Citrus Sinensis ID: 006289

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650--

MASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSMLREEVTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIRSIVS

ccccccccccccccHHHHHHHHHHHccccccccEEccccccHHHHHHHHHHHHHccccccccccccEEEEEHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEEcccHHccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHcccccccccccHHHHHHHHHccHHHHHcccccccccHHHHHHHHHcccccccccccccHHHcHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccHHccHHHHHHHcHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccEEEEccccccHHHHHHHHHHHccccccccEEcccccccHHHHHHHHccccccccccccccccHHHHcccccEEEEEHHHHcccccHHHHHHHHHccccccccccccEEccccEEEEcccccHHHHHccccccccccccHHHHHHHHHHHHHHccccccccccccEEEcccccHHHHHHHHHHHccccHHHHccccccccEEEcccccccccccccccc

ccHcccccccccccHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHcccccHHHHccEEEEEcHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEEcHHHEEccccccccccHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHcccEEcccccHHHHHHHHHHHHHHHHHHcccEEccHHHHHHHHHccHcHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccHHHHHHHHHHHHcccHHcEEEEcHHHHHHHHHHHHHccccccccccccccHHHHHHHccccEEEEEHHHHHHcHHHHHHHHHHHcccccccccccEEEcEcEEEEEEccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHccHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHcccccccccEccc

masagkldpvigrddEIRRCIQILSRrtknnpvligepgvgKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVvgagatngamdagnllkpmlgrgelrcigATTLDEYRKYIEKDPALERRFQQvyvdqpnveDTISILRGLRERYelhhgvrisdsALVEAAILSdryisgrflpdkAIDLVDEAAAKLKMEitskptaldEINRSVLKLEMERLsltndtdkASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKsmlreevtgsDIAEIVSkwtgipvsklqQSEREKLLHLEEELHKrvvgqdpavKSVAEAIQRsraglsdphrpiasfmfmgptgvgKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRligappgyvgyeeggqltevvrrrpyAVILFDEIEKAHSDVFNVFLQIlddgrvtdsqgrtvSFTNTVIIMTSNVgsqyilnmddetfpkeTAYETIKQRVMDAARSIfrpefmnrvdeyivfqpldrdqiSSIVRLQVSFSKVswiyspwhFNYEMLVKFCYLAFTIRSIVS

masagkldpvigrddeiRRCIQilsrrtknnpvligEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERrfqqvyvdqpnveDTISILRGLRERYELHHgvrisdsalvEAAILSDRYISGRFLPDKAIDLVDEAAAKLKmeitskptaldeiNRSVLKLEMErlsltndtdkaskdRLNRLEAELSLLKERQAQlteqwehektvmTRIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISsgksmlreevTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELhkrvvgqdpavKSVAEAIQrsraglsdphrpIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILddgrvtdsqgrtvSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIRSIVS

MASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSMLREEVTGSDIAEIVSKWTGIPVSKLQQSerekllhleeelhkrVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIRSIVS

**********IGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEI*************************************************************TVMTRIQSIKEEIDRVNLEIQQ***EYDLNRAAELKYG*********************************SDIAEIVSKWTGIPV*************************************************IASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIRSI**

*ASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEME******************************************************DRVNLEIQQAEREYDLNRAAELKYGSLNALQ***********************EVTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNM*************IKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIRSIV*

*****KLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYIS*GKSMLREEVTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIR****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTALDEINRSVLKLEMERLSLTNDTxxxxxxxxxxxxxxxxxxxxxxxxxxxxWEHEKTVMTRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGKSMLREEVTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYSPWHFNYEMLVKFCYLAFTIRSIVS

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		652	2.2.26 [Sep-21-2011]
Q9LF37		968	Chaperone protein ClpB3,	yes	no	0.947	0.638	0.919	0.0
Q75GT3		978	Chaperone protein ClpB2,	yes	no	0.949	0.632	0.886	0.0
Q8VYJ7		964	Chaperone protein ClpB4,	no	no	0.947	0.641	0.781	0.0
Q8YM56		872	Chaperone protein ClpB 2	yes	no	0.940	0.702	0.771	0.0
Q0E3C8		983	Chaperone protein ClpB3,	no	no	0.972	0.644	0.765	0.0
Q8DJ40		871	Chaperone protein ClpB 1	yes	no	0.934	0.699	0.779	0.0
Q7NFE9		872	Chaperone protein ClpB OS	yes	no	0.943	0.705	0.759	0.0
P53533		874	Chaperone protein ClpB 1	yes	no	0.992	0.740	0.722	0.0
O87444		873	Chaperone protein ClpB OS	N/A	no	0.940	0.702	0.763	0.0
P74361		872	Chaperone protein ClpB 2	N/A	no	0.941	0.704	0.750	0.0

>sp\|Q9LF37\|CLPB3_ARATH Chaperone protein ClpB3, chloroplastic OS=Arabidopsis thaliana GN=CLPB3 PE=1 SV=1	Back alignment and function desciption

 Score = 1169 bits (3023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/619 (91%), Positives = 598/619 (96%), Gaps = 1/619 (0%)

Query: 1   MASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQ 60
           MA  GKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQ
Sbjct: 247 MAREGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQ 306

Query: 61  ALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATN 120
           ALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVT+SEGQIILFIDEIHTVVGAGATN
Sbjct: 307 ALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTDSEGQIILFIDEIHTVVGAGATN 366

Query: 121 GAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISIL 180
           GAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQP VEDTISIL
Sbjct: 367 GAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPTVEDTISIL 426

Query: 181 RGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPT 240
           RGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPT
Sbjct: 427 RGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPT 486

Query: 241 ALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMT 300
           ALDE++RSV+KLEMERLSLTNDTDKAS++RLNR+E EL LLKE+QA+LTEQWEHE++VM+
Sbjct: 487 ALDELDRSVIKLEMERLSLTNDTDKASRERLNRIETELVLLKEKQAELTEQWEHERSVMS 546

Query: 301 RIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSM 360
           R+QSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLN+LQRQL  AEKELNEY+SSGKSM
Sbjct: 547 RLQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNSLQRQLNEAEKELNEYLSSGKSM 606

Query: 361 LREEVTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQR 420
            REEV GSDIAEIVSKWTGIPVSKLQQSER+KLLHLEEELHKRVVGQ+PAV +VAEAIQR
Sbjct: 607 FREEVLGSDIAEIVSKWTGIPVSKLQQSERDKLLHLEEELHKRVVGQNPAVTAVAEAIQR 666

Query: 421 SRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRL 480
           SRAGLSDP RPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRL
Sbjct: 667 SRAGLSDPGRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRL 726

Query: 481 IGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRT 540
           IGAPPGYVGYEEGGQLTE VRRRPY+VILFDEIEKAH DVFNVFLQILDDGRVTDSQGRT
Sbjct: 727 IGAPPGYVGYEEGGQLTETVRRRPYSVILFDEIEKAHGDVFNVFLQILDDGRVTDSQGRT 786

Query: 541 VSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYI 600
           VSFTNTVIIMTSNVGSQ+ILN  D+    E +YETIK+RVM+AARSIFRPEFMNRVDEYI
Sbjct: 787 VSFTNTVIIMTSNVGSQFILNNTDDD-ANELSYETIKERVMNAARSIFRPEFMNRVDEYI 845

Query: 601 VFQPLDRDQISSIVRLQVS 619
           VF+PLDR+QI+ IVRLQ++
Sbjct: 846 VFKPLDREQINRIVRLQLA 864

Molecular chaperone essential for chloroplast development and seedling viability. Mediates internal thylakoid membrane formation and confers thermotolerance to chloroplasts during heat stress.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q75GT3\|CLPB2_ORYSJ Chaperone protein ClpB2, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPB2 PE=2 SV=1	Back alignment and function description

>sp\|Q8VYJ7\|CLPB4_ARATH Chaperone protein ClpB4, mitochondrial OS=Arabidopsis thaliana GN=CLPB4 PE=1 SV=1	Back alignment and function description

>sp\|Q8YM56\|CLPB2_NOSS1 Chaperone protein ClpB 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=clpB2 PE=3 SV=2	Back alignment and function description

>sp\|Q0E3C8\|CLPB3_ORYSJ Chaperone protein ClpB3, mitochondrial OS=Oryza sativa subsp. japonica GN=CLPB3 PE=2 SV=3	Back alignment and function description

>sp\|Q8DJ40\|CLPB1_THEEB Chaperone protein ClpB 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=clpB1 PE=3 SV=1	Back alignment and function description

>sp\|Q7NFE9\|CLPB_GLOVI Chaperone protein ClpB OS=Gloeobacter violaceus (strain PCC 7421) GN=clpB PE=3 SV=1	Back alignment and function description

>sp\|P53533\|CLPB1_SYNE7 Chaperone protein ClpB 1 OS=Synechococcus elongatus (strain PCC 7942) GN=clpB1 PE=2 SV=3	Back alignment and function description

>sp\|O87444\|CLPB_PLEBO Chaperone protein ClpB OS=Plectonema boryanum GN=clpB PE=2 SV=2	Back alignment and function description

>sp\|P74361\|CLPB2_SYNY3 Chaperone protein ClpB 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=clpB2 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		652
357502203		1034	Chaperone protein clpB [Medicago truncat	0.947	0.597	0.959	0.0
356568712		974	PREDICTED: chaperone protein ClpB3, chlo	0.947	0.634	0.954	0.0
356523596		974	PREDICTED: chaperone protein ClpB3, chlo	0.947	0.634	0.953	0.0
357496641		974	Chaperone protein clpB [Medicago truncat	0.947	0.634	0.941	0.0
225452950		976	PREDICTED: chaperone protein ClpB3, chlo	0.947	0.633	0.964	0.0
147842424		790	hypothetical protein VITISV_009951 [Viti	0.947	0.782	0.959	0.0
224077716		967	predicted protein [Populus trichocarpa]	0.946	0.638	0.927	0.0
356551074		978	PREDICTED: chaperone protein ClpB3, chlo	0.947	0.631	0.943	0.0
356573524		978	PREDICTED: chaperone protein ClpB3, chlo	0.947	0.631	0.943	0.0
449460533		973	PREDICTED: chaperone protein ClpB3, chlo	0.947	0.635	0.943	0.0

>gi\|357502203\|ref\|XP_003621390.1\| Chaperone protein clpB [Medicago truncatula] gi\|355496405\|gb\|AES77608.1\| Chaperone protein clpB [Medicago truncatula]	Back alignment and taxonomy information

 Score = 1213 bits (3139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/618 (95%), Positives = 608/618 (98%)

Query: 1   MASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQ 60
           MA AGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQ
Sbjct: 309 MAKAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQ 368

Query: 61  ALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATN 120
           ALMNR+LISLDMGALIAGAKYRGEFEDRLKAVLKEVTES+GQ ILFIDEIHTVVGAGATN
Sbjct: 369 ALMNRRLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESDGQTILFIDEIHTVVGAGATN 428

Query: 121 GAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISIL 180
           GAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQP VEDTISIL
Sbjct: 429 GAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPTVEDTISIL 488

Query: 181 RGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPT 240
           RGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPT
Sbjct: 489 RGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPT 548

Query: 241 ALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMT 300
           ALDEINRSVLKLEMERLSLTNDTDKASKDRL+RLEAELSLLK +QA+LTEQWEHEK+VMT
Sbjct: 549 ALDEINRSVLKLEMERLSLTNDTDKASKDRLSRLEAELSLLKHKQAELTEQWEHEKSVMT 608

Query: 301 RIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSM 360
           R+QSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLN+LQRQLESAEKEL+EY++SGKSM
Sbjct: 609 RLQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNSLQRQLESAEKELDEYMNSGKSM 668

Query: 361 LREEVTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQR 420
           LREEVTGSDIAEIVSKWTGIPVSKLQQSEREKLL+LEE LHKRVVGQDPAVK+VAEAIQR
Sbjct: 669 LREEVTGSDIAEIVSKWTGIPVSKLQQSEREKLLYLEEVLHKRVVGQDPAVKAVAEAIQR 728

Query: 421 SRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRL 480
           SRAGLSDPHRPIASFMFMGPTGVGKTELAK LASYMFNTEEALVRIDMSEYMEKHAVSRL
Sbjct: 729 SRAGLSDPHRPIASFMFMGPTGVGKTELAKTLASYMFNTEEALVRIDMSEYMEKHAVSRL 788

Query: 481 IGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRT 540
           IGAPPGYVGYEEGGQLTE VRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRT
Sbjct: 789 IGAPPGYVGYEEGGQLTETVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRT 848

Query: 541 VSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYI 600
           VSFTNTVIIMTSNVGSQYILN DD+T PKE AYETIKQRVMDAARSIFRPEFMNRVDEYI
Sbjct: 849 VSFTNTVIIMTSNVGSQYILNTDDDTAPKELAYETIKQRVMDAARSIFRPEFMNRVDEYI 908

Query: 601 VFQPLDRDQISSIVRLQV 618
           VFQPLDRDQISSIVRLQ+
Sbjct: 909 VFQPLDRDQISSIVRLQL 926

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356568712\|ref\|XP_003552554.1\| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|356523596\|ref\|XP_003530423.1\| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|357496641\|ref\|XP_003618609.1\| Chaperone protein clpB [Medicago truncatula] gi\|355493624\|gb\|AES74827.1\| Chaperone protein clpB [Medicago truncatula]	Back alignment and taxonomy information

>gi\|225452950\|ref\|XP_002284243.1\| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147842424\|emb\|CAN69514.1\| hypothetical protein VITISV_009951 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224077716\|ref\|XP_002305376.1\| predicted protein [Populus trichocarpa] gi\|222848340\|gb\|EEE85887.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356551074\|ref\|XP_003543903.1\| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|356573524\|ref\|XP_003554908.1\| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|449460533\|ref\|XP_004148000.1\| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Cucumis sativus] gi\|449501963\|ref\|XP_004161506.1\| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		652
TAIR\|locus:2180922		968	CLPB3 "casein lytic proteinase	0.947	0.638	0.896	5e-289
UNIPROTKB\|Q75GT3		978	CLPB2 "Chaperone protein ClpB2	0.949	0.632	0.865	2.7e-283
UNIPROTKB\|Q0E3C8		983	CLPB3 "Chaperone protein ClpB3	0.972	0.644	0.748	1.3e-251
TAIR\|locus:2040159		964	CLPB4 "casein lytic proteinase	0.947	0.641	0.764	8.1e-250
TIGR_CMR\|BA_1177		866	BA_1177 "ATP-dependent Clp pro	0.929	0.699	0.619	3.1e-202
TIGR_CMR\|GSU_0658		865	GSU_0658 "ClpB protein" [Geoba	0.943	0.710	0.605	3.9e-202
TIGR_CMR\|CBU_0094		859	CBU_0094 "clpB protein" [Coxie	0.934	0.708	0.596	1.6e-198
UNIPROTKB\|P63284		857	clpB "ClpB chaperone" [Escheri	0.927	0.705	0.603	8.7e-198
UNIPROTKB\|Q9KU18		857	clpB "Chaperone protein ClpB"	0.930	0.708	0.604	1.1e-197
TIGR_CMR\|VC_0711		857	VC_0711 "clpB protein" [Vibrio	0.930	0.708	0.604	1.1e-197

TAIR\|locus:2180922 CLPB3 "casein lytic proteinase B3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2776 (982.3 bits), Expect = 5.0e-289, P = 5.0e-289
 Identities = 555/619 (89%), Positives = 583/619 (94%)

Query:     1 MASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQ 60
             MA  GKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQ
Sbjct:   247 MAREGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQ 306

Query:    61 ALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATN 120
             ALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVT+SEGQIILFIDEIHTVVGAGATN
Sbjct:   307 ALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTDSEGQIILFIDEIHTVVGAGATN 366

Query:   121 GAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISIL 180
             GAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQP VEDTISIL
Sbjct:   367 GAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPTVEDTISIL 426

Query:   181 RGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPT 240
             RGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPT
Sbjct:   427 RGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPT 486

Query:   241 ALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMT 300
             ALDE++RSV+KLEMERLSLTNDTDKAS++RLNR+E EL LLKE+QA+LTEQWEHE++VM+
Sbjct:   487 ALDELDRSVIKLEMERLSLTNDTDKASRERLNRIETELVLLKEKQAELTEQWEHERSVMS 546

Query:   301 RIQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSM 360
             R+QSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLN+LQRQL  AEKELNEY+SSGKSM
Sbjct:   547 RLQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNSLQRQLNEAEKELNEYLSSGKSM 606

Query:   361 LREEVTGSDIAEIVSKWTGIPVSKLQQSXXXXXXXXXXXXXXXVVGQDPAVKSVAEAIQR 420
              REEV GSDIAEIVSKWTGIPVSKLQQS               VVGQ+PAV +VAEAIQR
Sbjct:   607 FREEVLGSDIAEIVSKWTGIPVSKLQQSERDKLLHLEEELHKRVVGQNPAVTAVAEAIQR 666

Query:   421 SRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRL 480
             SRAGLSDP RPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRL
Sbjct:   667 SRAGLSDPGRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRL 726

Query:   481 IGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRT 540
             IGAPPGYVGYEEGGQLTE VRRRPY+VILFDEIEKAH DVFNVFLQILDDGRVTDSQGRT
Sbjct:   727 IGAPPGYVGYEEGGQLTETVRRRPYSVILFDEIEKAHGDVFNVFLQILDDGRVTDSQGRT 786

Query:   541 VSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYI 600
             VSFTNTVIIMTSNVGSQ+ILN  D+    E +YETIK+RVM+AARSIFRPEFMNRVDEYI
Sbjct:   787 VSFTNTVIIMTSNVGSQFILNNTDDD-ANELSYETIKERVMNAARSIFRPEFMNRVDEYI 845

Query:   601 VFQPLDRDQISSIVRLQVS 619
             VF+PLDR+QI+ IVRLQ++
Sbjct:   846 VFKPLDREQINRIVRLQLA 864

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA;ISS

GO:0005737 "cytoplasm" evidence=ISM;IEA

GO:0009408 "response to heat" evidence=IEA;IEP;ISS

GO:0016485 "protein processing" evidence=IEA

GO:0016887 "ATPase activity" evidence=ISS

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0019538 "protein metabolic process" evidence=IEA

GO:0009532 "plastid stroma" evidence=IDA

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0009507 "chloroplast" evidence=IDA

GO:0009658 "chloroplast organization" evidence=IMP

UNIPROTKB\|Q75GT3 CLPB2 "Chaperone protein ClpB2, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

UNIPROTKB\|Q0E3C8 CLPB3 "Chaperone protein ClpB3, mitochondrial" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TAIR\|locus:2040159 CLPB4 "casein lytic proteinase B4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_1177 BA_1177 "ATP-dependent Clp protease, ATP-binding subunit ClpB" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_0658 GSU_0658 "ClpB protein" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_0094 CBU_0094 "clpB protein" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

UNIPROTKB\|P63284 clpB "ClpB chaperone" [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KU18 clpB "Chaperone protein ClpB" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_0711 VC_0711 "clpB protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q98G96	CLPB_RHILO	No assigned EC number	0.6353	0.9279	0.6970	yes	no
Q6MIV0	CLPB_BDEBA	No assigned EC number	0.6276	0.9386	0.7157	yes	no
Q898C7	CLPB_CLOTE	No assigned EC number	0.6247	0.9309	0.7017	yes	no
Q72AW6	CLPB_DESVH	No assigned EC number	0.6737	0.9294	0.7005	yes	no
Q74FF1	CLPB_GEOSL	No assigned EC number	0.6163	0.9432	0.7109	yes	no
Q7V8B1	CLPB_PROMM	No assigned EC number	0.7237	0.9417	0.7098	yes	no
Q9LF37	CLPB3_ARATH	No assigned EC number	0.9192	0.9478	0.6384	yes	no
Q7VNH1	CLPB_HAEDU	No assigned EC number	0.6077	0.9340	0.7114	yes	no
Q929G7	CLPB_LISIN	No assigned EC number	0.6301	0.9309	0.7009	yes	no
P74361	CLPB2_SYNY3	No assigned EC number	0.7508	0.9417	0.7041	N/A	no
Q8YJ91	CLPB_BRUME	No assigned EC number	0.6320	0.9309	0.6945	yes	no
Q7CU92	CLPB_AGRT5	No assigned EC number	0.6256	0.9340	0.6967	yes	no
Q7NFE9	CLPB_GLOVI	No assigned EC number	0.7592	0.9432	0.7052	yes	no
Q97KG0	CLPB_CLOAB	No assigned EC number	0.6268	0.9217	0.6947	yes	no
Q8P6A0	CLPB_XANCP	No assigned EC number	0.6094	0.9371	0.7096	yes	no
Q7U637	CLPB1_SYNPX	No assigned EC number	0.7131	0.9401	0.7111	yes	no
Q8YM56	CLPB2_NOSS1	No assigned EC number	0.7714	0.9401	0.7029	yes	no
Q826F2	CLPB2_STRAW	No assigned EC number	0.6397	0.9340	0.6928	yes	no
Q81GM5	CLPB_BACCR	No assigned EC number	0.6323	0.9294	0.6997	yes	no
Q9JYQ8	CLPB_NEIMB	No assigned EC number	0.6110	0.9371	0.7112	yes	no
Q75GT3	CLPB2_ORYSJ	No assigned EC number	0.8869	0.9493	0.6329	yes	no
Q7NWN7	CLPB_CHRVO	No assigned EC number	0.6203	0.9340	0.7089	yes	no
Q9JTP9	CLPB_NEIMA	No assigned EC number	0.6110	0.9371	0.7112	yes	no
Q72IK9	CLPB_THET2	No assigned EC number	0.6548	0.9355	0.7142	yes	no
Q7VBL0	CLPB_PROMA	No assigned EC number	0.6494	0.9401	0.7094	yes	no
Q7CEG6	CLPB_BRUSU	No assigned EC number	0.6337	0.9309	0.6945	yes	no
P63286	CLPB_ECOL6	No assigned EC number	0.6209	0.9279	0.7059	yes	no
Q7X2S8	CLPB_MEIRU	No assigned EC number	0.6462	0.9279	0.7084	yes	no
Q8XZR0	CLPB_RALSO	No assigned EC number	0.6223	0.9371	0.7088	yes	no
Q8RHQ8	CLPB_FUSNN	No assigned EC number	0.6089	0.9693	0.7374	yes	no
P44403	CLPB_HAEIN	No assigned EC number	0.6348	0.9279	0.7067	yes	no
Q71XF9	CLPB_LISMF	No assigned EC number	0.6333	0.9309	0.7009	yes	no
O87444	CLPB_PLEBO	No assigned EC number	0.7633	0.9401	0.7021	N/A	no
P53533	CLPB1_SYNE7	No assigned EC number	0.7227	0.9923	0.7402	yes	no
Q8DJ40	CLPB1_THEEB	No assigned EC number	0.7797	0.9340	0.6991	yes	no
Q6N1H2	CLPB_RHOPA	No assigned EC number	0.6262	0.9325	0.6916	yes	no
Q9CKC0	CLPB_PASMU	No assigned EC number	0.6177	0.9294	0.7087	yes	no
Q9KU18	CLPB_VIBCH	No assigned EC number	0.6171	0.9325	0.7094	yes	no
Q9RA63	CLPB_THET8	No assigned EC number	0.6548	0.9355	0.7142	yes	no
Q7CQ01	CLPB_SALTY	No assigned EC number	0.6193	0.9279	0.7059	yes	no
Q7N788	CLPB_PHOLL	No assigned EC number	0.6110	0.9325	0.7094	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		652
TIGR03346		852	TIGR03346, chaperone_ClpB, ATP-dependent chaperone	0.0
COG0542		786	COG0542, clpA, ATP-binding subunits of Clp proteas	0.0
PRK10865		857	PRK10865, PRK10865, protein disaggregation chapero	0.0
CHL00095		821	CHL00095, clpC, Clp protease ATP binding subunit	0.0
TIGR03345		852	TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp	0.0
TIGR02639		730	TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi	1e-116
TIGR02639		730	TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi	3e-98
pfam07724		168	pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	7e-93
PRK11034		758	PRK11034, clpA, ATP-dependent Clp protease ATP-bin	2e-88
PRK11034		758	PRK11034, clpA, ATP-dependent Clp protease ATP-bin	2e-68
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	1e-21
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	2e-17
smart00382		148	smart00382, AAA, ATPases associated with a variety	2e-13
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	1e-12
pfam07728		135	pfam07728, AAA_5, AAA domain (dynein-related subfa	3e-10
COG0714		329	COG0714, COG0714, MoxR-like ATPases [General funct	3e-08
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	4e-07
smart00382		148	smart00382, AAA, ATPases associated with a variety	4e-06
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	8e-06
pfam13401		124	pfam13401, AAA_22, AAA domain	1e-05
pfam07728		135	pfam07728, AAA_5, AAA domain (dynein-related subfa	2e-05
pfam13191		154	pfam13191, AAA_16, AAA ATPase domain	2e-05
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	3e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-05
COG0714		329	COG0714, COG0714, MoxR-like ATPases [General funct	8e-05
COG5271		4600	COG5271, MDN1, AAA ATPase containing von Willebran	2e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	3e-04
PRK13342		413	PRK13342, PRK13342, recombination factor protein R	4e-04
TIGR00390		441	TIGR00390, hslU, ATP-dependent protease HslVU, ATP	4e-04
COG1220		444	COG1220, HslU, ATP-dependent protease HslVU (ClpYQ	4e-04
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	6e-04
PRK01156		895	PRK01156, PRK01156, chromosome segregation protein	6e-04
PRK05201		443	PRK05201, hslU, ATP-dependent protease ATP-binding	6e-04
pfam13401		124	pfam13401, AAA_22, AAA domain	0.001
TIGR03922		557	TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas	0.001
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	0.001
PRK14970		367	PRK14970, PRK14970, DNA polymerase III subunits ga	0.001
COG2256		436	COG2256, MGS1, ATPase related to the helicase subu	0.001
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.002
PRK05703		424	PRK05703, flhF, flagellar biosynthesis regulator F	0.002
TIGR03007		498	TIGR03007, pepcterm_ChnLen, polysaccharide chain l	0.003
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	0.004

>gnl\|CDD\|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB	Back alignment and domain information

 Score = 1126 bits (2916), Expect = 0.0
 Identities = 428/618 (69%), Positives = 523/618 (84%), Gaps = 7/618 (1%)

Query: 2   ASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQA 61
           A  GKLDPVIGRD+EIRR IQ+LSRRTKNNPVLIGEPGVGKTAI EGLAQRIV GDVP++
Sbjct: 167 AREGKLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGDVPES 226

Query: 62  LMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNG 121
           L N++L++LDMGALIAGAKYRGEFE+RLKAVL EVT+SEGQIILFIDE+HT+VGAG   G
Sbjct: 227 LKNKRLLALDMGALIAGAKYRGEFEERLKAVLNEVTKSEGQIILFIDELHTLVGAGKAEG 286

Query: 122 AMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQPNVEDTISILR 181
           AMDAGN+LKP L RGEL CIGATTLDEYRKYIEKD ALERRFQ V+VD+P VEDTISILR
Sbjct: 287 AMDAGNMLKPALARGELHCIGATTLDEYRKYIEKDAALERRFQPVFVDEPTVEDTISILR 346

Query: 182 GLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKPTA 241
           GL+ERYE+HHGVRI+D A+V AA LS RYI+ RFLPDKAIDL+DEAAA+++MEI SKP  
Sbjct: 347 GLKERYEVHHGVRITDPAIVAAATLSHRYITDRFLPDKAIDLIDEAAARIRMEIDSKPEE 406

Query: 242 LDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTR 301
           LDE++R +++LE+ER +L  + D+ASK+RL  LE EL+ L+E  A L EQW+ EK  +  
Sbjct: 407 LDELDRRIIQLEIEREALKKEKDEASKERLEDLEKELAELEEEYADLEEQWKAEKAAIQG 466

Query: 302 IQSIKEEIDRVNLEIQQAEREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSML 361
           IQ IKEEI++V LE++QAERE DL +AAEL+YG L  L+++L++AE +L E   +   +L
Sbjct: 467 IQQIKEEIEQVRLELEQAEREGDLAKAAELQYGKLPELEKRLQAAEAKLGE--ETKPRLL 524

Query: 362 REEVTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEELHKRVVGQDPAVKSVAEAIQRS 421
           REEVT  +IAE+VS+WTGIPVSK+ + EREKLLH+EE LH+RVVGQD AV++V++AI+RS
Sbjct: 525 REEVTAEEIAEVVSRWTGIPVSKMLEGEREKLLHMEEVLHERVVGQDEAVEAVSDAIRRS 584

Query: 422 RAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLI 481
           RAGLSDP+RPI SF+F+GPTGVGKTELAKALA ++F+ E+A+VRIDMSEYMEKH+V+RLI
Sbjct: 585 RAGLSDPNRPIGSFLFLGPTGVGKTELAKALAEFLFDDEDAMVRIDMSEYMEKHSVARLI 644

Query: 482 GAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTV 541
           GAPPGYVGYEEGGQLTE VRR+PY+V+LFDE+EKAH DVFNV LQ+LDDGR+TD QGRTV
Sbjct: 645 GAPPGYVGYEEGGQLTEAVRRKPYSVVLFDEVEKAHPDVFNVLLQVLDDGRLTDGQGRTV 704

Query: 542 SFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIV 601
            F NTVIIMTSN+GSQ+I  +          YE +++ VM+  R+ FRPEF+NR+DE +V
Sbjct: 705 DFRNTVIIMTSNLGSQFIQEL-----AGGDDYEEMREAVMEVLRAHFRPEFLNRIDEIVV 759

Query: 602 FQPLDRDQISSIVRLQVS 619
           F PL R+QI+ IV +Q+ 
Sbjct: 760 FHPLGREQIARIVEIQLG 777

Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins [Protein fate, Protein folding and stabilization]. Length = 852

>gnl\|CDD\|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional	Back alignment and domain information

>gnl\|CDD\|214361 CHL00095, clpC, Clp protease ATP binding subunit	Back alignment and domain information

>gnl\|CDD\|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>gnl\|CDD\|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>gnl\|CDD\|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>gnl\|CDD\|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	Back alignment and domain information

>gnl\|CDD\|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily)	Back alignment and domain information

>gnl\|CDD\|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|222104 pfam13401, AAA_22, AAA domain	Back alignment and domain information

>gnl\|CDD\|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily)	Back alignment and domain information

>gnl\|CDD\|221970 pfam13191, AAA_16, AAA ATPase domain	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed	Back alignment and domain information

>gnl\|CDD\|213527 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>gnl\|CDD\|224141 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235364 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>gnl\|CDD\|222104 pfam13401, AAA_22, AAA domain	Back alignment and domain information

>gnl\|CDD\|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA	Back alignment and domain information

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|184934 PRK14970, PRK14970, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|235570 PRK05703, flhF, flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>gnl\|CDD\|234084 TIGR03007, pepcterm_ChnLen, polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		652
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	100.0
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	100.0
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	100.0
PRK10865		857	protein disaggregation chaperone; Provisional	100.0
CHL00095		821	clpC Clp protease ATP binding subunit	100.0
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	100.0
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	100.0
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	100.0
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	100.0
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	100.0
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	100.0
KOG0736		953	consensus Peroxisome assembly factor 2 containing	100.0
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	100.0
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	100.0
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	99.96
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	99.96
COG2204		464	AtoC Response regulator containing CheY-like recei	99.96
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	99.96
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	99.95
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	99.95
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	99.95
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	99.95
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	99.94
CHL00195		489	ycf46 Ycf46; Provisional	99.94
COG3829		560	RocR Transcriptional regulator containing PAS, AAA	99.94
COG3604		550	FhlA Transcriptional regulator containing GAF, AAA	99.93
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	99.91
COG2256		436	MGS1 ATPase related to the helicase subunit of the	99.91
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	99.91
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	99.91
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	99.91
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	99.9
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	99.9
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	99.9
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	99.9
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	99.9
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	99.89
KOG0736		953	consensus Peroxisome assembly factor 2 containing	99.89
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	99.89
PRK11608		326	pspF phage shock protein operon transcriptional ac	99.89
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	99.88
PRK15424		538	propionate catabolism operon regulatory protein Pr	99.88
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	99.88
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	99.88
CHL00195		489	ycf46 Ycf46; Provisional	99.87
PRK05022		509	anaerobic nitric oxide reductase transcription reg	99.87
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	99.87
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	99.87
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	99.87
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	99.87
COG1221		403	PspF Transcriptional regulators containing an AAA-	99.87
COG3283		511	TyrR Transcriptional regulator of aromatic amino a	99.87
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	99.86
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	99.86
PRK03992		389	proteasome-activating nucleotidase; Provisional	99.86
CHL00181		287	cbbX CbbX; Provisional	99.85
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	99.85
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	99.85
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	99.85
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	99.85
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	99.85
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	99.85
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	99.85
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	99.84
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	99.84
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	99.84
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	99.84
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	99.84
CHL00181		287	cbbX CbbX; Provisional	99.84
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	99.84
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	99.84
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	99.84
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	99.83
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	99.83
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	99.83
COG5271		4600	MDN1 AAA ATPase containing von Willebrand factor t	99.83
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	99.83
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	99.83
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	99.83
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	99.82
KOG2028		554	consensus ATPase related to the helicase subunit o	99.82
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	99.82
CHL00176		638	ftsH cell division protein; Validated	99.82
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	99.82
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	99.82
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	99.82
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	99.82
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	99.81
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	99.81
COG5271		4600	MDN1 AAA ATPase containing von Willebrand factor t	99.81
PRK03992		389	proteasome-activating nucleotidase; Provisional	99.81
PRK15115		444	response regulator GlrR; Provisional	99.81
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	99.81
PRK13342		413	recombination factor protein RarA; Reviewed	99.81
TIGR01818		463	ntrC nitrogen regulation protein NR(I). This model	99.81
COG2256		436	MGS1 ATPase related to the helicase subunit of the	99.8
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	99.8
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	99.8
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	99.8
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	99.8
CHL00206		2281	ycf2 Ycf2; Provisional	99.8
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	99.79
PLN03025		319	replication factor C subunit; Provisional	99.79
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	99.79
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	99.79
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	99.79
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	99.78
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	99.78
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	99.78
PRK13341		725	recombination factor protein RarA/unknown domain f	99.78
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	99.78
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	99.78
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	99.78
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	99.78
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	99.78
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	99.78
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	99.77
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	99.77
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	99.77
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	99.77
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	99.77
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	99.77
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	99.76
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	99.76
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	99.76
COG3284		606	AcoR Transcriptional activator of acetoin/glycerol	99.76
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	99.76
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	99.76
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	99.76
PRK10365		441	transcriptional regulatory protein ZraR; Provision	99.76
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	99.75
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	99.75
CHL00176		638	ftsH cell division protein; Validated	99.75
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	99.75
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	99.75
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	99.75
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	99.75
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	99.75
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	99.74
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	99.74
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	99.74
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	99.74
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	99.74
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	99.73
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	99.73
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	99.73
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	99.73
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	99.73
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	99.73
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	99.73
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	99.73
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	99.72
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	99.72
CHL00206		2281	ycf2 Ycf2; Provisional	99.72
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	99.72
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	99.72
PHA02544		316	44 clamp loader, small subunit; Provisional	99.72
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	99.72
PRK04195		482	replication factor C large subunit; Provisional	99.72
PRK08084		235	DNA replication initiation factor; Provisional	99.71
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	99.71
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	99.71
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	99.71
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	99.71
PF00004		132	AAA: ATPase family associated with various cellula	99.71
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	99.71
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	99.71
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	99.71
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	99.7
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	99.7
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	99.7
PRK12402		337	replication factor C small subunit 2; Reviewed	99.7
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	99.7
COG0606		490	Predicted ATPase with chaperone activity [Posttran	99.7
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	99.7
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	99.7
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	99.69
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	99.69
PHA02244		383	ATPase-like protein	99.69
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	99.69
PRK07940		394	DNA polymerase III subunit delta'; Validated	99.69
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	99.69
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	99.68
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	99.68
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	99.68
PLN03025		319	replication factor C subunit; Provisional	99.68
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	99.68
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	99.68
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	99.68
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	99.67
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	99.67
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	99.67
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	99.67
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	99.67
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	99.66
PRK06893		229	DNA replication initiation factor; Validated	99.66
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	99.66
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	99.66
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	99.66
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	99.65
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	99.65
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	99.65
PRK00440		319	rfc replication factor C small subunit; Reviewed	99.65
KOG2170		344	consensus ATPase of the AAA+ superfamily [General	99.65
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	99.65
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	99.65
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	99.64
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	99.64
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	99.64
PRK05642		234	DNA replication initiation factor; Validated	99.64
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	99.64
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	99.64
PRK07940		394	DNA polymerase III subunit delta'; Validated	99.64
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	99.64
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	99.64
PRK13342		413	recombination factor protein RarA; Reviewed	99.64
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	99.64
PRK13531		498	regulatory ATPase RavA; Provisional	99.64
PRK13341		725	recombination factor protein RarA/unknown domain f	99.64
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	99.64
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	99.63
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	99.63
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	99.63
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	99.63
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	99.63
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	99.63
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	99.62
PF00004		132	AAA: ATPase family associated with various cellula	99.61
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	99.61
PTZ00112		1164	origin recognition complex 1 protein; Provisional	99.61
PHA02544		316	44 clamp loader, small subunit; Provisional	99.61
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	99.61
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	99.6
PRK04195		482	replication factor C large subunit; Provisional	99.6
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	99.6
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	99.6
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	99.6
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	99.6
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	99.6
PRK12402		337	replication factor C small subunit 2; Reviewed	99.6
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	99.59
PRK08727		233	hypothetical protein; Validated	99.59
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	99.59
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	99.59
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	99.59
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	99.58
PF07726		131	AAA_3: ATPase family associated with various cellu	99.58
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	99.58
COG0714		329	MoxR-like ATPases [General function prediction onl	99.58
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	99.58
PRK07399		314	DNA polymerase III subunit delta'; Validated	99.58
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	99.57
PRK08903		227	DnaA regulatory inactivator Hda; Validated	99.57
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	99.57
KOG2028		554	consensus ATPase related to the helicase subunit o	99.57
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	99.57
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	99.57
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	99.57
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	99.57
PRK09112		351	DNA polymerase III subunit delta'; Validated	99.56
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	99.56
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	99.55
PRK00149		450	dnaA chromosomal replication initiation protein; R	99.55
PRK12422		445	chromosomal replication initiation protein; Provis	99.55
PRK00411		394	cdc6 cell division control protein 6; Reviewed	99.55
PRK05564		313	DNA polymerase III subunit delta'; Validated	99.54
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	99.54
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	99.54
PRK14088		440	dnaA chromosomal replication initiation protein; P	99.54
PRK07471		365	DNA polymerase III subunit delta'; Validated	99.54
COG4650		531	RtcR Sigma54-dependent transcription regulator con	99.54
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	99.54
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	99.54
PRK06620		214	hypothetical protein; Validated	99.54
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	99.53
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	99.53
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.53
PRK14086		617	dnaA chromosomal replication initiation protein; P	99.53
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	99.53
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.52
PRK09112		351	DNA polymerase III subunit delta'; Validated	99.52
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	99.52
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	99.51
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	99.51
PRK08058		329	DNA polymerase III subunit delta'; Validated	99.51
PRK09087		226	hypothetical protein; Validated	99.51
PRK00440		319	rfc replication factor C small subunit; Reviewed	99.51
PRK07471		365	DNA polymerase III subunit delta'; Validated	99.51
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	99.5
PRK14087		450	dnaA chromosomal replication initiation protein; P	99.5
smart00350		509	MCM minichromosome maintenance proteins.	99.5
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	99.5
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	99.5
KOG0990		360	consensus Replication factor C, subunit RFC5 [Repl	99.49
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	99.49
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	99.49
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	99.48
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	99.48
PRK08903		227	DnaA regulatory inactivator Hda; Validated	99.48
PRK09862		506	putative ATP-dependent protease; Provisional	99.47
PRK06871		325	DNA polymerase III subunit delta'; Validated	99.47
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	99.46
COG1239		423	ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis	99.46
PTZ00111		915	DNA replication licensing factor MCM4; Provisional	99.46
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	99.46
COG0593		408	DnaA ATPase involved in DNA replication initiation	99.46
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.45
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	99.44
PRK08769		319	DNA polymerase III subunit delta'; Validated	99.44
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	99.44
PRK07399		314	DNA polymerase III subunit delta'; Validated	99.44
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	99.43
PRK06893		229	DNA replication initiation factor; Validated	99.43
PRK13765		637	ATP-dependent protease Lon; Provisional	99.43
COG3829		560	RocR Transcriptional regulator containing PAS, AAA	99.43
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	99.43
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	99.42
PRK05707		328	DNA polymerase III subunit delta'; Validated	99.42
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	99.42
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	99.42
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	99.42
PRK06964		342	DNA polymerase III subunit delta'; Validated	99.42
PRK07993		334	DNA polymerase III subunit delta'; Validated	99.42
PRK05564		313	DNA polymerase III subunit delta'; Validated	99.42
PRK06090		319	DNA polymerase III subunit delta'; Validated	99.42
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	99.42
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	99.4
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	99.39
PRK08084		235	DNA replication initiation factor; Provisional	99.39
PTZ00112		1164	origin recognition complex 1 protein; Provisional	99.39
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	99.38
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	99.38
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	99.37
KOG1942		456	consensus DNA helicase, TBP-interacting protein [R	99.37
PRK04132		846	replication factor C small subunit; Provisional	99.37
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	99.37
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	99.36
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	99.36
PRK13531		498	regulatory ATPase RavA; Provisional	99.36
PRK00411		394	cdc6 cell division control protein 6; Reviewed	99.36
PRK08727		233	hypothetical protein; Validated	99.36
PHA02244		383	ATPase-like protein	99.35
PRK10865		857	protein disaggregation chaperone; Provisional	99.35
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	99.34
COG0714		329	MoxR-like ATPases [General function prediction onl	99.34
CHL00095		821	clpC Clp protease ATP binding subunit	99.34
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	99.34
PRK08058		329	DNA polymerase III subunit delta'; Validated	99.33
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	99.33
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	99.32
KOG1969		877	consensus DNA replication checkpoint protein CHL12	99.32
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	99.32
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	99.32
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.31
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	99.31
PRK11608		326	pspF phage shock protein operon transcriptional ac	99.31
COG2204		464	AtoC Response regulator containing CheY-like recei	99.31
PRK05642		234	DNA replication initiation factor; Validated	99.31
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	99.31
COG3604		550	FhlA Transcriptional regulator containing GAF, AAA	99.3
PRK15424		538	propionate catabolism operon regulatory protein Pr	99.29
PRK05707		328	DNA polymerase III subunit delta'; Validated	99.29
PRK04132		846	replication factor C small subunit; Provisional	99.29
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	99.28
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	99.28
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	99.28
PRK05917		290	DNA polymerase III subunit delta'; Validated	99.27
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	99.27
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	99.27
PF07726		131	AAA_3: ATPase family associated with various cellu	99.26
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	99.26
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	99.26
PRK08699		325	DNA polymerase III subunit delta'; Validated	99.25
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	99.25
KOG0480		764	consensus DNA replication licensing factor, MCM6 c	99.25
KOG2680		454	consensus DNA helicase TIP49, TBP-interacting prot	99.25
PRK12422		445	chromosomal replication initiation protein; Provis	99.24
COG1221		403	PspF Transcriptional regulators containing an AAA-	99.23
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	99.23
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	99.22
PRK07276		290	DNA polymerase III subunit delta'; Validated	99.22
PRK08769		319	DNA polymerase III subunit delta'; Validated	99.22
PRK00149		450	dnaA chromosomal replication initiation protein; R	99.22
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	99.22
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	99.22
PRK05022		509	anaerobic nitric oxide reductase transcription reg	99.21
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	99.21
COG0606		490	Predicted ATPase with chaperone activity [Posttran	99.2
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	99.2
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	99.19
PRK07993		334	DNA polymerase III subunit delta'; Validated	99.18
PRK14087		450	dnaA chromosomal replication initiation protein; P	99.17
PRK14086		617	dnaA chromosomal replication initiation protein; P	99.15
PRK14088		440	dnaA chromosomal replication initiation protein; P	99.15
PF00493		331	MCM: MCM2/3/5 family This family extends the MCM d	99.15
PRK05818		261	DNA polymerase III subunit delta'; Validated	99.13
KOG1969		877	consensus DNA replication checkpoint protein CHL12	99.13
KOG1942		456	consensus DNA helicase, TBP-interacting protein [R	99.12
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	99.11
KOG0478		804	consensus DNA replication licensing factor, MCM4 c	99.11
COG1241		682	MCM2 Predicted ATPase involved in replication cont	99.11
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	99.11
KOG0990		360	consensus Replication factor C, subunit RFC5 [Repl	99.1
PRK12377		248	putative replication protein; Provisional	99.1
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	99.1
PRK06871		325	DNA polymerase III subunit delta'; Validated	99.1
smart00350		509	MCM minichromosome maintenance proteins.	99.09
PRK06964		342	DNA polymerase III subunit delta'; Validated	99.09
PRK08116		268	hypothetical protein; Validated	99.08
PRK06620		214	hypothetical protein; Validated	99.07
PRK13406		584	bchD magnesium chelatase subunit D; Provisional	99.07
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	99.07
PRK08116		268	hypothetical protein; Validated	99.07
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	99.05
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	99.05
PRK07132		299	DNA polymerase III subunit delta'; Validated	99.05
PRK12377		248	putative replication protein; Provisional	99.04
COG1239		423	ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis	99.04
PRK09087		226	hypothetical protein; Validated	99.03
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	99.02
PRK06090		319	DNA polymerase III subunit delta'; Validated	99.01
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	98.98
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	98.96
PRK08699		325	DNA polymerase III subunit delta'; Validated	98.96
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	98.95
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	98.94
smart00382		148	AAA ATPases associated with a variety of cellular	98.94
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	98.94
PRK09862		506	putative ATP-dependent protease; Provisional	98.94
PRK06526		254	transposase; Provisional	98.94
PRK08181		269	transposase; Validated	98.93
PRK07952		244	DNA replication protein DnaC; Validated	98.93
KOG1808		1856	consensus AAA ATPase containing von Willebrand fac	98.92
PF13173		128	AAA_14: AAA domain	98.91
PTZ00111		915	DNA replication licensing factor MCM4; Provisional	98.91
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	98.91
smart00382		148	AAA ATPases associated with a variety of cellular	98.9
PRK08181		269	transposase; Validated	98.89
PRK13765		637	ATP-dependent protease Lon; Provisional	98.88
COG1484		254	DnaC DNA replication protein [DNA replication, rec	98.87
PRK06835		329	DNA replication protein DnaC; Validated	98.87
KOG0481		729	consensus DNA replication licensing factor, MCM5 c	98.86
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	98.85
PRK07952		244	DNA replication protein DnaC; Validated	98.84
PRK15455		644	PrkA family serine protein kinase; Provisional	98.83
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	98.82
PRK05917		290	DNA polymerase III subunit delta'; Validated	98.82
PF12774		231	AAA_6: Hydrolytic ATP binding site of dynein motor	98.8
PRK09183		259	transposase/IS protein; Provisional	98.8
PRK15115		444	response regulator GlrR; Provisional	98.79
PRK06581		263	DNA polymerase III subunit delta'; Validated	98.79
PRK06835		329	DNA replication protein DnaC; Validated	98.79
KOG2680		454	consensus DNA helicase TIP49, TBP-interacting prot	98.77
COG5245		3164	DYN1 Dynein, heavy chain [Cytoskeleton]	98.76
TIGR01818		463	ntrC nitrogen regulation protein NR(I). This model	98.74
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	98.74
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	98.73
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	98.73
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	98.71
COG1484		254	DnaC DNA replication protein [DNA replication, rec	98.71
PRK06921		266	hypothetical protein; Provisional	98.7
KOG0477		854	consensus DNA replication licensing factor, MCM2 c	98.7
KOG1514		767	consensus Origin recognition complex, subunit 1, a	98.7
PRK06526		254	transposase; Provisional	98.7
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	98.7
COG0593		408	DnaA ATPase involved in DNA replication initiation	98.69
COG3283		511	TyrR Transcriptional regulator of aromatic amino a	98.69
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	98.67
PF12774		231	AAA_6: Hydrolytic ATP binding site of dynein motor	98.66
PF13173		128	AAA_14: AAA domain	98.66
PF05729		166	NACHT: NACHT domain	98.66
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	98.64
PRK07132		299	DNA polymerase III subunit delta'; Validated	98.63
PRK08939		306	primosomal protein DnaI; Reviewed	98.62
KOG0482		721	consensus DNA replication licensing factor, MCM7 c	98.62
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	98.61
PRK06921		266	hypothetical protein; Provisional	98.61
PRK10365		441	transcriptional regulatory protein ZraR; Provision	98.59
PRK08939		306	primosomal protein DnaI; Reviewed	98.57
KOG0479		818	consensus DNA replication licensing factor, MCM3 c	98.57
PRK07276		290	DNA polymerase III subunit delta'; Validated	98.55
PRK05818		261	DNA polymerase III subunit delta'; Validated	98.54
PRK09183		259	transposase/IS protein; Provisional	98.54
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	98.52
PF05729		166	NACHT: NACHT domain	98.52
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	98.51
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	98.5
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	98.5
PRK15455		644	PrkA family serine protein kinase; Provisional	98.49
PHA00729		226	NTP-binding motif containing protein	98.46
COG3284		606	AcoR Transcriptional activator of acetoin/glycerol	98.46
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	98.46
TIGR02688		449	conserved hypothetical protein TIGR02688. Members	98.46
PRK13406		584	bchD magnesium chelatase subunit D; Provisional	98.45
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	98.43
KOG3595		1395	consensus Dyneins, heavy chain [Cytoskeleton]	98.43
KOG0478		804	consensus DNA replication licensing factor, MCM4 c	98.42
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	98.39
PRK06851		367	hypothetical protein; Provisional	98.39
KOG1808		1856	consensus AAA ATPase containing von Willebrand fac	98.35

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=4.9e-86  Score=707.45  Aligned_cols=565  Identities=65%  Similarity=1.036  Sum_probs=508.8

Q ss_pred             CCcCCCCCCccCcHHHHHHHHHHhhcCCCCCcEEEcCCCCcHHHHHHHHHHHHhcCCCccccCCCeEEEEechhhhcccc
Q 006289            1 MASAGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAISEGLAQRIVQGDVPQALMNRKLISLDMGALIAGAK   80 (652)
Q Consensus         1 ~~~~~~~~~~ig~~~~i~~l~~~l~~~~~~~iLl~Gp~GtGKT~la~~la~~l~~~~~~~~~~~~~~~~i~~~~~~~~~~   80 (652)
                      +||.+.+||+|||++++++++++|++++++|.+|+|+||+|||.++..+|.++.++++|..+.+..++.+|.+.+..|.+
T Consensus       163 ~Ar~gklDPvIGRd~EI~r~iqIL~RR~KNNPvLiGEpGVGKTAIvEGLA~rIv~g~VP~~L~~~~i~sLD~g~LvAGak  242 (786)
T COG0542         163 LAREGKLDPVIGRDEEIRRTIQILSRRTKNNPVLVGEPGVGKTAIVEGLAQRIVNGDVPESLKDKRIYSLDLGSLVAGAK  242 (786)
T ss_pred             HHhcCCCCCCcChHHHHHHHHHHHhccCCCCCeEecCCCCCHHHHHHHHHHHHhcCCCCHHHcCCEEEEecHHHHhcccc
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccHHHHHHHHHHHHHhhCCCeEEEEcchhhhhcCCCCCc-hhhHHHhHHhhhhcCCeEEEEeeChHHHHhhhhcCHHH
Q 006289           81 YRGEFEDRLKAVLKEVTESEGQIILFIDEIHTVVGAGATNG-AMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPAL  159 (652)
Q Consensus        81 ~~g~~~~~~~~l~~~~~~~~~~~il~iDEi~~l~~~~~~~~-~~~~~~~L~~~l~~~~v~vI~~tn~~~~~~~~~~~~~l  159 (652)
                      |.|+++++++.+++++...+ +.||||||+|.+..++...| ..++.|.|+++|.+|.+.+||+|+..+|++++.-|+++
T Consensus       243 yRGeFEeRlk~vl~ev~~~~-~vILFIDEiHtiVGAG~~~G~a~DAaNiLKPaLARGeL~~IGATT~~EYRk~iEKD~AL  321 (786)
T COG0542         243 YRGEFEERLKAVLKEVEKSK-NVILFIDEIHTIVGAGATEGGAMDAANLLKPALARGELRCIGATTLDEYRKYIEKDAAL  321 (786)
T ss_pred             ccCcHHHHHHHHHHHHhcCC-CeEEEEechhhhcCCCcccccccchhhhhHHHHhcCCeEEEEeccHHHHHHHhhhchHH
Confidence            99999999999999999877 89999999999999988766 58899999999999999999999999999999999999


Q ss_pred             HcccccccccCCCHHHHHHHHHHHHHhhhhhcCCCCChHHHHHHHHHhhhhhcCCCChhhHHHHHHHHHHHhhhhhcCCc
Q 006289          160 ERRFQQVYVDQPNVEDTISILRGLRERYELHHGVRISDSALVEAAILSDRYISGRFLPDKAIDLVDEAAAKLKMEITSKP  239 (652)
Q Consensus       160 ~~Rf~~i~~~~p~~~~~~~il~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~  239 (652)
                      .|||+.|.+..|+.++...||+.+.++|+.+|++.++++++.+.+.++.+|++++++|+++++++|+++++.++... .|
T Consensus       322 ~RRFQ~V~V~EPs~e~ti~ILrGlk~~yE~hH~V~i~D~Al~aAv~LS~RYI~dR~LPDKAIDLiDeA~a~~~l~~~-~p  400 (786)
T COG0542         322 ERRFQKVLVDEPSVEDTIAILRGLKERYEAHHGVRITDEALVAAVTLSDRYIPDRFLPDKAIDLLDEAGARVRLEID-KP  400 (786)
T ss_pred             HhcCceeeCCCCCHHHHHHHHHHHHHHHHHccCceecHHHHHHHHHHHHhhcccCCCCchHHHHHHHHHHHHHhccc-CC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999988 99


Q ss_pred             hhHHHHHHHHHHHHHHHhhcccCcchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 006289          240 TALDEINRSVLKLEMERLSLTNDTDKASKDRLNRLEAELSLLKERQAQLTEQWEHEKTVMTRIQSIKEEIDRVNLEIQQA  319 (652)
Q Consensus       240 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~e~~~l~~~~~~l~~~~~~~~~~l~~~~~~~e~~~~~~~~~~~~  319 (652)
                      ..+..+++++.+++.+...+..+.+.                            ++.........++       .     
T Consensus       401 ~~l~~~~~~~~~l~~e~~~~~~e~~~----------------------------~~k~~~~~~~~~~-------~-----  440 (786)
T COG0542         401 EELDELERELAQLEIEKEALEREQDE----------------------------KEKKLIDEIIKLK-------E-----  440 (786)
T ss_pred             cchhHHHHHHHHHHHHHHHHhhhhhH----------------------------HHHHHHHHHHHHh-------h-----
Confidence            99999999999888777665544330                            0000000000000       0     


Q ss_pred             HHhhhHHHHHHhhhcChHHHHHHHHHHHHHHHHhhhhcccccccccchhhHHHHHHHHhCCCCcccchHHHHHHHHHHHH
Q 006289          320 EREYDLNRAAELKYGSLNALQRQLESAEKELNEYISSGKSMLREEVTGSDIAEIVSKWTGIPVSKLQQSEREKLLHLEEE  399 (652)
Q Consensus       320 ~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  399 (652)
                                    +.++.+.+++..                  .++.+++.+++..|+|+|..++...+...+..+++.
T Consensus       441 --------------~~~~~~~~~~~~------------------~v~~~~Ia~vv~~~TgIPv~~l~~~e~~kll~le~~  488 (786)
T COG0542         441 --------------GRIPELEKELEA------------------EVDEDDIAEVVARWTGIPVAKLLEDEKEKLLNLERR  488 (786)
T ss_pred             --------------hhhhhHHHHHhh------------------ccCHHHHHHHHHHHHCCChhhhchhhHHHHHHHHHH
Confidence                          011111222111                  188899999999999999999999999999999999


Q ss_pred             hhhhccCchHHHHHHHHHHHHhhcCCCCCCCCceEEEEeccCCCchHHHHHHHHHHhccCCCceEEeccccccchhhhhh
Q 006289          400 LHKRVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSR  479 (652)
Q Consensus       400 ~~~~i~g~~~~~~~l~~~l~~~~~~~~~~~~~~~~~Ll~GppG~GKT~la~~la~~~~~~~~~~~~~~~~~~~~~~~~~~  479 (652)
                      +...|+||++++..+.+++++.+.|+..|++|+|++||.||+|||||.+|+++|..+|+....++++++++|++.+.+++
T Consensus       489 L~~rViGQd~AV~avs~aIrraRaGL~dp~rPigsFlF~GPTGVGKTELAkaLA~~Lfg~e~aliR~DMSEy~EkHsVSr  568 (786)
T COG0542         489 LKKRVIGQDEAVEAVSDAIRRARAGLGDPNRPIGSFLFLGPTGVGKTELAKALAEALFGDEQALIRIDMSEYMEKHSVSR  568 (786)
T ss_pred             HhcceeChHHHHHHHHHHHHHHhcCCCCCCCCceEEEeeCCCcccHHHHHHHHHHHhcCCCccceeechHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999889999999999999999999


Q ss_pred             hcCCCCCccccccccchhHHHhhCCCeEEEEeCCcccCHHHHHHHHHhhcCceeecCCCceeecCCeEEEEecCcChHHh
Q 006289          480 LIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYI  559 (652)
Q Consensus       480 ~~g~~~~~~~~~~~~~l~~~~~~~~~~vl~iDEid~l~~~~~~~Ll~~le~~~~~~~~g~~~~~~~~~~I~ttn~~~~~~  559 (652)
                      ++|+++|||||.+++.|++++++.|++||+||||++++|+++|.||++||+|+++|..|+++++.|+++|+|||.|+..+
T Consensus       569 LIGaPPGYVGyeeGG~LTEaVRr~PySViLlDEIEKAHpdV~nilLQVlDdGrLTD~~Gr~VdFrNtiIImTSN~Gs~~i  648 (786)
T COG0542         569 LIGAPPGYVGYEEGGQLTEAVRRKPYSVILLDEIEKAHPDVFNLLLQVLDDGRLTDGQGRTVDFRNTIIIMTSNAGSEEI  648 (786)
T ss_pred             HhCCCCCCceeccccchhHhhhcCCCeEEEechhhhcCHHHHHHHHHHhcCCeeecCCCCEEecceeEEEEecccchHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             hhcCCCCCCccchHHHHHHHHHHHHhhcCChhhhhccCcEEEcCCCCHHHHHHHHHHHHHHHHhhcccC--CccccHHHH
Q 006289          560 LNMDDETFPKETAYETIKQRVMDAARSIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQVSFSKVSWIYS--PWHFNYEML  637 (652)
Q Consensus       560 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~R~~~~i~~~~~~~~~~~~i~~~~l~~~~~~~~~~--~~~~~~~~l  637 (652)
                      ......  .....++.+.+.+...++..|+|+|++|+|.+|+|.|++.+++.+|+..+|.++...+...  ...++.++.
T Consensus       649 ~~~~~~--~~~~~~~~~~~~v~~~l~~~F~PEFLNRid~II~F~~L~~~~l~~Iv~~~L~~l~~~L~~~~i~l~~s~~a~  726 (786)
T COG0542         649 LRDADG--DDFADKEALKEAVMEELKKHFRPEFLNRIDEIIPFNPLSKEVLERIVDLQLNRLAKRLAERGITLELSDEAK  726 (786)
T ss_pred             Hhhccc--cccchhhhHHHHHHHHHHhhCCHHHHhhcccEEeccCCCHHHHHHHHHHHHHHHHHHHHhCCceEEECHHHH
Confidence            875322  2224467778888889999999999999999999999999999999999999998877643  234667665


Q ss_pred             HHhc
Q 006289          638 VKFC  641 (652)
Q Consensus       638 ~~~~  641 (652)
                      .++.
T Consensus       727 ~~l~  730 (786)
T COG0542         727 DFLA  730 (786)
T ss_pred             HHHH
Confidence            5554

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism]	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>TIGR01818 ntrC nitrogen regulation protein NR(I)	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription]	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PRK10365 transcriptional regulatory protein ZraR; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only]	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair]	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK09862 putative ATP-dependent protease; Provisional	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]	Back alignment and domain information

>PTZ00111 DNA replication licensing factor MCM4; Provisional	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair]	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair]	Back alignment and domain information

>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07276 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite	Back alignment and domain information

>PRK05818 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair]	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair]	Back alignment and domain information

>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair]	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK13406 bchD magnesium chelatase subunit D; Provisional	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>PRK09862 putative ATP-dependent protease; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PTZ00111 DNA replication licensing factor MCM4; Provisional	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair]	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>PRK06581 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton]	Back alignment and domain information

>TIGR01818 ntrC nitrogen regulation protein NR(I)	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair]	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism]	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair]	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK10365 transcriptional regulatory protein ZraR; Provisional	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair]	Back alignment and domain information

>PRK07276 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05818 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription]	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>TIGR02688 conserved hypothetical protein TIGR02688	Back alignment and domain information

>PRK13406 bchD magnesium chelatase subunit D; Provisional	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>KOG3595 consensus Dyneins, heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair]	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

Homologous Structure Templates