVGCAAALVIISSVFYLWWTKDSSSHIRIFTDSPKQNLVR
ccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEEEEccccEEEccccccccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHHccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEccccEEEEccccccccccccEEEEEcccccccccHHHHccccccEEEEEEEccccccccccccccccccccccccccccccccEEcccccEEcccccccccccccccccccEEEccccccccccccccccccccccEEEEccccccccccHHHHHccccccccccccccccccccEEEEEEEEEEEEccccccccccccccccccccccccccccHHHHHccccccEEEEEEEEEccccEEEEEEEcccccccccccccccccccEEEEEcccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHEEEcccccccccccccccccccc
cccccHHHHHHHHHHHHEcccccccccHHHHHHHHHHHHHcccccccccHccccccccEEEcccccccccccccccccccEEEEEEEcccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEccccEEEccccHHHHccccEEEEccccccccccccccccHHHHHHHcccccccccccHHEEEccccccEEcccccccccccccccccEEEEccccccccccccHHcccccccEEEEEccccccccccHHHHHHccccccccccccccccccccEEEEEEEEEEEcccccccccccEEEEEEEEccEEEcccccHHHccccccEEEEEEEEEEcccEEEEEEEEccccccccccccccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
mellrpslLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWnlrskinlttidpctrnaswasenanprvacdctsnschithlKIYALDIMGELPSELFMLRKLMDlnlgqnvlngsipaeigqlsNMQYLSLGInnftgrvptelgnlTKLISLsfssnnffgplpkelgklTSLQQlyidssgvtgsipQEFANLKSLRILWAsdnlftgkipeffGTLTELADLRLQgtllegpiprsFRALNKLedlrigdlsaedstldFLESQKSLSILSlrncrvsgkipdqlGTFAKLQLLDLSfnkltgqiptslqdlSTLQYLYlgnnnlsgelpvniiapnlialdvsynplsgnlprnfakgglsmNVIGssinannlqdgkalgmmqclhsntkcsnkvpsssfsikcggtqiasasgiefdddsktLEAASFYTssgnrwavsntgnfisnpngplyiaqtdsqitgtldselyktarispsslryyglglengkyridLHFAEitmedslswkglgrRVFDVYIQGERVLRDLNikkeaggsKRALVKTFEANVTNTIIEIHFfwagkgtccipfqgtygplVSAIHAsqvstgngsskgdkkhvgKIVGITVGCAAALVIISSVFYLwwtkdssshiriftdspkqnlvr
MELLRPSLLLTVSLSLLQLVSAQtstdsaevDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMNVIGSSINANNLQDGKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMedslswkglgRRVFDVYIqgervlrdlnikkeaggskralVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQVstgngsskgdkKHVGKIVGITVGCAAALVIISSVFYLWWTKDSsshiriftdspkqnlvr
MEllrpsllltvslsllqlvsaqtsTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLsfssnnffGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMNVIGSSINANNLQDGKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQVSTGNGSSKGDKKHVGKIVGITVGCAAALVIISSVFYLWWTKDSSSHIRIFTDSPKQNLVR
*******LLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMNVIGSSINANNLQDGKALGMMQCLHS*************SIKCGGTQIA****I********LEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHA***************HVGKIVGITVGCAAALVIISSVFYLWWTKDSSSHIRIF**********
***LRPSLLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMNVIGSSINANNLQDGKALGMMQCLHSNTKCSNKVPSSSFSIKCG***IAS*SGIEFDDDSKTLEAASFYTSSGN*WA*SNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSW*GLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIH**********************GITVGCAAALVIISSVFYLWWTKDS**********PKQN***
MELLRPSLLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMNVIGSSINANNLQDGKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQ************KHVGKIVGITVGCAAALVIISSVFYLWWTKDSSSHIRIFTDSPKQNLVR
*ELLRPSLLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMNVIGSSINANNLQDGKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQVSTGNGSSKGDKKHVGKIVGITVGCAAALVIISSVFYLWWTKDSSSHIRIFTDS*K*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELLRPSLLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMNVIGSSINANNLQDGKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQVSTGNGSSKGDKKHVGKIVGITVGCAAALVIISSVFYLWWTKDSSSHIRIFTDSPKQNLVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query657 2.2.26 [Sep-21-2011]
C0LGH2 1032 Probable LRR receptor-lik yes no 0.934 0.594 0.444 1e-145
C0LGH3 1033 Probable LRR receptor-lik no no 0.949 0.604 0.445 1e-143
C0LGN2 1020 Probable leucine-rich rep no no 0.847 0.546 0.376 1e-94
C0LGG8 1038 Probable LRR receptor-lik no no 0.840 0.531 0.357 4e-93
C0LGG9 1035 Probable LRR receptor-lik no no 0.828 0.525 0.362 2e-92
C0LGE0 1014 Probable LRR receptor-lik no no 0.873 0.566 0.348 9e-92
C0LGG7 953 Probable LRR receptor-lik no no 0.770 0.530 0.365 6e-86
Q9ASQ6 1019 Probable LRR receptor-lik no no 0.907 0.584 0.357 8e-83
Q9FXF2 1021 Probable LRR receptor-lik no no 0.876 0.564 0.319 3e-78
Q9SHI21101 Leucine-rich repeat recep no no 0.368 0.219 0.401 6e-40
>sp|C0LGH2|Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2 Back     alignment and function desciption
 Score =  514 bits (1325), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 283/637 (44%), Positives = 393/637 (61%), Gaps = 23/637 (3%)

Query: 17  LQLVSAQTSTDSA----EVDALNKLIDYWNLRS----KINLTTIDPCTRNASWASENA-- 66
           +Q+V +Q  T +     E  ALN +   W +++     I+         +AS    N   
Sbjct: 24  VQVVQSQNQTGATTHPDEARALNSIFAAWKIQAPREWNISGELCSGAAIDASVLDSNPAY 83

Query: 67  NPRVACDCT---SNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEI 123
           NP + CDC+   S  C IT++K+YA+D++G +P EL+ L  L +LNLGQNVL GS+P  I
Sbjct: 84  NPLIKCDCSFQNSTICRITNIKVYAIDVVGPIPPELWTLTYLTNLNLGQNVLTGSLPPAI 143

Query: 124 GQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYID 183
           G L+ MQ+++ GIN  +G VP E+G LT L  L  SSNNF G +P E+G+ T LQQ+YID
Sbjct: 144 GNLTRMQWMTFGINALSGPVPKEIGLLTDLRLLGISSNNFSGSIPDEIGRCTKLQQMYID 203

Query: 184 SSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSF 243
           SSG++G IP  FANL  L   W +D   T +IP+F G  T+L  LR+ GT L GPIP SF
Sbjct: 204 SSGLSGRIPLSFANLVQLEQAWIADLEVTDQIPDFIGDWTKLTTLRIIGTGLSGPIPSSF 263

Query: 244 RALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLS 303
             L  L +LR+GD+S+  S+LDF++  KSLS+L LRN  ++G IP  +G  + L+ +DLS
Sbjct: 264 SNLTSLTELRLGDISSGSSSLDFIKDMKSLSVLVLRNNNLTGTIPSTIGEHSSLRQVDLS 323

Query: 304 FNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFA 363
           FNKL G IP SL +LS L +L+LGNN L+G  P      +L  +DVSYN LSG+LP   +
Sbjct: 324 FNKLHGPIPASLFNLSQLTHLFLGNNTLNGSFPTQKTQ-SLRNVDVSYNDLSGSLPSWVS 382

Query: 364 KGGLSMNVIGSSINANNLQDGKALGMMQCLHSNTKCSN-KVPSSSFSIKCGGTQIASASG 422
              L +N++ ++     L D + L  + CL  N  C+  K   S FSI CGG +  S +G
Sbjct: 383 LPSLKLNLVANNFTLEGL-DNRVLPGLNCLQKNFPCNRGKGIYSDFSINCGGPEKRSVTG 441

Query: 423 IEFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTA 482
             F+ + +    ASF+ S+G RWA S+ G F  + N  +YIA + SQ   TLDSEL+++A
Sbjct: 442 ALFEREDEDFGPASFFVSAGQRWAASSVGLFAGSSNN-IYIATSQSQFVNTLDSELFQSA 500

Query: 483 RISPSSLRYYGLGLENGKYRIDLHFAEITM--EDSLSWKGLGRRVFDVYIQGERVLRDLN 540
           R+S SS+RYYGLGLENG Y + L FAEI +    S +WKGLGRR FD+Y+QG  V +D +
Sbjct: 501 RLSASSVRYYGLGLENGGYTVTLQFAEIQILGSTSTTWKGLGRRRFDIYVQGRLVEKDFD 560

Query: 541 IKKEAGGSK-RALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHAS---Q 596
           +++ AG S  RA+ + ++ANV+   +E+H FWAGKGTCCIP QG YGPL+SA+ A+    
Sbjct: 561 VRRTAGDSTVRAVQRVYKANVSENHLEVHLFWAGKGTCCIPIQGAYGPLISAVSATPDFT 620

Query: 597 VSTGNGSSKGDKKHVGKIVGITVGCAAALVIISSVFY 633
            +  N      K   G IVG+ VG     ++   V +
Sbjct: 621 PTVANKPPSKGKNRTGTIVGVIVGVGLLSILAGVVMF 657

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGH3|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=1 SV=2 Back     alignment and function description
>sp|C0LGN2|Y3148_ARATH Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 OS=Arabidopsis thaliana GN=LRR-RLK PE=1 SV=1 Back     alignment and function description
>sp|C0LGG8|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1 Back     alignment and function description
>sp|C0LGG9|Y5344_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=1 SV=2 Back     alignment and function description
>sp|C0LGE0|Y1765_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana GN=At1g07650 PE=1 SV=1 Back     alignment and function description
>sp|C0LGG7|Y1534_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2 Back     alignment and function description
>sp|Q9ASQ6|Y1972_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g29720 OS=Arabidopsis thaliana GN=RFK1 PE=2 SV=3 Back     alignment and function description
>sp|Q9FXF2|RKF1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana GN=RKF1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query657
296082046649 unnamed protein product [Vitis vinifera] 0.978 0.990 0.764 0.0
359476140 889 PREDICTED: probable LRR receptor-like se 0.978 0.723 0.764 0.0
255548896 895 ATP binding protein, putative [Ricinus c 0.960 0.705 0.761 0.0
224143160608 predicted protein [Populus trichocarpa] 0.879 0.950 0.676 0.0
224092496466 predicted protein [Populus trichocarpa] 0.686 0.967 0.578 1e-178
359485959 1028 PREDICTED: probable LRR receptor-like se 0.936 0.598 0.489 1e-158
296081493 2193 unnamed protein product [Vitis vinifera] 0.936 0.280 0.482 1e-155
225447810 1031 PREDICTED: probable LRR receptor-like se 0.940 0.599 0.479 1e-153
359485957 1031 PREDICTED: probable LRR receptor-like se 0.933 0.594 0.478 1e-150
356523547 1029 PREDICTED: probable LRR receptor-like se 0.945 0.603 0.466 1e-150
>gi|296082046|emb|CBI21051.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1018 bits (2632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/649 (76%), Positives = 570/649 (87%), Gaps = 6/649 (0%)

Query: 9   LLTVS---LSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASEN 65
           +LTVS   L +++LV+AQT+TD  EV ALNKLIDYWNLRS +N ++IDPCT+NA+WAS++
Sbjct: 3   VLTVSFFVLCIIELVAAQTTTDRDEVAALNKLIDYWNLRS-LN-SSIDPCTQNATWASKD 60

Query: 66  ANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQ 125
           ANPRVACDCTSN+CHITHLKIYALDI GE+P ELF+L+KL+DLNLGQNVL+G IPAEIGQ
Sbjct: 61  ANPRVACDCTSNTCHITHLKIYALDISGEIPPELFVLKKLVDLNLGQNVLSGPIPAEIGQ 120

Query: 126 LSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSS 185
           LSN+QYLSLGINN TGRVP+ELGNLTKL+SLSF SNNFFGPLPKELG LTSLQQLYIDSS
Sbjct: 121 LSNLQYLSLGINNLTGRVPSELGNLTKLVSLSFGSNNFFGPLPKELGNLTSLQQLYIDSS 180

Query: 186 GVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRA 245
           GV+G IPQEFA LKSL+ILWASDNLFTGK+PEF GTL EL DLR++GTLLEGPIP SF A
Sbjct: 181 GVSGPIPQEFAGLKSLQILWASDNLFTGKLPEFIGTLIELRDLRVEGTLLEGPIPSSFGA 240

Query: 246 LNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFN 305
           L KLEDLRIGDL  +DS+LDFL SQ SLSILSLRNCRVSG+IPDQL TF KL+ LDLSFN
Sbjct: 241 LTKLEDLRIGDLRGQDSSLDFLGSQTSLSILSLRNCRVSGRIPDQLSTFTKLKYLDLSFN 300

Query: 306 KLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKG 365
           KLTG+I  S QD  +L+YLYLGNNNL+GELP NII+  LIALDVS+NPLSGNLP N AK 
Sbjct: 301 KLTGEILKSFQDFVSLEYLYLGNNNLNGELPANIISQELIALDVSFNPLSGNLPLNIAKV 360

Query: 366 GLSMNVIGSSINANNLQDGKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEF 425
           GLSMNV+G+SINAN+LQD KA GM+ CL  N KC+NK+PSSSFSIKCGGT+  SASG++F
Sbjct: 361 GLSMNVLGTSINANSLQDRKASGMLHCLQGNMKCTNKIPSSSFSIKCGGTEQRSASGVKF 420

Query: 426 DDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARIS 485
           DDDS+ L AAS YTS   +WAVSNTG+FISNPNGP YIA+TDSQI GTL+SELYKTAR+S
Sbjct: 421 DDDSEILGAASLYTSPDYQWAVSNTGSFISNPNGPQYIAKTDSQIRGTLESELYKTARVS 480

Query: 486 PSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEA 545
           PSSLRYYGLGL+NGKYR++LHFAEI MEDS+SWKGLGRR+FDVYIQGERVL   NI++EA
Sbjct: 481 PSSLRYYGLGLKNGKYRVELHFAEIAMEDSVSWKGLGRRLFDVYIQGERVLEGFNIQREA 540

Query: 546 GGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQV-STGNGSS 604
           GGSKRALVKT EANVTNTI+EIHF WAG+GTCCIPFQ TYGPLVSAIHA QV    + SS
Sbjct: 541 GGSKRALVKTLEANVTNTIMEIHFLWAGRGTCCIPFQSTYGPLVSAIHAYQVSDETSSSS 600

Query: 605 KGDKKHVGKIVGITVGCAAALVIISSVFYLWWTKDSSSHIRIFTDSPKQ 653
           + +KK +GK+VGI VGCA  +VIISS+FYLWW K++S H R+ T+SP++
Sbjct: 601 ESNKKRIGKVVGIVVGCAGGVVIISSIFYLWWKKEASGHTRVQTESPRK 649

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359476140|ref|XP_002282711.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255548896|ref|XP_002515504.1| ATP binding protein, putative [Ricinus communis] gi|223545448|gb|EEF46953.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224143160|ref|XP_002324865.1| predicted protein [Populus trichocarpa] gi|222866299|gb|EEF03430.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224092496|ref|XP_002309634.1| predicted protein [Populus trichocarpa] gi|222855610|gb|EEE93157.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359485959|ref|XP_002267672.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296081493|emb|CBI20016.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447810|ref|XP_002267129.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130 [Vitis vinifera] gi|296081492|emb|CBI20015.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485957|ref|XP_002267620.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356523547|ref|XP_003530399.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query657
TAIR|locus:2205250 1032 AT1G56130 [Arabidopsis thalian 0.917 0.584 0.448 8.8e-134
TAIR|locus:2203718 1035 AT1G53440 [Arabidopsis thalian 0.861 0.546 0.354 5.9e-89
TAIR|locus:2019367 1078 AT1G29740 [Arabidopsis thalian 0.891 0.543 0.344 1.7e-82
TAIR|locus:2019317 969 AT1G29730 [Arabidopsis thalian 0.858 0.582 0.346 2e-79
TAIR|locus:2205260 1047 AT1G56120 [Arabidopsis thalian 0.654 0.410 0.399 7.1e-77
TAIR|locus:2203847 1021 RKF1 "receptor-like kinase in 0.890 0.572 0.319 1e-75
TAIR|locus:2009630 953 AT1G53420 [Arabidopsis thalian 0.765 0.527 0.328 3.8e-61
TAIR|locus:2020417 1101 AT1G17230 [Arabidopsis thalian 0.414 0.247 0.366 7.6e-38
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.452 0.261 0.330 1.9e-37
TAIR|locus:2005540 999 HAE "HAESA" [Arabidopsis thali 0.526 0.346 0.336 2.5e-37
TAIR|locus:2205250 AT1G56130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1311 (466.6 bits), Expect = 8.8e-134, P = 8.8e-134
 Identities = 281/626 (44%), Positives = 389/626 (62%)

Query:    26 TDSAEVDALNKLIDYWNLRS--KINLTTIDPCTR---NASWASENA--NPRVACDCT-SN 77
             T   E  ALN +   W +++  + N++  + C+    +AS    N   NP + CDC+  N
Sbjct:    37 THPDEARALNSIFAAWKIQAPREWNISG-ELCSGAAIDASVLDSNPAYNPLIKCDCSFQN 95

Query:    78 S--CHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLG 135
             S  C IT++K+YA+D++G +P EL+ L  L +LNLGQNVL GS+P  IG L+ MQ+++ G
Sbjct:    96 STICRITNIKVYAIDVVGPIPPELWTLTYLTNLNLGQNVLTGSLPPAIGNLTRMQWMTFG 155

Query:   136 INNFTGRVPTELGNLTKLISLXXXXXXXXGPLPKELGKLTSLQQLYIDSSGVTGSIPQEF 195
             IN  +G VP E+G LT L  L        G +P E+G+ T LQQ+YIDSSG++G IP  F
Sbjct:   156 INALSGPVPKEIGLLTDLRLLGISSNNFSGSIPDEIGRCTKLQQMYIDSSGLSGRIPLSF 215

Query:   196 ANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIG 255
             ANL  L   W +D   T +IP+F G  T+L  LR+ GT L GPIP SF  L  L +LR+G
Sbjct:   216 ANLVQLEQAWIADLEVTDQIPDFIGDWTKLTTLRIIGTGLSGPIPSSFSNLTSLTELRLG 275

Query:   256 DLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSL 315
             D+S+  S+LDF++  KSLS+L LRN  ++G IP  +G  + L+ +DLSFNKL G IP SL
Sbjct:   276 DISSGSSSLDFIKDMKSLSVLVLRNNNLTGTIPSTIGEHSSLRQVDLSFNKLHGPIPASL 335

Query:   316 QDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMNVIGSS 375
              +LS L +L+LGNN L+G  P      +L  +DVSYN LSG+LP   +   L +N++ ++
Sbjct:   336 FNLSQLTHLFLGNNTLNGSFPTQK-TQSLRNVDVSYNDLSGSLPSWVSLPSLKLNLVANN 394

Query:   376 INANNLQDGKALGMMQCLHSNTKCSN-KVPSSSFSIKCGGTQIASASGIEFDDDSKTLEA 434
                  L D + L  + CL  N  C+  K   S FSI CGG +  S +G  F+ + +    
Sbjct:   395 FTLEGL-DNRVLPGLNCLQKNFPCNRGKGIYSDFSINCGGPEKRSVTGALFEREDEDFGP 453

Query:   435 ASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGL 494
             ASF+ S+G RWA S+ G F  + N  +YIA + SQ   TLDSEL+++AR+S SS+RYYGL
Sbjct:   454 ASFFVSAGQRWAASSVGLFAGSSNN-IYIATSQSQFVNTLDSELFQSARLSASSVRYYGL 512

Query:   495 GLENGKYRIDLHFAEITMEDSLS--WKGLGRRVFDVYIQGERVLRDLNIKKEAGGSK-RA 551
             GLENG Y + L FAEI +  S S  WKGLGRR FD+Y+QG  V +D ++++ AG S  RA
Sbjct:   513 GLENGGYTVTLQFAEIQILGSTSTTWKGLGRRRFDIYVQGRLVEKDFDVRRTAGDSTVRA 572

Query:   552 LVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQVST----GNGSSKGD 607
             + + ++ANV+   +E+H FWAGKGTCCIP QG YGPL+SA+ A+   T        SKG 
Sbjct:   573 VQRVYKANVSENHLEVHLFWAGKGTCCIPIQGAYGPLISAVSATPDFTPTVANKPPSKG- 631

Query:   608 KKHVGKIVGITVGCAAALVIISSVFY 633
             K   G IVG+ VG     ++   V +
Sbjct:   632 KNRTGTIVGVIVGVGLLSILAGVVMF 657
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0016020 "membrane" evidence=ISS
TAIR|locus:2203718 AT1G53440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019367 AT1G29740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019317 AT1G29730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205260 AT1G56120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203847 RKF1 "receptor-like kinase in flowers 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009630 AT1G53420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020417 AT1G17230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005540 HAE "HAESA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query657
pfam11721164 pfam11721, Malectin, Di-glucose binding within end 9e-59
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-42
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-39
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-38
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-36
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-35
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-11
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
pfam12819335 pfam12819, Malectin_like, Carbohydrate-binding pro 1e-05
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-05
>gnl|CDD|221187 pfam11721, Malectin, Di-glucose binding within endoplasmic reticulum Back     alignment and domain information 
 Score =  194 bits (495), Expect = 9e-59
 Identities = 82/189 (43%), Positives = 103/189 (54%), Gaps = 29/189 (15%)

Query: 407 SFSIKCGGTQIASASGIEFDDD-SKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQ 465
             +I CGG +   + GI ++ D   T  +A +Y S  N                      
Sbjct: 2   VLAINCGGPEHTDSDGITYEADTYFTGGSADYYVSDTNG--------------------- 40

Query: 466 TDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRV 525
             S I GT D ELY+T R SPSS  YY   LENG Y + LHFAEI   +     GLGRRV
Sbjct: 41  -SSSIAGTTDPELYQTERYSPSSFSYYIPCLENGNYTVILHFAEIYFGED----GLGRRV 95

Query: 526 FDVYIQGERVLRDLNIKKEAGGSKRALVKTF-EANVTNTIIEIHFFWAGKGTCCIPFQGT 584
           FDVY+QG+ VL+D +I  EAGG  +   K +    VT+  +EIHF+WAGKGT  IPF+G 
Sbjct: 96  FDVYVQGKLVLKDFDIVAEAGGKGKTAHKEYIPVTVTDGTLEIHFYWAGKGTLLIPFRGV 155

Query: 585 YG-PLVSAI 592
           YG P +SAI
Sbjct: 156 YGNPKISAI 164

Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan. It carries a signal peptide from residues 1-26, a C-terminal transmembrane helix from residues 255-274, and a highly conserved central part of approximately 190 residues followed by an acidic, glutamate-rich region. Carbohydrate-binding is mediated by the four aromatic residues, Y67, Y89, Y116, and F117 and the aspartate at D186. NMR-based ligand-screening studies has shown binding of the protein to maltose and related oligosaccharides, on the basis of which the protein has been designated "malectin", and its endogenous ligand is found to be Glc2-high-mannose N-glycan. Length = 164
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|221790 pfam12819, Malectin_like, Carbohydrate-binding protein of the ER Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 657
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
PF11721174 Malectin: Di-glucose binding within endoplasmic re 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
PLN032101153 Resistant to P. syringae 6; Provisional 99.84
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PLN032101153 Resistant to P. syringae 6; Provisional 99.83
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
KOG4237498 consensus Extracellular matrix protein slit, conta 99.8
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.78
KOG4237498 consensus Extracellular matrix protein slit, conta 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
PLN03150 623 hypothetical protein; Provisional 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
PF12819347 Malectin_like: Carbohydrate-binding protein of the 99.61
PLN03150623 hypothetical protein; Provisional 99.6
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.2
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.2
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.19
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.17
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.14
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.1
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.99
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.94
PF12819 347 Malectin_like: Carbohydrate-binding protein of the 98.9
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.9
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.86
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.85
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.74
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.62
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.59
KOG3593355 consensus Predicted receptor-like serine/threonine 98.55
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.49
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.41
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.35
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.32
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.19
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.18
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.15
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.03
PRK15386426 type III secretion protein GogB; Provisional 97.86
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.83
PRK15386426 type III secretion protein GogB; Provisional 97.7
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.65
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.64
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.56
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.36
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.31
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.29
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.17
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.07
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.89
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.78
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 96.62
KOG4341483 consensus F-box protein containing LRR [General fu 96.27
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 96.21
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 95.94
KOG4341483 consensus F-box protein containing LRR [General fu 95.87
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.72
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.7
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.66
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 95.48
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.44
KOG4308478 consensus LRR-containing protein [Function unknown 94.52
KOG4308478 consensus LRR-containing protein [Function unknown 94.41
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.23
PF06697278 DUF1191: Protein of unknown function (DUF1191); In 94.18
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.81
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 92.88
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.17
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.97
PF0103464 Syndecan: Syndecan domain; InterPro: IPR001050 The 89.65
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.27
PHA03265402 envelope glycoprotein D; Provisional 85.56
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.55
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 85.04
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.57
PF08374 221 Protocadherin: Protocadherin; InterPro: IPR013585 82.44
PF03302397 VSP: Giardia variant-specific surface protein; Int 82.09
PF02480439 Herpes_gE: Alphaherpesvirus glycoprotein E; InterP 81.19
PF0103464 Syndecan: Syndecan domain; InterPro: IPR001050 The 81.1
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.2e-38  Score=378.36  Aligned_cols=338  Identities=31%  Similarity=0.521  Sum_probs=257.4

Q ss_pred             CCCCHHHHHHHHHHHHhcCCC----CCCCCCCCCCCCCCCCCCCCCCCCCeeeecCCCCCceeEEEEecCCCCccCChhc
Q 006206           24 TSTDSAEVDALNKLIDYWNLR----SKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSEL   99 (657)
Q Consensus        24 ~~~~~~e~~aL~~~~~~~~~~----~~w~~~~~d~C~~~~~W~~~~~~~~v~C~~~~~~~~v~~L~l~~~~l~~~lp~~l   99 (657)
                      +..+++|.+||..|++.+..+    ..|+.. .|||.    |      .|+.|+   ...+|+.|+++++++.+.++..+
T Consensus        24 ~~~~~~~~~~l~~~~~~~~~~~~~~~~w~~~-~~~c~----w------~gv~c~---~~~~v~~L~L~~~~i~~~~~~~~   89 (968)
T PLN00113         24 SMLHAEELELLLSFKSSINDPLKYLSNWNSS-ADVCL----W------QGITCN---NSSRVVSIDLSGKNISGKISSAI   89 (968)
T ss_pred             cCCCHHHHHHHHHHHHhCCCCcccCCCCCCC-CCCCc----C------cceecC---CCCcEEEEEecCCCccccCChHH
Confidence            344778999999999998643    568765 78997    8      699997   24589999999999999999999


Q ss_pred             cCCCCCCEEEccCCCCCCCCchhcC-CCCCCCeeEcccCcCCCCCCccccCCCCCcEEEeecccCCCCCchhhcCCCCCC
Q 006206          100 FMLRKLMDLNLGQNVLNGSIPAEIG-QLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQ  178 (657)
Q Consensus       100 ~~l~~L~~L~Ls~n~l~~~~p~~l~-~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~  178 (657)
                      ..+++|+.|+|++|.+.+.+|..+. .+++|++|+|++|++++.+|.  +.+++|++|+|++|.+.+.+|..++++++|+
T Consensus        90 ~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~  167 (968)
T PLN00113         90 FRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLK  167 (968)
T ss_pred             hCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCC
Confidence            9999999999999999988887654 888899999998888877765  4577788888888877777777777777888


Q ss_pred             eeecccccCCCCCchhccCCCCCcEEEccCCcCCCCCchhcCCCCcccEEEccCCCCCCCchhhccCCCCCCeEEcCCCC
Q 006206          179 QLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLS  258 (657)
Q Consensus       179 ~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~~~  258 (657)
                      +|+|++|.+.+.+|..+.++++|++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|..+..+++|++|++++|.
T Consensus       168 ~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~  247 (968)
T PLN00113        168 VLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNN  247 (968)
T ss_pred             EEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCce
Confidence            88888777777777777777777888877777777777777777777777777777777777777777777777777777


Q ss_pred             CCCCChhhhhcCCCCCEEEccCcccccCCcccccCCCCCcEEeccCCCCCCCCchhccCCCCCcEEEccCCcCCCCCCcc
Q 006206          259 AEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVN  338 (657)
Q Consensus       259 ~~~~~~~~l~~~~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~  338 (657)
                      +....+..+..+++|++|+|++|.+.+.+|..+..+++|+.|+|++|++.+.+|..+..+++|+.|++++|.+++.+|..
T Consensus       248 l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~  327 (968)
T PLN00113        248 LTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVA  327 (968)
T ss_pred             eccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChh
Confidence            66666666777777777777777777777777777777777777777777677776777777777777777777666644


Q ss_pred             c-cCCCCceEecccccCCCCCCccccC-CCcE-EEeecCCcC
Q 006206          339 I-IAPNLIALDVSYNPLSGNLPRNFAK-GGLS-MNVIGSSIN  377 (657)
Q Consensus       339 ~-~~~~L~~LdLs~N~l~g~~p~~~~~-~~l~-~~l~~n~~~  377 (657)
                      + .+++|+.|+|++|.+++.+|..+.. ..|+ +++++|++.
T Consensus       328 ~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~  369 (968)
T PLN00113        328 LTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLT  369 (968)
T ss_pred             HhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeE
Confidence            4 3566777777777776666655554 4443 566666553

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3593 consensus Predicted receptor-like serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF06697 DUF1191: Protein of unknown function (DUF1191); InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF01034 Syndecan: Syndecan domain; InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PHA03265 envelope glycoprotein D; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information
>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) Back     alignment and domain information
>PF02480 Herpes_gE: Alphaherpesvirus glycoprotein E; InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein Back     alignment and domain information
>PF01034 Syndecan: Syndecan domain; InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query657
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-23
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-23
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-14
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-06
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 4e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 5e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 97/341 (28%), Positives = 139/341 (40%), Gaps = 84/341 (24%)
Query: 73  DCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYL 132
           DC++    + HL I    + G+    +    +L  LN+  N   G IP     L ++QYL
Sbjct: 218 DCSA----LQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYL 271
Query: 133 SLGINNFTGRVPTEL-GNLTKLISLXXXXXXXXGPLPKELG------------------- 172
           SL  N FTG +P  L G    L  L        G +P   G                   
Sbjct: 272 SLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGEL 331
Query: 173 ------KLTSLQQLYIDSSGVTGSIPQEFANL---------------------------K 199
                 K+  L+ L +  +  +G +P+   NL                            
Sbjct: 332 PMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKN 391
Query: 200 SLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSA 259
           +L+ L+  +N FTGKIP      +EL  L L    L G IP S  +L+KL DL++     
Sbjct: 392 TLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKL----- 446
Query: 260 EDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLS 319
               L+ LE                G+IP +L     L+ L L FN LTG+IP+ L + +
Sbjct: 447 ---WLNMLE----------------GEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCT 487
Query: 320 TLQYLYLGNNNLSGELPVNI-IAPNLIALDVSYNPLSGNLP 359
            L ++ L NN L+GE+P  I    NL  L +S N  SGN+P
Sbjct: 488 NLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIP 528
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query657
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-40
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-66
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-64
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-63
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-61
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-61
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-61
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-57
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-55
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-43
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-45
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-40
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-40
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-25
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-41
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-39
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-39
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-38
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-38
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 4e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-38
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-34
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-33
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-30
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-37
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-36
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-34
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-33
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-27
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-22
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-22
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-21
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-21
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  224 bits (574), Expect = 3e-68
 Identities = 79/293 (26%), Positives = 124/293 (42%), Gaps = 31/293 (10%)

Query: 70  VACDCTSNSCHITHLKIYALDIMGE--LPSELFMLRKLMDLNL-GQNVLNGSIPAEIGQL 126
           V CD  + +  + +L +  L++     +PS L  L  L  L + G N L G IP  I +L
Sbjct: 41  VLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKL 100

Query: 127 SNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSG 186
           + + YL +   N +G +P  L  +  L++L FS N   G LP  +  L +L  +  D + 
Sbjct: 101 TQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNR 160

Query: 187 VTGSIPQEFANLKSL-RILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRA 245
           ++G+IP  + +   L   +  S N  TGKIP  F  L  LA + L   +LEG     F +
Sbjct: 161 ISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGS 219

Query: 246 LNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFN 305
                                    K+   + L    ++  +  ++G    L  LDL  N
Sbjct: 220 D------------------------KNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNN 254

Query: 306 KLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNP-LSGN 357
           ++ G +P  L  L  L  L +  NNL GE+P             + N  L G+
Sbjct: 255 RIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGS 307
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Length = 174 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query657
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.98
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.98
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.98
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.81
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.81
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.8
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.79
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.72
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.72
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.56
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.42
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.37
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.15
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.15
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.14
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.14
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.94
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.93
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.9
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.73
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.67
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.57
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.37
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.33
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.3
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.19
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.95
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.76
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.65
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.84
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.83
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 96.42
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 96.4
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 96.31
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.31
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.59
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 93.82
2k9y_A41 Ephrin type-A receptor 2; receptor tyrosine kinase 89.67
2o14_A 375 Hypothetical protein YXIM; NESG, X-RAY, SR595, str 82.71
1iij_A35 ERBB-2 receptor protein-tyrosine kinase; alpha-hel 80.09
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=2.6e-39  Score=335.12  Aligned_cols=298  Identities=29%  Similarity=0.448  Sum_probs=251.8

Q ss_pred             CCCHHHHHHHHHHHHhcCCC---CCCCCCCCCCCCCCCCCCCCCCCCCeeeecCCCCCceeEEEEecCCCCc--cCChhc
Q 006206           25 STDSAEVDALNKLIDYWNLR---SKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMG--ELPSEL   99 (657)
Q Consensus        25 ~~~~~e~~aL~~~~~~~~~~---~~w~~~~~d~C~~~~~W~~~~~~~~v~C~~~~~~~~v~~L~l~~~~l~~--~lp~~l   99 (657)
                      .|+++|++||.+||+.++.+   ..|+.. .|||..  .|      .||.|+......+|++|+++++++.+  .+|..+
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~~l~~W~~~-~~~C~~--~w------~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~~l   72 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPTTLSSWLPT-TDCCNR--TW------LGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSL   72 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTT-SCTTTT--CS------TTEEECCSSSCCCEEEEEEECCCCSSCEECCGGG
T ss_pred             CCCHHHHHHHHHHHHhcCCcccccCCCCC-CCCCcC--CC------cceEeCCCCCCceEEEEECCCCCccCCcccChhH
Confidence            58999999999999999754   579776 789962  37      79999854334789999999999998  899999


Q ss_pred             cCCCCCCEEEccC-CCCCCCCchhcCCCCCCCeeEcccCcCCCCCCccccCCCCCcEEEeecccCCCCCchhhcCCCCCC
Q 006206          100 FMLRKLMDLNLGQ-NVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQ  178 (657)
Q Consensus       100 ~~l~~L~~L~Ls~-n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~  178 (657)
                      .++++|++|+|++ |.+.+.+|..|+++++|++|+|++|.+++.+|..|.++++|++|+|++|.+.+.+|..+..+++|+
T Consensus        73 ~~l~~L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~  152 (313)
T 1ogq_A           73 ANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLV  152 (313)
T ss_dssp             GGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCC
T ss_pred             hCCCCCCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCC
Confidence            9999999999994 888888999999999999999999999988999999999999999999999888888899999999


Q ss_pred             eeecccccCCCCCchhccCCC-CCcEEEccCCcCCCCCchhcCCCCcccEEEccCCCCCCCchhhccCCCCCCeEEcCCC
Q 006206          179 QLYIDSSGVTGSIPQEFANLK-SLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDL  257 (657)
Q Consensus       179 ~L~Ls~n~l~~~~p~~l~~l~-~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~~  257 (657)
                      +|++++|.+++.+|..+..++ +|++|++++|++.+.+|..+..++ |++|++++|.+++..|..+..+           
T Consensus       153 ~L~L~~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~~~~l-----------  220 (313)
T 1ogq_A          153 GITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSD-----------  220 (313)
T ss_dssp             EEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTT-----------
T ss_pred             eEECcCCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCCc-ccEEECcCCcccCcCCHHHhcC-----------
Confidence            999999999888888888887 888888888888888888777776 8888888887776666555544           


Q ss_pred             CCCCCChhhhhcCCCCCEEEccCcccccCCcccccCCCCCcEEeccCCCCCCCCchhccCCCCCcEEEccCCcCCCCCCc
Q 006206          258 SAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPV  337 (657)
Q Consensus       258 ~~~~~~~~~l~~~~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~  337 (657)
                                   ++|++|+|++|.+++.+|. +..+++|++|+|++|++++.+|..+..+++|++|+|++|+++|.+|.
T Consensus       221 -------------~~L~~L~L~~N~l~~~~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~  286 (313)
T 1ogq_A          221 -------------KNTQKIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ  286 (313)
T ss_dssp             -------------SCCSEEECCSSEECCBGGG-CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC
T ss_pred             -------------CCCCEEECCCCceeeecCc-ccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCcccccCCC
Confidence                         5566666666777655555 67788999999999999888898899999999999999999988887


Q ss_pred             cccCCCCceEeccccc-CCCC
Q 006206          338 NIIAPNLIALDVSYNP-LSGN  357 (657)
Q Consensus       338 ~~~~~~L~~LdLs~N~-l~g~  357 (657)
                      ...+++|+.|++++|+ +.|.
T Consensus       287 ~~~l~~L~~l~l~~N~~lc~~  307 (313)
T 1ogq_A          287 GGNLQRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             STTGGGSCGGGTCSSSEEEST
T ss_pred             CccccccChHHhcCCCCccCC
Confidence            7668899999999998 6764
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2k9y_A Ephrin type-A receptor 2; receptor tyrosine kinase, membrane protein, dimeric transmembrane domain, ephrin receptor, ATP-binding, glycoprotein; NMR {Homo sapiens} Back     alignment and structure
>2o14_A Hypothetical protein YXIM; NESG, X-RAY, SR595, structural genomics, PSI-2, protein structure initiative; 2.10A {Bacillus subtilis} SCOP: b.18.1.32 c.23.10.8 Back     alignment and structure
>1iij_A ERBB-2 receptor protein-tyrosine kinase; alpha-helix-PI-bulge-alpha-helix, signaling protein; NMR {Synthetic} SCOP: j.35.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 657
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-04
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 92.0 bits (227), Expect = 4e-21
 Identities = 58/286 (20%), Positives = 105/286 (36%), Gaps = 14/286 (4%)

Query: 118 SIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSL 177
            +P ++    +   L L  N  T     +  NL  L +L   +N      P     L  L
Sbjct: 24  KVPKDLP--PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKL 81

Query: 178 QQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLE- 236
           ++LY+  + +   +P++         L   +N  T      F  L ++  + L    L+ 
Sbjct: 82  ERLYLSKNQLK-ELPEKMPKTLQE--LRVHENEITKVRKSVFNGLNQMIVVELGTNPLKS 138

Query: 237 -GPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFA 295
            G    +F+ + KL  +RI D +             SL+ L L   +++      L    
Sbjct: 139 SGIENGAFQGMKKLSYIRIADTNITTIPQGLP---PSLTELHLDGNKITKVDAASLKGLN 195

Query: 296 KLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLS 355
            L  L LSFN ++     SL +   L+ L+L NN L            +  + +  N +S
Sbjct: 196 NLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNIS 255

Query: 356 GNLPRNFAKGGL---SMNVIGSSINANNLQDGKAL-GMMQCLHSNT 397
                +F   G      +  G S+ +N +Q  +      +C++   
Sbjct: 256 AIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRA 301
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query657
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.5
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.41
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.13
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.04
d2o14a1146 Hypothetical protein YxiM {Bacillus subtilis [TaxI 98.38
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.03
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.53
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.48
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.66
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=1.2e-38  Score=327.67  Aligned_cols=298  Identities=28%  Similarity=0.437  Sum_probs=246.5

Q ss_pred             CCCHHHHHHHHHHHHhcCCC---CCCCCCCCCCCCCCCCCCCCCCCCCeeeecCCCCCceeEEEEecCCCCc--cCChhc
Q 006206           25 STDSAEVDALNKLIDYWNLR---SKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMG--ELPSEL   99 (657)
Q Consensus        25 ~~~~~e~~aL~~~~~~~~~~---~~w~~~~~d~C~~~~~W~~~~~~~~v~C~~~~~~~~v~~L~l~~~~l~~--~lp~~l   99 (657)
                      .|+|+|++||.+||+.+..+   .+|... .|||.  ..|      .||+|+..+...||++|+|+++++.|  .+|+++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~~~-~d~C~--~~w------~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l   72 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWLPT-TDCCN--RTW------LGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSL   72 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTT-SCTTT--TCS------TTEEECCSSSCCCEEEEEEECCCCSSCEECCGGG
T ss_pred             CCCHHHHHHHHHHHHHCCCCCcCCCCCCC-CCCCC--CcC------CCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHH
Confidence            58999999999999999765   679766 89995  248      79999976667799999999999987  588999


Q ss_pred             cCCCCCCEEEccC-CCCCCCCchhcCCCCCCCeeEcccCcCCCCCCccccCCCCCcEEEeecccCCCCCchhhcCCCCCC
Q 006206          100 FMLRKLMDLNLGQ-NVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQ  178 (657)
Q Consensus       100 ~~l~~L~~L~Ls~-n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~  178 (657)
                      .+|++|++|+|++ |.++|.+|..|+++++|++|+|++|++.+..+..+..+..|++++++.|.+.+.+|..+.++++|+
T Consensus        73 ~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~  152 (313)
T d1ogqa_          73 ANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLV  152 (313)
T ss_dssp             GGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCC
T ss_pred             hcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccc
Confidence            9999999999986 788888999999999999999999999988888888899999999999988888888888899999


Q ss_pred             eeecccccCCCCCchhccCCCCC-cEEEccCCcCCCCCchhcCCCCcccEEEccCCCCCCCchhhccCCCCCCeEEcCCC
Q 006206          179 QLYIDSSGVTGSIPQEFANLKSL-RILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDL  257 (657)
Q Consensus       179 ~L~Ls~n~l~~~~p~~l~~l~~L-~~L~Ls~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~~  257 (657)
                      ++++++|.+.+.+|..+..+..+ +.+++++|++++..|..+..+..+ .+++..+...+.+|..+..+           
T Consensus       153 ~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~-----------  220 (313)
T d1ogqa_         153 GITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSD-----------  220 (313)
T ss_dssp             EEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTT-----------
T ss_pred             eeeccccccccccccccccccccccccccccccccccccccccccccc-cccccccccccccccccccc-----------
Confidence            99999998888888888877775 778888888887777777666544 57777777666666555444           


Q ss_pred             CCCCCChhhhhcCCCCCEEEccCcccccCCcccccCCCCCcEEeccCCCCCCCCchhccCCCCCcEEEccCCcCCCCCCc
Q 006206          258 SAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPV  337 (657)
Q Consensus       258 ~~~~~~~~~l~~~~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~  337 (657)
                                   ++|+.+++++|.+.+.+| .+..+++|+.|+|++|+++|.+|..|..+++|++|+|++|+++|.+|.
T Consensus       221 -------------~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~  286 (313)
T d1ogqa_         221 -------------KNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ  286 (313)
T ss_dssp             -------------SCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC
T ss_pred             -------------cccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC
Confidence                         556666666777765554 467788889999999999888888888899999999999999988886


Q ss_pred             cccCCCCceEeccccc-CCCC
Q 006206          338 NIIAPNLIALDVSYNP-LSGN  357 (657)
Q Consensus       338 ~~~~~~L~~LdLs~N~-l~g~  357 (657)
                      ...+++|+.+++++|+ +.|.
T Consensus       287 ~~~L~~L~~l~l~~N~~l~g~  307 (313)
T d1ogqa_         287 GGNLQRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             STTGGGSCGGGTCSSSEEEST
T ss_pred             cccCCCCCHHHhCCCccccCC
Confidence            5567888889999987 6664
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure