Citrus Sinensis ID: 006276

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650--
MHFNKLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNERMQEYKRQIDRESRWASNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRFFVLDSRGMLYYYRKQCSKSSGSGSQLSSQRNSSELGSGLLSRWLSSHYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLSSQAPERCLPTSPMGSGHHRSASDSSSFESSDFDHAAVEEYTSERNLTSAYHERQSRGSQQQRSCVKSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHSDSISVKEKFIHAKVQYPLWPLRFNCFMHNCIYRM
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccEEEEccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccEEEEEcccccccccccccccEEEcccccccccHHHHHHHHHHcHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccc
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccccccccccccccEEccccccccccEEEEccccccccEEEEEEEEEEcccccccccEEEEEEEccEEEEEEEcccccccccccccccccccccccccEHHEHHHccccccccccccccEEEEEEEEEEEcccHHHHHHcccEEEEcccccEEEEcccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHcHHccccccccccccccccccHHHHHHHHHcccccEccccccEcccEEEccccEEEcHHHHHHHHHHccccccEEEcccccccccHHHHHHHHHHcHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHccHHHHcc
mhfnklddspmFRKQIQGLEESAEVLRERSLKFYKGCRKyteglgegydgdIAFASALEtfggghndpisvafggpvmtKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNERMQEYKRQIDresrwasngsngspngdgiqAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLskrssnlrgdwKRRFFVLDSRGMLYYYRkqcskssgsgsqlssqrnssELGSGLLSRWLsshyhggvhdeksaARHTVNLLTSTikvdadqsdlrfcfriisptknytlqaESALDQMDWIEKITGVIASLlssqaperclptspmgsghhrsasdsssfessdfdHAAVEEYTsernltsayherqsrgsqqqrscvksekpidVLRRvcgndrcadcgapepdwaslnLGVLVCIECsgvhrnlgvHISKVRSLtldvkvwePSVITLFQSLGNAFANSVWEELLQSRsafhvdltppslhksdkpqlllmgkpshsdsisVKEKFIHAkvqyplwplrfncfmhnciyrm
mhfnklddspmfrKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNERMQEYKRQIDRESrwasngsngspngdGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGylskrssnlrgdwkrRFFVLDSRGMLYYYRKQCskssgsgsqlssQRNSSELGSGLLSRWLSSHYHGGVHDEKSAARHTVNLLTStikvdadqsdLRFCFRiisptknytLQAESALDQMDWIEKITGVIASLLSSQAPERCLPTSPMGSGHHRSASDSSSFESSDFDHAAVEEYTSERNLTSAYherqsrgsqqqrscvksekpidVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHSDSISVKEKFIHAKVQYPLWPLRFNCFMHNCIYRM
MHFNKLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNERMQEYKRQIDRESRWAsngsngspngDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRFFVLDSRGMLYYYRKQCskssgsgsqlssqrnsselgsgllsrwlssHYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLSSQAPERCLPTSPMgsghhrsasdsssfessdfdhaaVEEYTSERNLTSAYHErqsrgsqqqrsCVKSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHSDSISVKEKFIHAKVQYPLWPLRFNCFMHNCIYRM
************************VLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYA**********************************************************************IRQGYL*****NLRGDWKRRFFVLDSRGMLYYYRK************************LLSRWLSSHYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLL***********************************************************************IDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVD***************************VKEKFIHAKVQYPLWPLRFNCFMHNCIY**
**FNKLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQA***********************HSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLT**********************************************************************************************VLDSRGMLY**********************************************************************************************************************************************************************************IDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQ*********************************ISVKEKFIHAKVQYPLWPLRFNCF********
********SPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNERMQEYKRQIDRESRWASNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRFFVLDSRGMLYYYRKQ*********************SGLLSRWLSSHYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLSSQAPERCLP**********************FDHAAVEEYTSERNLTS*******************EKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHSDSISVKEKFIHAKVQYPLWPLRFNCFMHNCIYRM
****KLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNERMQEYKRQIDRE****************I**I*RSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRFFVLDSRGMLYYYRKQC*********************GLLSRWLSSHYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLSSQ**************************************************************VKSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQ*******************************DSISVKEKFIHAKVQYPLWPLRFNCFMHNCIYR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHFNKLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSxxxxxxxxxxxxxxxxxxxxxIDRESRWASNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRFFVLDSRGMLYYYRKQCSKSSGSGSQLSSQRNSSELGSGLLSRWLSSHYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLSSQAPERCLPTSPMGSGHHRSASDSSSFESSDFDHAAVEEYTSERNLTSAYHERQSRGSQQQRSCVKSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHSDSISVKEKFIHAKVQYPLWPLRFNCFMHNCIYRM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query652 2.2.26 [Sep-21-2011]
Q5W7F2 827 ADP-ribosylation factor G yes no 0.975 0.769 0.856 0.0
Q9FIT8 828 ADP-ribosylation factor G no no 0.960 0.756 0.742 0.0
Q9C6C3 776 ADP-ribosylation factor G no no 0.886 0.744 0.484 1e-160
Q9SMX5 775 ADP-ribosylation factor G no no 0.891 0.749 0.471 1e-158
Q96P50 834 Arf-GAP with coiled-coil, yes no 0.714 0.558 0.277 2e-47
Q5FVC7 770 Arf-GAP with coiled-coil, yes no 0.717 0.607 0.268 1e-46
Q6ZQK5 770 Arf-GAP with coiled-coil, no no 0.717 0.607 0.267 5e-46
Q6IVG4 778 Arf-GAP with coiled-coil, yes no 0.714 0.598 0.266 9e-46
Q15057 778 Arf-GAP with coiled-coil, no no 0.714 0.598 0.264 1e-45
Q5ZK62 781 Arf-GAP with coiled-coil, no no 0.720 0.601 0.259 7e-45
>sp|Q5W7F2|AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana GN=AGD3 PE=1 SV=1 Back     alignment and function desciption
 Score = 1115 bits (2885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/642 (85%), Positives = 587/642 (91%), Gaps = 6/642 (0%)

Query: 1   MHFNKLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALET 60
           MHF KLDDSPMFRKQ+Q +EESAE+LRERSLKFYKGCRKYTEGLGE YDGDIAFASALET
Sbjct: 1   MHFTKLDDSPMFRKQLQSMEESAEILRERSLKFYKGCRKYTEGLGEAYDGDIAFASALET 60

Query: 61  FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKE 120
           FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEH+LNDRLLQ+ N+DLHEVKE
Sbjct: 61  FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHILNDRLLQFANMDLHEVKE 120

Query: 121 ARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVE 180
           ARK FDKASL YDQAREKFLSLRKGTK+DVAA LE+ELH++RS FEQARF+LVTALSNVE
Sbjct: 121 ARKRFDKASLTYDQAREKFLSLRKGTKSDVAAALEQELHTSRSMFEQARFNLVTALSNVE 180

Query: 181 AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNER 240
           AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNE+
Sbjct: 181 AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNEK 240

Query: 241 MQEYKRQIDRESRWASNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLS 300
           MQEYKRQ+DRESRW SNGSNGSPNGDGIQAIGRSSHKMI+AVMQSAA+GKVQTIRQGYLS
Sbjct: 241 MQEYKRQVDRESRWGSNGSNGSPNGDGIQAIGRSSHKMIDAVMQSAARGKVQTIRQGYLS 300

Query: 301 KRSSNLRGDWKRRFFVLDSRGMLYYYRKQCSKSSGSGSQLSSQRNSSELGSGLLSRWLSS 360
           KRSSNLRGDWKRRFFVLDSRGMLYYYRKQCSK SGSGSQLS QRNSSELGSGLLSRWLSS
Sbjct: 301 KRSSNLRGDWKRRFFVLDSRGMLYYYRKQCSKPSGSGSQLSGQRNSSELGSGLLSRWLSS 360

Query: 361 --HYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMD 418
             H HGGVHDEKS ARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMD
Sbjct: 361 NNHGHGGVHDEKSVARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMD 420

Query: 419 WIEKITGVIASLLSSQAPERCLPTSPMGSGHHRSASDSSSFESSDFDHAAVEEYTSERNL 478
           WIEKITGVIASLLSSQ PE+ LP SPMGSGHHRSAS+SSS+ESS++DH   EE+  ER+ 
Sbjct: 421 WIEKITGVIASLLSSQVPEQRLPGSPMGSGHHRSASESSSYESSEYDHPTTEEFVCERSF 480

Query: 479 TSAYHERQSRGSQQQRSCVKSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIEC 538
              Y+ER SR  Q QRS  K EKPID LR+VCGND+CADCGAPEPDWASLNLGVLVCIEC
Sbjct: 481 L-GYNERPSRSFQPQRSIRKGEKPIDALRKVCGNDKCADCGAPEPDWASLNLGVLVCIEC 539

Query: 539 SGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTP 598
           SGVHRNLGVHISKVRSLTLDVKVWEPSVI+LFQ+LGN FAN+VWEELL SRSA H D   
Sbjct: 540 SGVHRNLGVHISKVRSLTLDVKVWEPSVISLFQALGNTFANTVWEELLHSRSAIHFD--- 596

Query: 599 PSLHKSDKPQLLLMGKPSHSDSISVKEKFIHAKVQYPLWPLR 640
           P L  SDK ++++ GKPS++D IS+KEK+I AK    L+  R
Sbjct: 597 PGLTVSDKSRVMVTGKPSYADMISIKEKYIQAKYAEKLFVRR 638
GTPase-activating protein (GAP) for ADP ribosylation factor (ARF). Involved in the spatial control of provascular differentiation. Required for the formation of the normal pattern of continuous secondary veins. Involved in auxin signaling but not in polar auxin transport or in auxin responses. Required for PIN1 internalization in roots.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FIT8|AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana GN=AGD1 PE=2 SV=2 Back     alignment and function description
>sp|Q9C6C3|AGD2_ARATH ADP-ribosylation factor GTPase-activating protein AGD2 OS=Arabidopsis thaliana GN=AGD2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SMX5|AGD4_ARATH ADP-ribosylation factor GTPase-activating protein AGD4 OS=Arabidopsis thaliana GN=AGD4 PE=2 SV=2 Back     alignment and function description
>sp|Q96P50|ACAP3_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ACAP3 PE=1 SV=2 Back     alignment and function description
>sp|Q5FVC7|ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus GN=Acap2 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZQK5|ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Acap2 PE=1 SV=2 Back     alignment and function description
>sp|Q6IVG4|ACAP2_RABIT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Oryctolagus cuniculus GN=ACAP2 PE=2 SV=1 Back     alignment and function description
>sp|Q15057|ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ACAP2 PE=1 SV=3 Back     alignment and function description
>sp|Q5ZK62|ACAP2_CHICK Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Gallus gallus GN=ACAP2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query652
296085519 832 unnamed protein product [Vitis vinifera] 0.976 0.765 0.901 0.0
224057840 840 predicted protein [Populus trichocarpa] 0.963 0.747 0.879 0.0
224072473 830 predicted protein [Populus trichocarpa] 0.964 0.757 0.885 0.0
356567188 1231 PREDICTED: ADP-ribosylation factor GTPas 0.967 0.512 0.908 0.0
255543198 1369 ATP binding protein, putative [Ricinus c 0.973 0.463 0.904 0.0
356523716 1228 PREDICTED: ADP-ribosylation factor GTPas 0.976 0.518 0.899 0.0
449520667 1194 PREDICTED: ADP-ribosylation factor GTPas 0.950 0.519 0.882 0.0
297811447 828 hypothetical protein ARALYDRAFT_488148 [ 0.975 0.768 0.859 0.0
79512687 827 ADP-ribosylation factor GTPase-activatin 0.975 0.769 0.856 0.0
357502667 832 ADP-ribosylation factor GTPase-activatin 0.967 0.758 0.887 0.0
>gi|296085519|emb|CBI29251.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1183 bits (3060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/637 (90%), Positives = 602/637 (94%)

Query: 1   MHFNKLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALET 60
           MHF KLDDSPMFRKQIQ LEESAE LRERSLKFYKGCRKYTEGLGEGYDGDIAFASALET
Sbjct: 1   MHFAKLDDSPMFRKQIQCLEESAESLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALET 60

Query: 61  FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKE 120
           FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRL+Q+VNIDLH+VKE
Sbjct: 61  FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLIQFVNIDLHDVKE 120

Query: 121 ARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVE 180
           ARK FDKASLLYDQAREK+LSLRKGTK+D+A +LEEELH+ARS FEQARF+LVT LSNVE
Sbjct: 121 ARKRFDKASLLYDQAREKYLSLRKGTKSDIATVLEEELHNARSTFEQARFNLVTTLSNVE 180

Query: 181 AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNER 240
           AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERS YEQAALNE+
Sbjct: 181 AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSKYEQAALNEK 240

Query: 241 MQEYKRQIDRESRWASNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLS 300
           MQE+KRQIDRESRW SNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLS
Sbjct: 241 MQEFKRQIDRESRWPSNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLS 300

Query: 301 KRSSNLRGDWKRRFFVLDSRGMLYYYRKQCSKSSGSGSQLSSQRNSSELGSGLLSRWLSS 360
           KRSSNLRGDWKRRFFVLDSRGMLYYYRKQ SK SGSGSQ S QRNSSELGSGLLSRWLSS
Sbjct: 301 KRSSNLRGDWKRRFFVLDSRGMLYYYRKQNSKPSGSGSQHSGQRNSSELGSGLLSRWLSS 360

Query: 361 HYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWI 420
           HYHGGVHDEKS A HTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWI
Sbjct: 361 HYHGGVHDEKSVAHHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWI 420

Query: 421 EKITGVIASLLSSQAPERCLPTSPMGSGHHRSASDSSSFESSDFDHAAVEEYTSERNLTS 480
           EKITGVIASLLSSQAPERCLP SPMGS HHRSAS+SSS+ES+DFDH AVEEYTSER+  +
Sbjct: 421 EKITGVIASLLSSQAPERCLPISPMGSSHHRSASESSSYESTDFDHTAVEEYTSERSSAT 480

Query: 481 AYHERQSRGSQQQRSCVKSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSG 540
           A+HER S+G QQ RSC+KSEKPIDVLRRVCGND+CADCGAPEPDWASLNLGVLVCIECSG
Sbjct: 481 AHHERPSKGLQQIRSCIKSEKPIDVLRRVCGNDKCADCGAPEPDWASLNLGVLVCIECSG 540

Query: 541 VHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPS 600
           VHRNLGVHISKVRSLTLDVKVWEPSV+TLFQSLGN FANSVWEELLQSR+AF VDL P  
Sbjct: 541 VHRNLGVHISKVRSLTLDVKVWEPSVLTLFQSLGNTFANSVWEELLQSRNAFQVDLVPTG 600

Query: 601 LHKSDKPQLLLMGKPSHSDSISVKEKFIHAKVQYPLW 637
           L+KSDKPQL  + KPSH+DSIS+KEK+IHAK    L+
Sbjct: 601 LYKSDKPQLHFISKPSHADSISIKEKYIHAKYAEKLF 637

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224057840|ref|XP_002299350.1| predicted protein [Populus trichocarpa] gi|222846608|gb|EEE84155.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224072473|ref|XP_002303749.1| predicted protein [Populus trichocarpa] gi|222841181|gb|EEE78728.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356567188|ref|XP_003551803.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like [Glycine max] Back     alignment and taxonomy information
>gi|255543198|ref|XP_002512662.1| ATP binding protein, putative [Ricinus communis] gi|223548623|gb|EEF50114.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356523716|ref|XP_003530481.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like [Glycine max] Back     alignment and taxonomy information
>gi|449520667|ref|XP_004167355.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|297811447|ref|XP_002873607.1| hypothetical protein ARALYDRAFT_488148 [Arabidopsis lyrata subsp. lyrata] gi|297319444|gb|EFH49866.1| hypothetical protein ARALYDRAFT_488148 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|79512687|ref|NP_196834.3| ADP-ribosylation factor GTPase-activating protein AGD3 [Arabidopsis thaliana] gi|75321812|sp|Q5W7F2.1|AGD3_ARATH RecName: Full=ADP-ribosylation factor GTPase-activating protein AGD3; Short=ARF GAP AGD3; AltName: Full=Protein ARF-GAP DOMAIN 3; Short=AtAGD3; AltName: Full=Protein SCARFACE; AltName: Full=Protein VASCULAR NETWORK 3 gi|55583334|dbj|BAD69588.1| ARF-GAP [Arabidopsis thaliana] gi|332004495|gb|AED91878.1| ADP-ribosylation factor GTPase-activating protein AGD3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357502667|ref|XP_003621622.1| ADP-ribosylation factor GTPase-activating protein AGD3 [Medicago truncatula] gi|355496637|gb|AES77840.1| ADP-ribosylation factor GTPase-activating protein AGD3 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query652
TAIR|locus:2183916 827 SFC "SCARFACE" [Arabidopsis th 0.975 0.769 0.760 1.3e-256
TAIR|locus:2025850 776 AGD2 "ARF-GAP domain 2" [Arabi 0.659 0.554 0.472 9.1e-141
TAIR|locus:2197359 775 AGD4 "ARF-GAP domain 4" [Arabi 0.659 0.554 0.479 3.1e-140
DICTYBASE|DDB_G0276395 843 acapB "Arf GTPase activating p 0.464 0.359 0.270 4.1e-50
ZFIN|ZDB-GENE-050208-640 802 acap2 "ArfGAP with coiled-coil 0.131 0.107 0.545 7.7e-45
UNIPROTKB|Q96P50 834 ACAP3 "Arf-GAP with coiled-coi 0.130 0.101 0.574 1e-44
RGD|1310711625 Acap3 "ArfGAP with coiled-coil 0.130 0.136 0.574 1.5e-44
UNIPROTKB|D4AAD1 833 Acap3 "Protein Acap3" [Rattus 0.130 0.102 0.574 1.6e-43
UNIPROTKB|F1MWF6 820 ACAP3 "Uncharacterized protein 0.130 0.103 0.574 7.9e-43
UNIPROTKB|F1NGZ5 834 ACAP3 "Uncharacterized protein 0.130 0.101 0.563 4.2e-42
TAIR|locus:2183916 SFC "SCARFACE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2470 (874.5 bits), Expect = 1.3e-256, P = 1.3e-256
 Identities = 488/642 (76%), Positives = 521/642 (81%)

Query:     1 MHFNKLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALET 60
             MHF KLDDSPMFRKQ+Q +EESAE+LRERSLKFYKGCRKYTEGLGE YDGDIAFASALET
Sbjct:     1 MHFTKLDDSPMFRKQLQSMEESAEILRERSLKFYKGCRKYTEGLGEAYDGDIAFASALET 60

Query:    61 FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKE 120
             FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEH+LNDRLLQ+ N+DLHEVKE
Sbjct:    61 FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHILNDRLLQFANMDLHEVKE 120

Query:   121 ARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVE 180
             ARK FDKASL YDQAREKFLSLRKGTK+DVAA LE+ELH++RS FEQARF+LVTALSNVE
Sbjct:   121 ARKRFDKASLTYDQAREKFLSLRKGTKSDVAAALEQELHTSRSMFEQARFNLVTALSNVE 180

Query:   181 AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNER 240
             AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNE+
Sbjct:   181 AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNEK 240

Query:   241 MQEYKRQIDRESRWAXXXXXXXXXXDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLS 300
             MQEYKRQ+DRESRW           DGIQAIGRSSHKMI+AVMQSAA+GKVQTIRQGYLS
Sbjct:   241 MQEYKRQVDRESRWGSNGSNGSPNGDGIQAIGRSSHKMIDAVMQSAARGKVQTIRQGYLS 300

Query:   301 KRSSNLRGDWKRRFFVLDSRGMLYYYRKQCXXXXXXXXXXXXXXXXXXXXXXXXXX--XX 358
             KRSSNLRGDWKRRFFVLDSRGMLYYYRKQC                              
Sbjct:   301 KRSSNLRGDWKRRFFVLDSRGMLYYYRKQCSKPSGSGSQLSGQRNSSELGSGLLSRWLSS 360

Query:   359 XXHYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMD 418
               H HGGVHDEKS ARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMD
Sbjct:   361 NNHGHGGVHDEKSVARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMD 420

Query:   419 WIEKITGVIASLLSSQAPERCLPTSPMXXXXXXXXXXXXXXXXXXXXXXXVEEYTSERNL 478
             WIEKITGVIASLLSSQ PE+ LP SPM                        EE+  ER+ 
Sbjct:   421 WIEKITGVIASLLSSQVPEQRLPGSPMGSGHHRSASESSSYESSEYDHPTTEEFVCERSF 480

Query:   479 TSAYHEXXXXXXXXXXXCVKSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIEC 538
                Y+E             K EKPID LR+VCGND+CADCGAPEPDWASLNLGVLVCIEC
Sbjct:   481 LG-YNERPSRSFQPQRSIRKGEKPIDALRKVCGNDKCADCGAPEPDWASLNLGVLVCIEC 539

Query:   539 SGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTP 598
             SGVHRNLGVHISKVRSLTLDVKVWEPSVI+LFQ+LGN FAN+VWEELL SRSA H D   
Sbjct:   540 SGVHRNLGVHISKVRSLTLDVKVWEPSVISLFQALGNTFANTVWEELLHSRSAIHFD--- 596

Query:   599 PSLHKSDKPQLLLMGKPSHSDSISVKEKFIHAKVQYPLWPLR 640
             P L  SDK ++++ GKPS++D IS+KEK+I AK    L+  R
Sbjct:   597 PGLTVSDKSRVMVTGKPSYADMISIKEKYIQAKYAEKLFVRR 638
GO:0005543 "phospholipid binding" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=ISM
GO:0008060 "ARF GTPase activator activity" evidence=IEA;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0010087 "phloem or xylem histogenesis" evidence=IMP
GO:0009733 "response to auxin stimulus" evidence=IMP
GO:0009965 "leaf morphogenesis" evidence=IMP
GO:0030140 "trans-Golgi network transport vesicle" evidence=IDA
GO:0035091 "phosphatidylinositol binding" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0010051 "xylem and phloem pattern formation" evidence=RCA;IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006897 "endocytosis" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0003002 "regionalization" evidence=RCA
GO:0007155 "cell adhesion" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0009887 "organ morphogenesis" evidence=RCA
GO:0009888 "tissue development" evidence=RCA
GO:0009944 "polarity specification of adaxial/abaxial axis" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010089 "xylem development" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010638 "positive regulation of organelle organization" evidence=RCA
GO:0016049 "cell growth" evidence=RCA
GO:0033043 "regulation of organelle organization" evidence=RCA
GO:0033044 "regulation of chromosome organization" evidence=RCA
GO:0045010 "actin nucleation" evidence=RCA
GO:0045595 "regulation of cell differentiation" evidence=RCA
GO:0048439 "flower morphogenesis" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
GO:0048519 "negative regulation of biological process" evidence=RCA
GO:0048589 "developmental growth" evidence=RCA
GO:0048765 "root hair cell differentiation" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
TAIR|locus:2025850 AGD2 "ARF-GAP domain 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197359 AGD4 "ARF-GAP domain 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0276395 acapB "Arf GTPase activating protein B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-640 acap2 "ArfGAP with coiled-coil, ankyrin repeat and PH domains 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q96P50 ACAP3 "Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1310711 Acap3 "ArfGAP with coiled-coil, ankyrin repeat and PH domains 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4AAD1 Acap3 "Protein Acap3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWF6 ACAP3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGZ5 ACAP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5W7F2AGD3_ARATHNo assigned EC number0.85660.97540.7690yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query652
cd07606202 cd07606, BAR_SFC_plant, The Bin/Amphiphysin/Rvs (B 1e-108
pfam01412117 pfam01412, ArfGap, Putative GTPase activating prot 3e-42
smart00105119 smart00105, ArfGap, Putative GTP-ase activating pr 2e-36
cd1325098 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin 1e-33
cd07307194 cd07307, BAR, The Bin/Amphiphysin/Rvs (BAR) domain 2e-31
COG5347 319 COG5347, COG5347, GTPase-activating protein that r 2e-26
smart00721239 smart00721, BAR, BAR domain 6e-18
cd07603200 cd07603, BAR_ACAPs, The Bin/Amphiphysin/Rvs (BAR) 3e-15
cd07638200 cd07638, BAR_ACAP2, The Bin/Amphiphysin/Rvs (BAR) 1e-13
smart00233102 smart00233, PH, Pleckstrin homology domain 2e-12
cd07637200 cd07637, BAR_ACAP3, The Bin/Amphiphysin/Rvs (BAR) 7e-12
PLN03114 395 PLN03114, PLN03114, ADP-ribosylation factor GTPase 2e-11
pfam00169101 pfam00169, PH, PH domain 2e-11
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 3e-10
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 8e-10
cd07601215 cd07601, BAR_APPL, The Bin/Amphiphysin/Rvs (BAR) d 5e-09
cd07634207 cd07634, BAR_GAP10-like, The Bin/Amphiphysin/Rvs ( 3e-08
cd07602207 cd07602, BAR_RhoGAP_OPHN1-like, The Bin/Amphiphysi 8e-08
cd07631215 cd07631, BAR_APPL1, The Bin/Amphiphysin/Rvs (BAR) 2e-07
cd07635207 cd07635, BAR_GRAF2, The Bin/Amphiphysin/Rvs (BAR) 2e-06
cd07639200 cd07639, BAR_ACAP1, The Bin/Amphiphysin/Rvs (BAR) 2e-06
pfam03114230 pfam03114, BAR, BAR domain 3e-06
cd13288120 cd13288, PH_Ses, Sesquipedalian family Pleckstrin 1e-05
cd1328296 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology 1e-05
cd01251105 cd01251, PH2_ADAP, ArfGAP with dual PH domains Ple 1e-05
cd13296111 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P 4e-05
cd01233111 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein p 5e-05
cd13255110 cd13255, PH_TAAP2-like, Tandem PH-domain-containin 9e-05
cd13247125 cd13247, BAR-PH_APPL, Adaptor protein containing P 1e-04
cd07636207 cd07636, BAR_GRAF, The Bin/Amphiphysin/Rvs (BAR) d 1e-04
cd07632215 cd07632, BAR_APPL2, The Bin/Amphiphysin/Rvs (BAR) 2e-04
cd13269106 cd13269, PH_alsin, Alsin Pleckstrin homology (PH) 2e-04
cd07642215 cd07642, BAR_ASAP2, The Bin/Amphiphysin/Rvs (BAR) 2e-04
cd07600242 cd07600, BAR_Gvp36, The Bin/Amphiphysin/Rvs (BAR) 2e-04
cd1057396 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosin 2e-04
cd13298106 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin 3e-04
cd01218123 cd01218, PH_Phafin2-like, Phafin2 (also called EAP 5e-04
cd13266106 cd13266, PH_Skap_family, Src kinase-associated pho 5e-04
cd13301108 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin 5e-04
cd13248104 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate 6e-04
cd13292103 cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol bin 6e-04
cd13277111 cd13277, PH_Bem3, Bud emergence protein 3 (Bem3) P 6e-04
cd13271114 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing 7e-04
cd01265101 cd01265, PH_TBC1D2A, TBC1 domain family member 2A 7e-04
cd13380106 cd13380, PH_Skap1, Src kinase-associated phosphopr 0.001
cd01235106 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als 0.001
cd01250114 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat 0.001
cd13273110 cd13273, PH_SWAP-70, Switch-associated protein-70 0.002
cd13251108 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin 0.002
cd13265108 cd13265, PH_evt, Evectin Pleckstrin homology (PH) 0.003
>gnl|CDD|153290 cd07606, BAR_SFC_plant, The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC) Back     alignment and domain information 
 Score =  325 bits (835), Expect = e-108
 Identities = 139/202 (68%), Positives = 162/202 (80%)

Query: 14  KQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGGHNDPISVAF 73
           KQ+Q LE SA+ LR+RSLK YKGCRKY + LGE YDGD AFA +LE FGGGH+DPISVA 
Sbjct: 1   KQLQELEGSADELRDRSLKLYKGCRKYRDALGEAYDGDSAFAESLEEFGGGHDDPISVAV 60

Query: 74  GGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYD 133
           GGPVMTKFT ALREIG+YKEVLRSQVEHMLNDRL Q+ + DL EVK+AR+ FDKASL Y+
Sbjct: 61  GGPVMTKFTSALREIGSYKEVLRSQVEHMLNDRLAQFADTDLQEVKDARRRFDKASLDYE 120

Query: 134 QAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSG 193
           QAR KFLSL K  K ++ A  EE+L + RSAFE ARF L+  L   +A+KR EFLE +SG
Sbjct: 121 QARSKFLSLTKDAKPEILAAAEEDLGTTRSAFETARFDLMNRLHAADARKRVEFLERLSG 180

Query: 194 TMDAHLRYFKQGYELLHQMEPY 215
           +MDAHL +FK GYELL Q+EPY
Sbjct: 181 SMDAHLAFFKSGYELLRQLEPY 202

BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions including organelle biogenesis, membrane trafficking or remodeling, and cell division and migration. The plant protein SCARFACE (SFC), also called VAscular Network 3 (VAN3), is a plant ACAP (ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein), an Arf GTPase Activating Protein (GAP) that plays a role in the trafficking of auxin efflux regulators from the plasma membrane to the endosome. It is required for the normal vein patterning in leaves. SCF contains an N-terminal BAR domain, followed by a Pleckstrin Homology (PH) domain, an Arf GAP domain, and C-terminal ankyrin (ANK) repeats. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. Length = 202
>gnl|CDD|216485 pfam01412, ArfGap, Putative GTPase activating protein for Arf Back     alignment and domain information
>gnl|CDD|214518 smart00105, ArfGap, Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153271 cd07307, BAR, The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature Back     alignment and domain information
>gnl|CDD|227651 COG5347, COG5347, GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|214787 smart00721, BAR, BAR domain Back     alignment and domain information
>gnl|CDD|153287 cd07603, BAR_ACAPs, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins Back     alignment and domain information
>gnl|CDD|153322 cd07638, BAR_ACAP2, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|153321 cd07637, BAR_ACAP3, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>gnl|CDD|178661 PLN03114, PLN03114, ADP-ribosylation factor GTPase-activating protein AGD10; Provisional Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153285 cd07601, BAR_APPL, The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins Back     alignment and domain information
>gnl|CDD|153318 cd07634, BAR_GAP10-like, The Bin/Amphiphysin/Rvs (BAR) domain of Rho GTPase activating protein 10-like Back     alignment and domain information
>gnl|CDD|153286 cd07602, BAR_RhoGAP_OPHN1-like, The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins Back     alignment and domain information
>gnl|CDD|153315 cd07631, BAR_APPL1, The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 Back     alignment and domain information
>gnl|CDD|153319 cd07635, BAR_GRAF2, The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion 2 Back     alignment and domain information
>gnl|CDD|153323 cd07639, BAR_ACAP1, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>gnl|CDD|145973 pfam03114, BAR, BAR domain Back     alignment and domain information
>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241266 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241401 cd13247, BAR-PH_APPL, Adaptor protein containing PH domain, PTB domain, and Leucine zipper motif Bin1/amphiphysin/Rvs167 (BAR)-Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153320 cd07636, BAR_GRAF, The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion kinase Back     alignment and domain information
>gnl|CDD|153316 cd07632, BAR_APPL2, The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 2 Back     alignment and domain information
>gnl|CDD|241423 cd13269, PH_alsin, Alsin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153326 cd07642, BAR_ASAP2, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>gnl|CDD|153284 cd07600, BAR_Gvp36, The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Golgi vesicle protein of 36 kDa and similar proteins Back     alignment and domain information
>gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and 3-Phosphoinositides Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241253 cd01218, PH_Phafin2-like, Phafin2 (also called EAPF, FLJ13187, ZFYVE18 or PLEKHF2) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241420 cd13266, PH_Skap_family, Src kinase-associated phosphoprotein family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241446 cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol binding protein homologs 1 and 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241431 cd13277, PH_Bem3, Bud emergence protein 3 (Bem3) Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat Back     alignment and domain information
>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241531 cd13380, PH_Skap1, Src kinase-associated phosphoprotein 1 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241281 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat and PH domain-containing protein Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241405 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 652
KOG0521 785 consensus Putative GTPase activating proteins (GAP 100.0
KOG1451 812 consensus Oligophrenin-1 and related Rho GTPase-ac 100.0
KOG0705 749 consensus GTPase-activating protein Centaurin gamm 100.0
cd07606202 BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain 100.0
cd07603200 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07601215 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of A 100.0
cd07602207 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR 100.0
cd07636207 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of G 100.0
cd07637200 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07638200 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07633207 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07634207 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domai 100.0
cd07639200 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
KOG0703 287 consensus Predicted GTPase-activating protein [Sig 100.0
cd07635207 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
PF01412116 ArfGap: Putative GTPase activating protein for Arf 100.0
cd07631215 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
smart00105112 ArfGap Putative GTP-ase activating proteins for th 100.0
cd07632215 BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07641215 BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07604215 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07642215 BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of 99.97
cd07640213 BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of 99.97
PLN03119 648 putative ADP-ribosylation factor GTPase-activating 99.97
COG5347 319 GTPase-activating protein that regulates ARFs (ADP 99.97
PLN03131 705 hypothetical protein; Provisional 99.97
cd07609214 BAR_SIP3_fungi The Bin/Amphiphysin/Rvs (BAR) domai 99.96
KOG1117 1186 consensus Rho- and Arf-GTPase activating protein A 99.93
PLN03114 395 ADP-ribosylation factor GTPase-activating protein 99.92
KOG0706 454 consensus Predicted GTPase-activating protein [Sig 99.91
KOG0704 386 consensus ADP-ribosylation factor GTPase activator 99.91
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 99.91
cd07307194 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimeri 99.82
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.75
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.74
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.73
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.72
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.7
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.68
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.67
smart00721239 BAR BAR domain. 99.66
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.66
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.65
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.63
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 99.63
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.62
PF03114229 BAR: BAR domain; InterPro: IPR004148 Endocytosis a 99.61
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.6
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.59
cd07594229 BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) dom 99.59
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.58
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.55
cd07593215 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) dom 99.52
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.52
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.51
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.5
cd07615223 BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) do 99.5
cd07616229 BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) do 99.49
cd07614223 BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) do 99.49
cd07592223 BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) dom 99.48
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.48
cd07595244 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) 99.46
cd07608192 BAR_ArfGAP_fungi The Bin/Amphiphysin/Rvs (BAR) dom 99.46
cd07613223 BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) do 99.43
KOG0702 524 consensus Predicted GTPase-activating protein [Sig 99.43
cd07617220 BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) do 99.42
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.4
PF1540989 PH_8: Pleckstrin homology domain 99.38
KOG0930395 consensus Guanine nucleotide exchange factor Cytoh 99.37
cd07618246 BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of 99.37
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.37
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.33
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 99.32
cd07619248 BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of 99.31
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 99.28
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 99.23
cd07600242 BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of 99.23
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 99.22
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 99.19
KOG4424623 consensus Predicted Rho/Rac guanine nucleotide exc 99.13
cd07590225 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of B 99.11
KOG3725375 consensus SH3 domain protein SH3GLB [Signal transd 99.1
cd07620257 BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of 99.09
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 99.06
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 99.03
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 99.02
KOG1118366 consensus Lysophosphatidic acid acyltransferase en 98.96
cd07591224 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain o 98.94
KOG0690 516 consensus Serine/threonine protein kinase [Signal 98.93
cd00011203 BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) do 98.86
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 98.86
cd07588211 BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) doma 98.85
cd07599216 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain o 98.82
PF06456229 Arfaptin: Arfaptin-like domain; InterPro: IPR01050 98.79
PF08397219 IMD: IRSp53/MIM homology domain; InterPro: IPR0136 98.77
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 98.77
cd07598211 BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of 98.77
PF10455289 BAR_2: Bin/amphiphysin/Rvs domain for vesicular tr 98.76
cd07660201 BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain 98.76
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 98.68
cd07611211 BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) 98.67
cd07612211 BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of B 98.64
cd07659215 BAR_PICK1 The Bin/Amphiphysin/Rvs (BAR) domain of 98.64
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 98.46
cd07596218 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So 98.42
cd07628185 BAR_Atg24p The Bin/Amphiphysin/Rvs (BAR) domain of 98.39
cd07605223 I-BAR_IMD Inverse (I)-BAR, also known as the IRSp5 98.38
PF09325236 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp 98.38
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 98.38
KOG10901732 consensus Predicted dual-specificity phosphatase [ 98.36
cd07624200 BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain o 98.31
cd07661204 BAR_ICA69 The Bin/Amphiphysin/Rvs (BAR) domain of 98.3
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 98.25
cd07589195 BAR_DNMBP The Bin/Amphiphysin/Rvs (BAR) domain of 98.21
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 98.19
cd07623224 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of 98.16
cd07664234 BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of S 98.14
cd07627216 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of 98.14
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 98.1
KOG3771460 consensus Amphiphysin [Intracellular trafficking, 98.08
PF06730219 FAM92: FAM92 protein; InterPro: IPR009602 This fam 98.03
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 98.02
cd07665234 BAR_SNX1 The Bin/Amphiphysin/Rvs (BAR) domain of S 98.0
KOG36401116 consensus Actin binding protein Anillin [Cell cycl 97.97
cd07622201 BAR_SNX4 The Bin/Amphiphysin/Rvs (BAR) domain of S 97.97
cd07646232 I-BAR_IMD_IRSp53 Inverse (I)-BAR, also known as th 97.87
PTZ00267478 NIMA-related protein kinase; Provisional 97.85
cd07629187 BAR_Atg20p The Bin/Amphiphysin/Rvs (BAR) domain of 97.85
KOG3751622 consensus Growth factor receptor-bound proteins (G 97.76
KOG0932774 consensus Guanine nucleotide exchange factor EFA6 97.72
KOG2059800 consensus Ras GTPase-activating protein [Signal tr 97.71
cd07667240 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of 97.71
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 97.69
cd07644215 I-BAR_IMD_BAIAP2L2 Inverse (I)-BAR, also known as 97.67
cd07630198 BAR_SNX_like The Bin/Amphiphysin/Rvs (BAR) domain 97.67
cd07625230 BAR_Vps17p The Bin/Amphiphysin/Rvs (BAR) domain of 97.66
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 97.62
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 97.56
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 97.56
KOG3876341 consensus Arfaptin and related proteins [Signal tr 97.55
cd07662218 BAR_SNX6 The Bin/Amphiphysin/Rvs (BAR) domain of S 97.53
cd07621219 BAR_SNX5_6 The Bin/Amphiphysin/Rvs (BAR) domain of 97.53
cd07663218 BAR_SNX5 The Bin/Amphiphysin/Rvs (BAR) domain of S 97.49
cd07653251 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B 97.47
cd07645226 I-BAR_IMD_BAIAP2L1 Inverse (I)-BAR, also known as 97.38
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 97.35
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 97.27
PTZ00283496 serine/threonine protein kinase; Provisional 97.26
cd07643231 I-BAR_IMD_MIM Inverse (I)-BAR, also known as the I 97.25
cd07666243 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S 97.14
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 97.13
KOG0248 936 consensus Cytoplasmic protein Max-1, contains PH, 97.1
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 97.04
cd07648261 F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Am 97.03
cd07674261 F-BAR_FCHO1 The F-BAR (FES-CIP4 Homology and Bin/A 97.01
cd07607209 BAR_SH3P_plant The Bin/Amphiphysin/Rvs (BAR) domai 97.01
cd07651236 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology 97.0
KOG3723851 consensus PH domain protein Melted [Signal transdu 97.0
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 96.95
PLN02866 1068 phospholipase D 96.84
KOG0521785 consensus Putative GTPase activating proteins (GAP 96.84
cd07610191 FCH_F-BAR The Extended FES-CIP4 Homology (FCH) or 96.77
cd07658239 F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin 96.72
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 96.7
cd07649233 F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Am 96.6
cd07626199 BAR_SNX9_like The Bin/Amphiphysin/Rvs (BAR) domain 96.58
cd07676253 F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/A 96.54
cd07597246 BAR_SNX8 The Bin/Amphiphysin/Rvs (BAR) domain of S 96.5
KOG1739 611 consensus Serine/threonine protein kinase GPBP [Si 96.4
KOG3651429 consensus Protein kinase C, alpha binding protein 96.4
cd07650228 F-BAR_Syp1p_like The F-BAR (FES-CIP4 Homology and 96.38
cd07637200 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of 96.36
cd07638200 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of 96.12
cd07647239 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/ 96.1
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 96.07
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 95.9
cd07655258 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/ 95.88
cd07673269 F-BAR_FCHO2 The F-BAR (FES-CIP4 Homology and Bin/A 95.81
cd07639200 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of 95.66
cd07635207 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of 95.58
cd07657237 F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin 95.42
cd07675252 F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/ 95.32
cd07671242 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin 95.32
KOG3891436 consensus Secretory vesicle-associated protein ICA 95.29
KOG2273503 consensus Membrane coat complex Retromer, subunit 95.29
cd07636207 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of G 95.28
PF10456237 BAR_3_WASP_bdg: WASP-binding domain of Sorting nex 95.22
cd07652234 F-BAR_Rgd1 The F-BAR (FES-CIP4 Homology and Bin/Am 95.22
KOG35311036 consensus Rho guanine nucleotide exchange factor C 94.97
PF15406112 PH_6: Pleckstrin homology domain 94.91
cd07680258 F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin 94.89
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 94.86
KOG1117 1186 consensus Rho- and Arf-GTPase activating protein A 94.65
cd07681258 F-BAR_PACSIN3 The F-BAR (FES-CIP4 Homology and Bin 94.57
cd07685237 F-BAR_Fes The F-BAR (FES-CIP4 Homology and Bin/Amp 94.5
cd07603200 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of 94.42
cd07669207 BAR_SNX33 The Bin/Amphiphysin/Rvs (BAR) domain of 94.25
cd07668210 BAR_SNX9 The Bin/Amphiphysin/Rvs (BAR) domain of S 93.73
PF03114229 BAR: BAR domain; InterPro: IPR004148 Endocytosis a 93.39
cd07672240 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin 93.31
PF15404185 PH_4: Pleckstrin homology domain 93.08
KOG3543 1218 consensus Ca2+-dependent activator protein [Signal 92.86
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 92.79
cd07670207 BAR_SNX18 The Bin/Amphiphysin/Rvs (BAR) domain of 92.71
KOG2070661 consensus Guanine nucleotide exchange factor [Nucl 92.58
KOG2996 865 consensus Rho guanine nucleotide exchange factor V 92.26
KOG1451 812 consensus Oligophrenin-1 and related Rho GTPase-ac 92.02
smart00721239 BAR BAR domain. 91.84
cd07656241 F-BAR_srGAP The F-BAR (FES-CIP4 Homology and Bin/A 91.76
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 91.57
cd07602207 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR 91.37
KOG1737 799 consensus Oxysterol-binding protein [Lipid transpo 91.24
KOG2856472 consensus Adaptor protein PACSIN [Signal transduct 90.02
cd07604215 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of 89.78
KOG35311036 consensus Rho guanine nucleotide exchange factor C 89.65
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 88.94
cd07631215 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of 88.83
cd01248115 PH_PLC Phospholipase C (PLC) pleckstrin homology ( 87.15
cd07601215 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of A 86.31
cd07590225 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of B 86.2
PF15408104 PH_7: Pleckstrin homology domain 85.77
PF08458110 PH_2: Plant pleckstrin homology-like region; Inter 85.57
cd07679258 F-BAR_PACSIN2 The F-BAR (FES-CIP4 Homology and Bin 85.56
cd07634207 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domai 85.26
KOG3523695 consensus Putative guanine nucleotide exchange fac 83.93
cd07633207 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of 83.84
cd07307194 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimeri 83.43
PF04740204 LXG: LXG domain of WXG superfamily; InterPro: IPR0 82.15
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-74  Score=659.59  Aligned_cols=522  Identities=43%  Similarity=0.634  Sum_probs=427.2

Q ss_pred             CCCccCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcccchHHHHHHHHHHhh-CCCCCCCccccCchhHHH
Q 006276            2 HFNKLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFG-GGHNDPISVAFGGPVMTK   80 (652)
Q Consensus         2 ~~~~~~DSP~FRasv~~~E~~le~l~~~l~kl~K~~kk~~~~~~~~~~~~~~f~~~L~~f~-~~~~d~~~~~~~g~~L~~   80 (652)
                      +++|+.|||+||+++..+|+++..+++.++++++.+....++-.++..+.+.|...+..+. -+ .|+...   +++|.+
T Consensus         9 ~~e~lkdsp~fr~~~~~~ee~~~~~~~~l~k~~~~~~~~~~~~~~~~~~~~~f~~~~~d~~~~~-~~~~~~---~~~l~~   84 (785)
T KOG0521|consen    9 AEEFLKDSPQFRSTLDVFEEDAGTLEKYLNKLLKAMTRKYDAGKEFVQATEQFGKGLKDLFSLG-QDEEVI---SETLQK   84 (785)
T ss_pred             hHHHhhcChhHHHHHHHHHHHHHhhhhhHHHHHHHHHhhhcccHHHHHHHHHHHHHHHHHHHhc-cCchhh---hhHHHH
Confidence            4678999999999999999999999999999999999877765666666677777775553 23 332222   458999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHhccccCCChhhHhHHHHHHHH
Q 006276           81 FTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHS  160 (652)
Q Consensus        81 f~~~lkel~~~~~~l~~~~~~~i~~pL~~f~~~di~~~ke~Rk~Fek~~~~YD~al~ky~s~~K~k~~~~~~E~~~eL~~  160 (652)
                      |+..+.|+..++..|..++++.+..||.+|++.||.++++.|++|++++++||.++.||.+++|++.+....|.+++|..
T Consensus        85 fs~~~~e~~~~~~~L~~q~~~~~~~~l~~f~k~dl~~v~~~kk~f~ka~~~~d~a~~k~~~l~k~~~~~~~~e~~~~l~~  164 (785)
T KOG0521|consen   85 FSKVLRELGTYHTELRSQLAHTLSLPLSQFVKGDLHEVKELKKLFEKASEEYDLALVKYSRLPKKRRSKVKTEVEEELAA  164 (785)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHhhhhhHHHHHHHhhHHHHHHHhhhhhhccccchhHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999876667788889999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHhHHHHHHHHHH
Q 006276          161 ARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNER  240 (652)
Q Consensus       161 ~Rk~f~~aslDyv~~l~~l~~~k~~e~le~l~~~~~aq~~ff~~g~e~~~~l~~~l~el~~~lq~~r~~~~~~~~~l~~~  240 (652)
                      +|++|++++|||+..|+.++.++++++|+.+++||+||..||++|++++.+++||++.+..++++++.+++.+++.++++
T Consensus       165 ~r~~f~~~~~~y~~~ln~~q~kk~~~~le~~l~~~~aq~~fF~~g~~l~~~m~p~~~~i~~~v~ql~~~~~~e~~am~~~  244 (785)
T KOG0521|consen  165 ARRKFQLTALDYVLALNVLQAKKQFEILETLLGFMHAQINFFKQGEDLLSQMDPYIKKVATYVQQLREESDAEQRAMEQR  244 (785)
T ss_pred             HHHHHHHHHHHHHHhhhhhhcccchHHHHHHHHHHHhccchhcccHhHHhhhhHHHHHHHHHHHHHHHhhHHHHHHHHhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhhhhhhhcCCCCCCCCCCCCcccccCCchhhHHHHHhhhccCCCceeeeEEEeccCCCCCCCceeEEEEEecC
Q 006276          241 MQEYKRQIDRESRWASNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRFFVLDSR  320 (652)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~k~G~L~K~~~~~~~~WkrR~f~L~~~  320 (652)
                      ++.+..+.+.+.+.-  .....|.++                     .........|||+++.++..+.|+||||.++ +
T Consensus       245 ~q~l~~~~~~~~~~~--~~~~~~~~~---------------------~~~~~~~~~~~l~~k~~~~~~tw~r~~f~~q-~  300 (785)
T KOG0521|consen  245 YQELRSASNLESRPK--SDSASPSGG---------------------NLKLGYRMEGYLRKKASNASKTWKRRWFSIQ-D  300 (785)
T ss_pred             HHHHHHHhhhhhhcc--ccccccccc---------------------cccchhhhhhhhhhhcccchhhHHhhhhhhh-c
Confidence            988877665444431  111112211                     1122345689999999888899999999998 5


Q ss_pred             ceEEEEecCCCCCCCCCCCcccccCcccccccccccccccccCCCCCCccccccceeecccceeeeCCCCCCCcccEEEE
Q 006276          321 GMLYYYRKQCSKSSGSGSQLSSQRNSSELGSGLLSRWLSSHYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRII  400 (652)
Q Consensus       321 g~l~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~i~l~~~~vk~~~~~~~rrfcF~I~  400 (652)
                      +.+.|.......                               +        .....+|++|.|++.++..++||||+|+
T Consensus       301 ~~l~~~~r~~~~-------------------------------~--------~~~~~dL~~csvk~~~~~~drr~CF~ii  341 (785)
T KOG0521|consen  301 GQLGYQHRGADA-------------------------------E--------NVLIEDLRTCSVKPDAEQRDRRFCFEII  341 (785)
T ss_pred             cccccccccccc-------------------------------c--------ccccccchhccccCCcccccceeeEEEe
Confidence            555544332210                               0        0234678999999988777999999999


Q ss_pred             eCCeeEEEEeCCHHHHHHHHHHHHHHHHHhhccCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCcccchhhccccccc
Q 006276          401 SPTKNYTLQAESALDQMDWIEKITGVIASLLSSQAPERCLPT-SPMGSGHHRSASDSSSFESSDFDHAAVEEYTSERNLT  479 (652)
Q Consensus       401 t~~r~~~lqA~se~e~~~Wi~ai~~ai~~~l~~~~~~~~~~~-~~~~~~~~~~~s~~~s~~~~~~~~~~~~~~~~~~~~~  479 (652)
                      +|+++|+|||+|+.|..+||.+|+++|..+++...++..... +..+.+...+++. .+.++.        .....    
T Consensus       342 S~tks~~lQAes~~d~~~Wi~~i~nsi~s~l~~~~~~~~~~~~~~~~~~~~~~~s~-~~~~s~--------~~s~~----  408 (785)
T KOG0521|consen  342 SPTKSYLLQAESEKDCQDWISALQNSILSALNSAFLGQDSTGGRNTQSGHSSSASY-STITSA--------NTSRE----  408 (785)
T ss_pred             cCCcceEEecCchhHHHHHHHHHHHHHHHHHhccCcccccccCCCccccccccccc-cccccc--------ccccc----
Confidence            999999999999999999999999999999998776543221 1111111111110 000000        00000    


Q ss_pred             cccccccccccchhccccCcccHHHHHHccCCCCccccCCCCCCCceeeccceeeeccchhhhcccCCCccceeEeecCC
Q 006276          480 SAYHERQSRGSQQQRSCVKSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDV  559 (652)
Q Consensus       480 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~N~~C~dC~~~~p~w~s~~~gv~~C~~Cs~~Hr~lg~~is~vks~~ld~  559 (652)
                                     ...+..-++..++..|||..|+|||++.|+|+++|+||.+||+|+|+||+||+|+|||+||+|| 
T Consensus       409 ---------------~~~~~~~~~~~vq~~pgN~~c~Dcg~p~ptw~S~NLgv~~CIecSGvhRslGvh~SkvrsLtLD-  472 (785)
T KOG0521|consen  409 ---------------RLNKGISVIEEVQSVPGNAQCCDCGAPEPTWASINLGVLLCIECSGVHRSLGVHISKVRSLTLD-  472 (785)
T ss_pred             ---------------ccccCcchhhhhhcCCchhhhhhcCCCCCchHhhhhchhhHhhccccccccCchhhhhhhhhhh-
Confidence                           0011122577889999999999999999999999999999999999999999999999999999 


Q ss_pred             CCCCHHHHHHHHHhchHHHHHHHHhhcccccccccCCCCCCCCCCCcchhhccCCCCCCCCHHHHHHHHHHhhcCCCCcc
Q 006276          560 KVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHSDSISVKEKFIHAKVQYPLWPL  639 (652)
Q Consensus       560 ~~w~~~~i~~~~~~GN~~~n~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~i~~kY~~~~f~~  639 (652)
                       .|+++.+.+++.+||..+|.|||+.+++-.                     ..+|.+..++..|+.||++||++++|..
T Consensus       473 -~~~~~l~~l~~~lgn~~~N~i~e~~l~~~~---------------------~~~~~~~~~~~~r~~~i~~kyve~~F~~  530 (785)
T KOG0521|consen  473 -VWEPELLLLFKNLGNKYVNEIYEALLPSYD---------------------SSKPTASSSRQAREAWIKAKYVERRFSV  530 (785)
T ss_pred             -ccCcHHHHHHHHhCcchhhhhhhccccccc---------------------ccCCCCccchhhhhHhhhcccceeeEee
Confidence             699999999999999999999999999721                     3688888889999999999999999976


Q ss_pred             CC
Q 006276          640 RF  641 (652)
Q Consensus       640 ~~  641 (652)
                      .-
T Consensus       531 k~  532 (785)
T KOG0521|consen  531 KE  532 (785)
T ss_pred             cc
Confidence            53

>KOG1451 consensus Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>cd07606 BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC) Back     alignment and domain information
>cd07603 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins Back     alignment and domain information
>cd07601 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins Back     alignment and domain information
>cd07602 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins Back     alignment and domain information
>cd07636 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion kinase Back     alignment and domain information
>cd07637 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>cd07638 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>cd07633 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin-1 Back     alignment and domain information
>cd07634 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domain of Rho GTPase activating protein 10-like Back     alignment and domain information
>cd07639 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>KOG0703 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd07635 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion 2 Back     alignment and domain information
>PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] Back     alignment and domain information
>cd07631 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 Back     alignment and domain information
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>cd07632 BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 2 Back     alignment and domain information
>cd07641 BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>cd07604 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing proteins Back     alignment and domain information
>cd07642 BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>cd07640 BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional Back     alignment and domain information
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03131 hypothetical protein; Provisional Back     alignment and domain information
>cd07609 BAR_SIP3_fungi The Bin/Amphiphysin/Rvs (BAR) domain of fungal Snf1p-interacting protein 3 Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional Back     alignment and domain information
>KOG0706 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0704 consensus ADP-ribosylation factor GTPase activator [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>cd07307 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>smart00721 BAR BAR domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>PF03114 BAR: BAR domain; InterPro: IPR004148 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd07594 BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd07593 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) domain of Schizosaccharomyces pombe Meiotically Up-regulated Gene 137 protein and similar proteins Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd07615 BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A3 Back     alignment and domain information
>cd07616 BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B1 Back     alignment and domain information
>cd07614 BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A2 Back     alignment and domain information
>cd07592 BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>cd07595 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) domain of Rich-like Rho GTPase Activating Proteins Back     alignment and domain information
>cd07608 BAR_ArfGAP_fungi The Bin/Amphiphysin/Rvs (BAR) domain of uncharacterized fungal Arf GAP proteins Back     alignment and domain information
>cd07613 BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A1 Back     alignment and domain information
>KOG0702 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd07617 BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B2 Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07618 BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 1 Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd07619 BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 2 Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07600 BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Golgi vesicle protein of 36 kDa and similar proteins Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] Back     alignment and domain information
>cd07590 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 3 Back     alignment and domain information
>KOG3725 consensus SH3 domain protein SH3GLB [Signal transduction mechanisms] Back     alignment and domain information
>cd07620 BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of SH3-domain Binding Protein 1 Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG1118 consensus Lysophosphatidic acid acyltransferase endophilin/SH3GL, involved in synaptic vesicle formation [Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd07591 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 161 and similar proteins Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00011 BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-like proteins, a dimerization module that binds and bends membranes Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd07588 BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysins Back     alignment and domain information
>cd07599 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 167 and similar proteins Back     alignment and domain information
>PF06456 Arfaptin: Arfaptin-like domain; InterPro: IPR010504 Arfaptin interacts with ARF1, a small GTPase involved in vesicle budding at the Golgi complex and immature secretory granules Back     alignment and domain information
>PF08397 IMD: IRSp53/MIM homology domain; InterPro: IPR013606 The IMD (IRSp53 and MIM (missing in metastases) homology) domain is a BAR-like domain of approximately 250 amino acids found at the N-terminal in the insulin receptor tyrosine kinase substrate p53 (IRSp53) and in the evolutionarily related IRSp53/MIM family Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>cd07598 BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of Family with sequence similarity 92 (FAM92) Back     alignment and domain information
>PF10455 BAR_2: Bin/amphiphysin/Rvs domain for vesicular trafficking; InterPro: IPR018859 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment Back     alignment and domain information
>cd07660 BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd07611 BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysin I and II Back     alignment and domain information
>cd07612 BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 2 Back     alignment and domain information
>cd07659 BAR_PICK1 The Bin/Amphiphysin/Rvs (BAR) domain of Protein Interacting with C Kinase 1 Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins Back     alignment and domain information
>cd07628 BAR_Atg24p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Atg24p Back     alignment and domain information
>cd07605 I-BAR_IMD Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), a dimerization module that binds and bends membranes Back     alignment and domain information
>PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] Back     alignment and domain information
>cd07624 BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 7 and 30 Back     alignment and domain information
>cd07661 BAR_ICA69 The Bin/Amphiphysin/Rvs (BAR) domain of Islet Cell Autoantigen 69-kDa Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>cd07589 BAR_DNMBP The Bin/Amphiphysin/Rvs (BAR) domain of Dynamin Binding Protein Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07623 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 1 and 2 Back     alignment and domain information
>cd07664 BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 2 Back     alignment and domain information
>cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3771 consensus Amphiphysin [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06730 FAM92: FAM92 protein; InterPro: IPR009602 This family consists of several eukaryotic sequences of around 270 residues in length Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07665 BAR_SNX1 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 1 Back     alignment and domain information
>KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>cd07622 BAR_SNX4 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 4 Back     alignment and domain information
>cd07646 I-BAR_IMD_IRSp53 Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Insulin Receptor tyrosine kinase Substrate p53 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07629 BAR_Atg20p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Atg20p Back     alignment and domain information
>KOG3751 consensus Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0932 consensus Guanine nucleotide exchange factor EFA6 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd07667 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 30 Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd07644 I-BAR_IMD_BAIAP2L2 Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2-Like 2 Back     alignment and domain information
>cd07630 BAR_SNX_like The Bin/Amphiphysin/Rvs (BAR) domain of uncharacterized Sorting Nexins Back     alignment and domain information
>cd07625 BAR_Vps17p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps17p Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3876 consensus Arfaptin and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd07662 BAR_SNX6 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 6 Back     alignment and domain information
>cd07621 BAR_SNX5_6 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 5 and 6 Back     alignment and domain information
>cd07663 BAR_SNX5 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 5 Back     alignment and domain information
>cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins Back     alignment and domain information
>cd07645 I-BAR_IMD_BAIAP2L1 Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2-Like 1 Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07643 I-BAR_IMD_MIM Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Missing In Metastasis Back     alignment and domain information
>cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7 Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd07648 F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only proteins Back     alignment and domain information
>cd07674 F-BAR_FCHO1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 1 protein Back     alignment and domain information
>cd07607 BAR_SH3P_plant The Bin/Amphiphysin/Rvs (BAR) domain of the plant SH3 domain-containing proteins Back     alignment and domain information
>cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins Back     alignment and domain information
>KOG3723 consensus PH domain protein Melted [Signal transduction mechanisms] Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>cd07610 FCH_F-BAR The Extended FES-CIP4 Homology (FCH) or F-BAR (FCH and Bin/Amphiphysin/Rvs) domain, a dimerization module that binds and bends membranes Back     alignment and domain information
>cd07658 F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Nitric Oxide Synthase TRaffic INducer (NOSTRIN) Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>cd07649 F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Growth Arrest Specific protein 7 Back     alignment and domain information
>cd07626 BAR_SNX9_like The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 9 and Similar Proteins Back     alignment and domain information
>cd07676 F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 17 Back     alignment and domain information
>cd07597 BAR_SNX8 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 8 Back     alignment and domain information
>KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms] Back     alignment and domain information
>KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd07650 F-BAR_Syp1p_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of yeast Syp1 protein Back     alignment and domain information
>cd07637 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>cd07638 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>cd07647 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Proteins Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07655 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>cd07673 F-BAR_FCHO2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 2 protein Back     alignment and domain information
>cd07639 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>cd07635 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion 2 Back     alignment and domain information
>cd07657 F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) and Fer (Fes related) tyrosine kinases Back     alignment and domain information
>cd07675 F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 1-Like Back     alignment and domain information
>cd07671 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>KOG3891 consensus Secretory vesicle-associated protein ICA69, contains Arfaptin domain [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2273 consensus Membrane coat complex Retromer, subunit VPS5/SNX1, Sorting nexins, and related PX domain-containing proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07636 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion kinase Back     alignment and domain information
>PF10456 BAR_3_WASP_bdg: WASP-binding domain of Sorting nexin protein; InterPro: IPR019497 The C-terminal region of the Sorting nexin group of proteins appears to carry a BAR-like (Bin/amphiphysin/Rvs) domain Back     alignment and domain information
>cd07652 F-BAR_Rgd1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Saccharomyces cerevisiae Rho GTPase activating protein Rgd1 and similar proteins Back     alignment and domain information
>KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>cd07680 F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd07681 F-BAR_PACSIN3 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) Back     alignment and domain information
>cd07685 F-BAR_Fes The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) tyrosine kinase Back     alignment and domain information
>cd07603 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins Back     alignment and domain information
>cd07669 BAR_SNX33 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 33 Back     alignment and domain information
>cd07668 BAR_SNX9 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 9 Back     alignment and domain information
>PF03114 BAR: BAR domain; InterPro: IPR004148 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment Back     alignment and domain information
>cd07672 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 2 Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>KOG3543 consensus Ca2+-dependent activator protein [Signal transduction mechanisms] Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07670 BAR_SNX18 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 18 Back     alignment and domain information
>KOG2070 consensus Guanine nucleotide exchange factor [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2996 consensus Rho guanine nucleotide exchange factor VAV3 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1451 consensus Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms] Back     alignment and domain information
>smart00721 BAR BAR domain Back     alignment and domain information
>cd07656 F-BAR_srGAP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Slit-Robo GTPase Activating Proteins Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>cd07602 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins Back     alignment and domain information
>KOG1737 consensus Oxysterol-binding protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG2856 consensus Adaptor protein PACSIN [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd07604 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing proteins Back     alignment and domain information
>KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>cd07631 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 Back     alignment and domain information
>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07601 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins Back     alignment and domain information
>cd07590 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 3 Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function Back     alignment and domain information
>cd07679 F-BAR_PACSIN2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 2 (PACSIN2) Back     alignment and domain information
>cd07634 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domain of Rho GTPase activating protein 10-like Back     alignment and domain information
>KOG3523 consensus Putative guanine nucleotide exchange factor TIM [Signal transduction mechanisms] Back     alignment and domain information
>cd07633 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin-1 Back     alignment and domain information
>cd07307 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature Back     alignment and domain information
>PF04740 LXG: LXG domain of WXG superfamily; InterPro: IPR006829 This group of putative transposases is found in Gram-positive bacteria, mostly Bacillus members and is thought to be a Cytosolic protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query652
3t9k_A 390 Crystal Structure Of Acap1 C-portion Mutant S554d F 3e-22
3jue_A 368 Crystal Structure Of Arfgap And Ank Repeat Domain O 4e-22
4f1p_A 368 Crystal Structure Of Mutant S554d For Arfgap And An 4e-22
1dcq_A 278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 3e-20
3fm8_C 392 Crystal Structure Of Full Length Centaurin Alpha-1 2e-17
3feh_A 386 Crystal Structure Of Full Length Centaurin Alpha-1 2e-17
3lvq_E 497 The Crystal Structure Of Asap3 In Complex With Arf6 7e-17
2b0o_E 301 Crystal Structure Of Uplc1 Gap Domain Length = 301 8e-17
2iqj_A134 Crystal Structure Of The Gap Domain Of Smap1l (Loc6 1e-16
2crr_A141 Solution Structure Of Arfgap Domain From Human Smap 1e-15
2p57_A144 Gap Domain Of Znf289, An Id1-Regulated Zinc Finger 4e-14
3sub_A163 Crystal Structure Of The Catalytic Domain Of Plasmo 8e-14
2crw_A149 Solution Structure Of The Arfgap Domain Of Adp-Ribo 8e-14
3o47_A 329 Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le 1e-11
3dwd_A147 Crystal Structure Of The Arfgap Domain Of Human Arf 2e-11
2q13_A385 Crystal Structure Of Bar-Ph Domain Of Appl1 Length 5e-09
2owa_A138 Crystal Structure Of Putative Gtpase Activating Pro 2e-08
2elb_A396 Crystal Structure Of The Bar-Ph Domain Of Human App 5e-08
2z0o_A387 Crystal Structure Of Appl1-Bar-Ph Domain Length = 3 6e-08
2z0n_A280 Crystal Structure Of Appl1-Bar Domain Length = 280 2e-07
2q12_A265 Crystal Structure Of Bar Domain Of Appl1 Length = 2 4e-07
2olm_A140 Arfgap Domain Of Hiv-1 Rev Binding Protein Length = 2e-05
2d9l_A134 Solution Structure Of The Arfgap Domain Of Human Ri 2e-04
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure 
Iteration: 1

 Score =  103 bits (257), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/126 (42%), Positives = 73/126 (57%), Gaps = 23/126 (18%)
Query: 506 LRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPS 565
           ++ V GN +C DC  P P+WAS+NLGV +CI+CSG+HR+LGVH SKVRSLTLD   WEP 
Sbjct: 39  VQSVDGNAQCCDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLD--SWEPE 96
Query: 566 VITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHSDSISVKE 625
           ++ L   LGN   N ++E  +++                     + + KP  S S   KE
Sbjct: 97  LVKLMCELGNVIINQIYEARVEA---------------------MAVKKPGPSCSRQEKE 135
Query: 626 KFIHAK 631
            +IHAK
Sbjct: 136 AWIHAK 141
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|3FM8|C Chain C, Crystal Structure Of Full Length Centaurin Alpha-1 Bound With The Fha Domain Of Kif13b (Capri Target) Length = 392 Back     alignment and structure
>pdb|3FEH|A Chain A, Crystal Structure Of Full Length Centaurin Alpha-1 Length = 386 Back     alignment and structure
>pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Length = 497 Back     alignment and structure
>pdb|2B0O|E Chain E, Crystal Structure Of Uplc1 Gap Domain Length = 301 Back     alignment and structure
>pdb|2IQJ|A Chain A, Crystal Structure Of The Gap Domain Of Smap1l (Loc64744) Stromal Membrane-Associated Protein 1-Like Length = 134 Back     alignment and structure
>pdb|2CRR|A Chain A, Solution Structure Of Arfgap Domain From Human Smap1 Length = 141 Back     alignment and structure
>pdb|2P57|A Chain A, Gap Domain Of Znf289, An Id1-Regulated Zinc Finger Protein Length = 144 Back     alignment and structure
>pdb|3SUB|A Chain A, Crystal Structure Of The Catalytic Domain Of Plasmodium Falciparum Arf Gtpase Activating Protein Length = 163 Back     alignment and structure
>pdb|2CRW|A Chain A, Solution Structure Of The Arfgap Domain Of Adp-Ribosylation Factor Gtpaseactivating Protein 3 (Arfgap 3) Length = 149 Back     alignment and structure
>pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 Back     alignment and structure
>pdb|3DWD|A Chain A, Crystal Structure Of The Arfgap Domain Of Human Arfgap1 Length = 147 Back     alignment and structure
>pdb|2Q13|A Chain A, Crystal Structure Of Bar-Ph Domain Of Appl1 Length = 385 Back     alignment and structure
>pdb|2OWA|A Chain A, Crystal Structure Of Putative Gtpase Activating Protein For Adp Ribosylation Factor From Cryptosporidium Parvum (Cgd5_1040) Length = 138 Back     alignment and structure
>pdb|2ELB|A Chain A, Crystal Structure Of The Bar-Ph Domain Of Human Appl1 Length = 396 Back     alignment and structure
>pdb|2Z0O|A Chain A, Crystal Structure Of Appl1-Bar-Ph Domain Length = 387 Back     alignment and structure
>pdb|2Z0N|A Chain A, Crystal Structure Of Appl1-Bar Domain Length = 280 Back     alignment and structure
>pdb|2Q12|A Chain A, Crystal Structure Of Bar Domain Of Appl1 Length = 265 Back     alignment and structure
>pdb|2OLM|A Chain A, Arfgap Domain Of Hiv-1 Rev Binding Protein Length = 140 Back     alignment and structure
>pdb|2D9L|A Chain A, Solution Structure Of The Arfgap Domain Of Human Rip Length = 134 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query652
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 3e-63
2q12_A265 DIP13 alpha, DCC-interacting protein 13 alpha; APP 2e-52
2b0o_E 301 UPLC1; arfgap, structural genomics, structural gen 9e-48
3jue_A 368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-47
1dcq_A 278 PYK2-associated protein beta; zinc-binding module, 4e-47
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-44
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 5e-43
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 8e-43
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 1e-42
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 5e-30
3dwd_A147 ADP-ribosylation factor GTPase-activating protein; 2e-38
2owa_A138 Arfgap-like finger domain containing protein; zinc 3e-38
2olm_A140 Nucleoporin-like protein RIP; arfgap, GTPase-activ 5e-38
3sub_A163 ADP-ribosylation factor GTPase-activating protein; 1e-37
2p57_A144 GTPase-activating protein ZNF289; zinc finger, GAP 4e-37
2crw_A149 ARF GAP 3, ADP-ribosylation factor GTPase-activati 8e-36
1zww_A256 SH3-containing GRB2-like protein 2; coiled coil, t 6e-27
2z0v_A240 SH3-containing GRB2-like protein 3; helix bundle, 2e-26
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 1e-23
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 3e-21
1wi1_A126 Calcium-dependent activator protein for secretion, 3e-19
1v5p_A126 Pleckstrin homology domain-containing, family A; T 2e-18
1uru_A244 Amphiphysin; endocytosis, coiled-coil, membrane cu 1e-17
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 3e-17
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 3e-17
3caz_A294 BAR protein; thermo-acidophilic RED ALGA, protein 1e-16
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 1e-16
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 1e-16
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 2e-16
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 3e-16
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 4e-16
3aj4_A112 Pleckstrin homology domain-containing family B ME; 6e-16
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 9e-16
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 1e-15
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 2e-15
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 2e-15
2dkp_A128 Pleckstrin homology domain-containing family A mem 2e-15
2d9v_A130 Pleckstrin homology domain-containing protein fami 4e-15
3rcp_A103 Pleckstrin homology domain-containing family A ME; 4e-15
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 4e-15
2d9y_A117 Pleckstrin homology domain-containing protein fami 2e-14
2yry_A122 Pleckstrin homology domain-containing family A mem 3e-14
1u5e_A211 SRC-associated adaptor protein; novel dimerization 3e-14
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 3e-14
4avm_A237 Bridging integrator 2; protein binding, plasma mem 4e-14
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 4e-14
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 1e-13
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 1e-13
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 2e-13
4a3a_A243 Amphiphysin; structural genomics, invagination, kn 4e-13
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 6e-13
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 6e-13
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 9e-13
3cxb_B112 Pleckstrin homology domain-containing family M mem 1e-12
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 2e-12
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 1e-11
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 5e-11
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 7e-11
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 1e-10
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 1e-10
2fic_A251 Bridging integrator 1; BAR domain, homodimer, coil 2e-10
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 6e-10
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 6e-10
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 1e-09
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 8e-09
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 1e-08
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 1e-08
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 3e-08
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 3e-08
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 9e-08
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 1e-06
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 1e-06
1v88_A130 Oxysterol binding protein-related protein 8; vesic 2e-06
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 8e-06
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 1e-05
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 3e-05
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 7e-05
2ykt_A253 Brain-specific angiogenesis inhibitor 1-associate 7e-05
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 7e-05
1i4d_A224 Arfaptin 2, partner of RAC1; coiled coil, G-protei 1e-04
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 2e-04
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 Back     alignment and structure
 Score =  213 bits (543), Expect = 3e-63
 Identities = 80/439 (18%), Positives = 156/439 (35%), Gaps = 74/439 (16%)

Query: 6   LDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGGH 65
           L+DSP  R  +   EE A  +     + Y+   +  +   E        +  L+ +    
Sbjct: 13  LEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEKQR 72

Query: 66  NDPISV-AFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKC 124
                        + +F+  + E+ +   VL +Q+   +   + Q+   DL E+   ++ 
Sbjct: 73  FPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEV 132

Query: 125 FDKASLLYDQAREKFLSLRKGTKTDVAAI-LEEELHSARSAFEQARFSLVTALSNVEAKK 183
           F  AS  +D A  ++  L K  + D     + E+++++R    Q       AL+ ++ KK
Sbjct: 133 FQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKK 192

Query: 184 RFEFLEAVSGTMDAHLRYFKQGYE-LLHQMEPYINQVLTYAQQSRERSNYEQAALNERMQ 242
           +   LE + G M A + +FK G E L  Q+E ++  + T  Q  R   + +   + + ++
Sbjct: 193 KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIE 252

Query: 243 EYKRQIDRESRWASNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLSKR 302
           + +   D                            + +         +  T + GYL+ R
Sbjct: 253 DLEVASDP-------------------------LYVPDPDPTKFPVNRNLTRKAGYLNAR 287

Query: 303 SSN--LRGDWKRRFFVLDSRGMLYYYRKQCSKSSGSGSQLSSQRNSSELGSGLLSRWLSS 360
           +    +   W R+F+      ++                                     
Sbjct: 288 NKTGLVSSTWDRQFYFTQGGNLMSQ----------------------------------- 312

Query: 361 HYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIIS--PTKNYTLQAESALDQMD 418
                      A    +++   ++    D  D R+CF+I S    K+  LQAES  D  +
Sbjct: 313 ------ARGDVAGGLAMDIDNCSVMA-VDCEDRRYCFQITSFDGKKSSILQAESKKDHEE 365

Query: 419 WIEKITGVIASLLSSQAPE 437
           WI  I  +   +  S+ PE
Sbjct: 366 WICTINNISKQIYLSENPE 384
>2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A Length = 265 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Length = 147 Back     alignment and structure
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Length = 138 Back     alignment and structure
>2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Length = 140 Back     alignment and structure
>3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Length = 163 Back     alignment and structure
>2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Length = 144 Back     alignment and structure
>2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A Length = 256 Back     alignment and structure
>2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} Length = 240 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 Length = 244 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>3caz_A BAR protein; thermo-acidophilic RED ALGA, protein structure initiative, PSI, center for eukaryotic structural genomics, signaling protein; 3.34A {Galdieria sulphuraria} Length = 294 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>2fic_A Bridging integrator 1; BAR domain, homodimer, coiled-coils, endocytosis/exocytosis, protein complex, endocytosis-exocytosis; 1.99A {Homo sapiens} PDB: 2rmy_A 2rnd_A Length = 251 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Length = 113 Back     alignment and structure
>2ykt_A Brain-specific angiogenesis inhibitor 1-associate protein 2; signaling protein, NPY motif, binding pocket; 2.11A {Homo sapiens} PDB: 1y2o_A 1wdz_A Length = 253 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>1i4d_A Arfaptin 2, partner of RAC1; coiled coil, G-protein, complex, signaling protein; HET: GDP; 2.50A {Homo sapiens} SCOP: a.238.1.2 PDB: 1i49_A* 1i4l_A* 1i4t_A* Length = 224 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query652
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 100.0
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 100.0
2q12_A265 DIP13 alpha, DCC-interacting protein 13 alpha; APP 100.0
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 100.0
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 100.0
2olm_A140 Nucleoporin-like protein RIP; arfgap, GTPase-activ 100.0
3jue_A 368 Arfgap with coiled-coil, ANK repeat and PH domain 100.0
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 99.97
2owa_A138 Arfgap-like finger domain containing protein; zinc 99.97
2crw_A149 ARF GAP 3, ADP-ribosylation factor GTPase-activati 99.97
3dwd_A147 ADP-ribosylation factor GTPase-activating protein; 99.96
2p57_A144 GTPase-activating protein ZNF289; zinc finger, GAP 99.96
3sub_A163 ADP-ribosylation factor GTPase-activating protein; 99.95
2b0o_E 301 UPLC1; arfgap, structural genomics, structural gen 99.95
1dcq_A 278 PYK2-associated protein beta; zinc-binding module, 99.95
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.94
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 99.9
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.82
1wi1_A126 Calcium-dependent activator protein for secretion, 99.8
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.79
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.76
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.74
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.74
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.74
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.73
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.72
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.72
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.72
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.72
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.72
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.72
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.72
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.71
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.71
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.71
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.71
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.71
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.7
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.7
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.7
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.69
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.69
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.69
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.69
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.69
2z0v_A240 SH3-containing GRB2-like protein 3; helix bundle, 99.68
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.68
2yry_A122 Pleckstrin homology domain-containing family A mem 99.68
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.68
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.68
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.68
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.67
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.67
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.66
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.66
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.66
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.66
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.66
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.66
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.65
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.65
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.65
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.64
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.64
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.64
1zww_A256 SH3-containing GRB2-like protein 2; coiled coil, t 99.6
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 99.6
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.59
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.54
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.53
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.52
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.51
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.5
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.43
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.38
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.32
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.31
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 99.28
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.28
2fic_A251 Bridging integrator 1; BAR domain, homodimer, coil 99.27
1uru_A244 Amphiphysin; endocytosis, coiled-coil, membrane cu 99.18
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.09
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 99.06
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 99.04
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 99.03
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 98.94
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 98.91
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 98.91
4avm_A237 Bridging integrator 2; protein binding, plasma mem 98.84
4a3a_A243 Amphiphysin; structural genomics, invagination, kn 98.76
1i4d_A224 Arfaptin 2, partner of RAC1; coiled coil, G-protei 98.7
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 98.64
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 98.58
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 98.57
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 98.47
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 98.45
2ykt_A253 Brain-specific angiogenesis inhibitor 1-associate 98.21
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 98.04
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 98.01
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 97.95
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 97.94
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 97.88
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 97.88
3ok8_A222 Brain-specific angiogenesis inhibitor 1-associate 97.85
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 97.83
2d1l_A253 Metastasis suppressor protein 1; IRSP53, actin bin 97.81
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.8
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.78
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 97.77
4akv_A386 Sorting nexin-33; transport protein, organelle bio 97.74
2efl_A305 Formin-binding protein 1; EFC domain, structural g 97.61
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 97.54
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 97.47
3dyt_A366 Sorting nexin-9; 3-helix bundle, BAR domain, PX do 97.39
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 97.31
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 97.22
2efk_A301 CDC42-interacting protein 4; EFC domain, structura 97.19
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 97.17
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 97.17
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 97.06
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 97.05
1foe_A377 T-lymphoma invasion and metastasis inducing protei 96.95
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 96.9
2v0o_A276 FCHO2, FCH domain only protein 2; lipid-binding pr 96.88
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 96.82
2x3v_A337 Syndapin I, protein kinase C and casein kinase sub 96.79
3ml4_A224 Protein DOK-7; tyrosine phosphorylation, adapter p 96.77
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 96.67
3g9g_A287 Suppressor of yeast profilin deletion; SYP1, BAR d 96.59
4dyl_A406 Tyrosine-protein kinase FES/FPS; structural genomi 96.57
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 96.56
3aco_A350 Pacsin2, protein kinase C and casein kinase substr 96.53
2q12_A265 DIP13 alpha, DCC-interacting protein 13 alpha; APP 96.46
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 96.28
3abh_A312 Pacsin2, protein kinase C and casein kinase substr 95.97
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 95.71
3m3w_A320 Pacsin3, protein kinase C and casein kinase II sub 95.04
3i2w_A290 Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocyt 94.2
3caz_A294 BAR protein; thermo-acidophilic RED ALGA, protein 93.99
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 93.73
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 93.33
2adz_A178 Alpha-1-syntrophin; protein binding; NMR {Mus musc 93.01
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 86.58
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
Probab=100.00  E-value=1.9e-57  Score=492.64  Aligned_cols=361  Identities=23%  Similarity=0.370  Sum_probs=297.4

Q ss_pred             CccCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcccchHHHHHHHHHHhhC-----CCCCCCccccCchhH
Q 006276            4 NKLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGG-----GHNDPISVAFGGPVM   78 (652)
Q Consensus         4 ~~~~DSP~FRasv~~~E~~le~l~~~l~kl~K~~kk~~~~~~~~~~~~~~f~~~L~~f~~-----~~~d~~~~~~~g~~L   78 (652)
                      +|++|||.||++|+++|++++.++.||++++|.|++++++..+++.+...|+++|..++.     +.+|+..    +++|
T Consensus        11 e~~~DSP~FR~~l~~~E~~~~~l~~~l~kl~k~~~~~~~a~~~~~~a~~~f~~~L~~~~~~~~~~~~~d~~v----~~~l   86 (385)
T 2q13_A           11 ETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEKQRFPLGGDDEVM----SSTL   86 (385)
T ss_dssp             GTTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTSCCCC---CCHH----HHHH
T ss_pred             HhhcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCCcHHH----HHHH
Confidence            799999999999999999999999999999999999999988888889999999998765     2234432    3589


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHhccccCCChhhH-hHHHHH
Q 006276           79 TKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDVA-AILEEE  157 (652)
Q Consensus        79 ~~f~~~lkel~~~~~~l~~~~~~~i~~pL~~f~~~di~~~ke~Rk~Fek~~~~YD~al~ky~s~~K~k~~~~~-~E~~~e  157 (652)
                      .+|+.+++++..++..|+.++++.++.||++|+++||+++++.||.||+++.+||++++||++++|+++++.. .|++.+
T Consensus        87 ~~f~~~~~ei~~~~~~l~~~~~~~~~~PL~~f~~~di~~~ke~kk~fek~~~~yd~al~k~~~~~k~k~~e~~~~ea~~~  166 (385)
T 2q13_A           87 QQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTED  166 (385)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCSSSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCchhhHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999877644 677799


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHH-hhhHHHHHHHHHHHHHHHHHhHHHHHH
Q 006276          158 LHSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELL-HQMEPYINQVLTYAQQSRERSNYEQAA  236 (652)
Q Consensus       158 L~~~Rk~f~~aslDyv~~l~~l~~~k~~e~le~l~~~~~aq~~ff~~g~e~~-~~l~~~l~el~~~lq~~r~~~~~~~~~  236 (652)
                      |+++|+.|++++|||+..|++++.++++++|++|+.|+++|.+||++|++++ ++++||++++...++++|.+++++.+.
T Consensus       167 l~~~rk~f~~~~ldy~~~l~~l~~rk~~e~le~l~~~~~a~~~ff~~g~~~~~~~~~~~~~~l~~~l~~~r~~~~~~~~~  246 (385)
T 2q13_A          167 VYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIET  246 (385)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999998 599999999999999999999988777


Q ss_pred             HHHHHHHHHhhhhhhhhhcCCCCCCCCCCCCcccccCCchhhHHHHHhhhccCCCceeeeEEEeccCCC--CCCCceeEE
Q 006276          237 LNERMQEYKRQIDRESRWASNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSN--LRGDWKRRF  314 (652)
Q Consensus       237 l~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~k~G~L~K~~~~--~~~~WkrR~  314 (652)
                      +.+.++.+..    ....+.     .|..+..               + .......++|+|||+|+++.  .++.|+|||
T Consensus       247 ~~~~~~~l~~----~~~~~~-----~~~~~~~---------------~-~~~~~~~~~k~G~L~K~~~~~~~~~~WkkRw  301 (385)
T 2q13_A          247 MQQTIEDLEV----ASDPLY-----VPDPDPT---------------K-FPVNRNLTRKAGYLNARNKTGLVSSTWDRQF  301 (385)
T ss_dssp             HHHHHHHHHH----HHGGGS-----SSSCCTT---------------T-SCCCCCCSCCEEEEEEC--------CCEEEE
T ss_pred             HHHHHHHHhc----cCCCCC-----CCCCccc---------------c-cccCCCCccEEEEEEEecCCCCCcCCceeEE
Confidence            6666554321    111111     1111100               0 00112367899999999765  345799999


Q ss_pred             EEEecCceEEEEecCCCCCCCCCCCcccccCcccccccccccccccccCCCCCCccccccceeecccceeeeCCCCCCCc
Q 006276          315 FVLDSRGMLYYYRKQCSKSSGSGSQLSSQRNSSELGSGLLSRWLSSHYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLR  394 (652)
Q Consensus       315 f~L~~~g~l~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~i~l~~~~vk~~~~~~~rr  394 (652)
                      |+|+ +|.|+||++...                                        .+.+.|+|..|+|+.. +..+|+
T Consensus       302 fvL~-~~~L~y~k~~~~----------------------------------------~~~~~i~l~~~~v~~~-~~~~r~  339 (385)
T 2q13_A          302 YFTQ-GGNLMSQARGDV----------------------------------------AGGLAMDIDNCSVMAV-DCEDRR  339 (385)
T ss_dssp             EEEE-TTEEEEECSSCS----------------------------------------SCEEEEECTTCEEEEE-CCTTCS
T ss_pred             EEEE-CCEEEEecCCCc----------------------------------------CCCceEEccceEEEec-cccCCC
Confidence            9999 566777766211                                        1235678888988763 456889


Q ss_pred             ccEEEEeCC--eeEEEEeCCHHHHHHHHHHHHHHHHHhhccCC
Q 006276          395 FCFRIISPT--KNYTLQAESALDQMDWIEKITGVIASLLSSQA  435 (652)
Q Consensus       395 fcF~I~t~~--r~~~lqA~se~e~~~Wi~ai~~ai~~~l~~~~  435 (652)
                      |||+|++++  ++|+|||+|++||++||.||+.+|..++....
T Consensus       340 ~~F~i~t~~~~~~~~l~A~s~~e~~~Wi~ai~~~~~~~~~~~~  382 (385)
T 2q13_A          340 YCFQITSFDGKKSSILQAESKKDHEEWICTINNISKQIYLSEN  382 (385)
T ss_dssp             SEEEEECTTSCBCCCEECSSHHHHHHHHHHHHHHHTTCC----
T ss_pred             ceEEEEeCCCCeEEEEEeCCHHHHHHHHHHHHHHHHhhccccC
Confidence            999999999  89999999999999999999999987665433
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A Back     alignment and structure
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Back     alignment and structure
>2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Back     alignment and structure
>3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fic_A Bridging integrator 1; BAR domain, homodimer, coiled-coils, endocytosis/exocytosis, protein complex, endocytosis-exocytosis; 1.99A {Homo sapiens} PDB: 2rmy_A 2rnd_A Back     alignment and structure
>1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>4avm_A Bridging integrator 2; protein binding, plasma membrane, BAR adaptor; 1.91A {Homo sapiens} Back     alignment and structure
>1i4d_A Arfaptin 2, partner of RAC1; coiled coil, G-protein, complex, signaling protein; HET: GDP; 2.50A {Homo sapiens} SCOP: a.238.1.2 PDB: 1i49_A* 1i4l_A* 1i4t_A* Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2ykt_A Brain-specific angiogenesis inhibitor 1-associate protein 2; signaling protein, NPY motif, binding pocket; 2.11A {Homo sapiens} PDB: 1y2o_A 1wdz_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>3ok8_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 2; I-BAR, protein binding; 2.25A {Mus musculus} Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>2d1l_A Metastasis suppressor protein 1; IRSP53, actin binding, IMD, protein binding; HET: MSE; 1.85A {Mus musculus} Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} Back     alignment and structure
>2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3dyt_A Sorting nexin-9; 3-helix bundle, BAR domain, PX domain, phosphoprotein, protein transport, SH3 domain, transport, transport protein; 2.08A {Homo sapiens} PDB: 3dyu_A 2raj_A 2rai_A 2rak_A* Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>3g9g_A Suppressor of yeast profilin deletion; SYP1, BAR domain, FCH, adaptor, endocytosis, phosphoprotein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4dyl_A Tyrosine-protein kinase FES/FPS; structural genomics, structural genomics consortium, BCR, CR associated substrate, transferase; 2.18A {Homo sapiens} Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>3aco_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.70A {Homo sapiens} Back     alignment and structure
>2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3m3w_A Pacsin3, protein kinase C and casein kinase II substrate P; mouse, BAR domain, endocytosis; 2.60A {Mus musculus} PDB: 3syv_A 3qe6_A Back     alignment and structure
>3i2w_A Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocytosis; 2.67A {Drosophila melanogaster} Back     alignment and structure
>3caz_A BAR protein; thermo-acidophilic RED ALGA, protein structure initiative, PSI, center for eukaryotic structural genomics, signaling protein; 3.34A {Galdieria sulphuraria} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 652
d2elba1268 a.238.1.1 (A:6-273) DCC-interacting protein 13-alp 8e-54
d1dcqa2122 g.45.1.1 (A:247-368) Pyk2-associated protein beta 3e-34
d1y2oa1248 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain 2e-27
d1urua_217 a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila 3e-22
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 5e-22
d2d4ca1237 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sap 3e-21
d1i4da_200 a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Hum 2e-20
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 4e-16
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 6e-15
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 1e-13
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 5e-11
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 7e-11
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 1e-10
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 3e-10
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 5e-10
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 6e-10
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 7e-10
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 9e-10
d1v5pa_126 b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 2e-09
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 5e-09
d1unqa_118 b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H 6e-09
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 9e-09
d1qqga1103 b.55.1.2 (A:12-114) Insulin receptor substrate 1, 2e-08
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 2e-08
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 3e-08
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 4e-08
d2coca199 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont 7e-07
d2coaa1112 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma 1e-06
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 2e-06
d2fjla1101 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph 2e-06
d2j59m1133 b.55.1.1 (M:931-1063) Rho GTPase-activating protei 3e-06
d1omwa2119 b.55.1.1 (A:550-668) G-protein coupled receptor ki 8e-06
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 1e-05
d2cofa195 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) 5e-05
d1x1fa1136 b.55.1.1 (A:8-143) Signal-transducing adaptor prot 6e-05
d1wgqa_109 b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin 6e-05
d2elba2101 b.55.1.1 (A:274-374) DCC-interacting protein 13-al 3e-04
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 4e-04
d1ki1b2142 b.55.1.1 (B:1439-1580) GEF of intersectin {Human ( 5e-04
d1zc3b1109 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 7e-04
d1btna_106 b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), 0.002
>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 Back     information, alignment and structure

class: All alpha proteins
fold: BAR/IMD domain-like
superfamily: BAR/IMD domain-like
family: BAR domain
domain: DCC-interacting protein 13-alpha, APPL1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  183 bits (465), Expect = 8e-54
 Identities = 55/252 (21%), Positives = 109/252 (43%), Gaps = 11/252 (4%)

Query: 6   LDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASAL-----ET 60
           L+DSP  R  +   EE A  +     + Y+   +  +   E        +  L     + 
Sbjct: 8   LEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEKQR 67

Query: 61  FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKE 120
           F  G +D +        + +F+  + E+ +   VL +Q+   +   + Q+   DL E+  
Sbjct: 68  FPLGGDDEVM----SSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILT 123

Query: 121 ARKCFDKASLLYDQAREKFLSLRKGTKTD-VAAILEEELHSARSAFEQARFSLVTALSNV 179
            ++ F  AS  +D A  ++  L K  + D V   + E+++++R    Q       AL+ +
Sbjct: 124 LKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTL 183

Query: 180 EAKKRFEFLEAVSGTMDAHLRYFKQGYELL-HQMEPYINQVLTYAQQSRERSNYEQAALN 238
           + KK+   LE + G M A + +FK G E L  Q+E ++  + T  Q  R   + +   + 
Sbjct: 184 QYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQ 243

Query: 239 ERMQEYKRQIDR 250
           + +++ +   D 
Sbjct: 244 QTIEDLEVASDP 255
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 217 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Length = 200 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query652
d2elba1268 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 100.0
d1dcqa2122 Pyk2-associated protein beta ARF-GAP domain {Mouse 100.0
d1y2oa1248 BAP2/IRSp53 N-terminal domain {Human (Homo sapiens 99.79
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.78
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.75
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.72
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.71
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.7
d1i4da_200 Arfaptin, Rac-binding fragment {Human (Homo sapien 99.69
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.69
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.68
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.67
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.67
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.67
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.66
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.65
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.65
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.65
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.65
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.65
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.64
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.63
d2d4ca1237 Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.62
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.62
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1urua_217 Amphiphysin {Fruit fly (Drosophila melanogaster) [ 99.62
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.61
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.61
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.6
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.6
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.59
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.58
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.57
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.53
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.52
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 99.03
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 98.93
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 98.74
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 98.52
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 98.49
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 98.3
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 98.26
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 98.25
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 97.84
d2efka1279 CDC42-interacting protein 4, CIP4 {Human (Homo sap 97.67
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 97.67
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 97.15
d2efla1288 Formin-binding protein 1, FNBP1 {Human (Homo sapie 97.0
d2elba1268 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 96.62
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 95.17
d1urua_217 Amphiphysin {Fruit fly (Drosophila melanogaster) [ 94.78
d1y2oa1248 BAP2/IRSp53 N-terminal domain {Human (Homo sapiens 94.33
d2zkmx3131 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 92.88
d1i4da_200 Arfaptin, Rac-binding fragment {Human (Homo sapien 90.42
d1u5ka2157 Recombinational repair protein RecO, C-terminal do 81.47
>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: BAR/IMD domain-like
superfamily: BAR/IMD domain-like
family: BAR domain
domain: DCC-interacting protein 13-alpha, APPL1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.9e-37  Score=316.98  Aligned_cols=238  Identities=21%  Similarity=0.332  Sum_probs=212.8

Q ss_pred             CccCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcccchHHHHHHHHHHhhCC----CCCCCccccCchhHH
Q 006276            4 NKLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGG----HNDPISVAFGGPVMT   79 (652)
Q Consensus         4 ~~~~DSP~FRasv~~~E~~le~l~~~l~kl~K~~kk~~~~~~~~~~~~~~f~~~L~~f~~~----~~d~~~~~~~g~~L~   79 (652)
                      +|++|||.||++|+++|.+++.++.||++++|.|++|+++...++.++..|+++|..|+..    ..|+..+   +.+|.
T Consensus         6 E~~~DSP~FRa~l~~~E~~~~~l~~~l~kl~k~~~~~~~~~~~~~~~~~~f~~~L~~~~~~~~~~~~dd~~~---~~~l~   82 (268)
T d2elba1           6 ETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEKQRFPLGGDDEVM---SSTLQ   82 (268)
T ss_dssp             GTTTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTGGGSCCC-----CHH---HHHHH
T ss_pred             HHHhcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcccccCCcHHH---HHHHH
Confidence            7999999999999999999999999999999999999999999988899999999887642    1222212   46899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHhccccCCChhh-HhHHHHHH
Q 006276           80 KFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDV-AAILEEEL  158 (652)
Q Consensus        80 ~f~~~lkel~~~~~~l~~~~~~~i~~pL~~f~~~di~~~ke~Rk~Fek~~~~YD~al~ky~s~~K~k~~~~-~~E~~~eL  158 (652)
                      +|+.++++++.++..+..+++..++.||.+|+++||+++++.||.|++++.+||++++||++++|+++++. ..|++.+|
T Consensus        83 ~f~~~~~el~~~~~~l~~~~~~~~~~pL~~f~~~di~~~ke~kk~fek~~~~yd~~l~k~~~~~k~k~~~~~~~Ea~~~l  162 (268)
T d2elba1          83 QFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDV  162 (268)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCC-----HHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCcchhhhhHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999998887655 45788999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHH-hhhHHHHHHHHHHHHHHHHHhHHHHHHH
Q 006276          159 HSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELL-HQMEPYINQVLTYAQQSRERSNYEQAAL  237 (652)
Q Consensus       159 ~~~Rk~f~~aslDyv~~l~~l~~~k~~e~le~l~~~~~aq~~ff~~g~e~~-~~l~~~l~el~~~lq~~r~~~~~~~~~l  237 (652)
                      +.+|+.|+++++||+.+|+.++.++++++|+.+++|+++|.+||++|++.+ .++++|++++..++++++..++.+.+.+
T Consensus       163 ~~~r~~f~~~~~d~~~~l~~l~~~k~~~~l~~l~~~~~a~~~ff~~~~~~l~~~l~~~~~~l~~~~~~~~~~~~~~~~~~  242 (268)
T d2elba1         163 YTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETM  242 (268)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999988 5799999999999999999998776666


Q ss_pred             HHHHHHH
Q 006276          238 NERMQEY  244 (652)
Q Consensus       238 ~~~~~~~  244 (652)
                      ...++.+
T Consensus       243 ~~~~~~~  249 (268)
T d2elba1         243 QQTIEDL  249 (268)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
Confidence            6555543
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure