Citrus Sinensis ID: 006296

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-
MCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDAPFPFPCLETLRFENMREWEDWIPLRSGQGVEGFPKLRELHLISCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKEVVWESATDHLGSQNSEVCRETSNQVFLAGPLKPRLPKLEELKINDMKEQTYIWKSHNELLQDICSLRRLTIDSCPKLQSLVAEEEKDQQQQLCELSCELEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYGCSSLVSFPEVALPSKLKTIKIREYDALKSLPEAWTCDTNSSLETLYIEHCRTLTYLAGVQLPRSLKRLDILSCDNIRTLTVEEGIQSSSGSRRHTSYLLEKLEIWNCRSLTCIFSKNELPATLESLEVGNLPPSLKSLRVERCSKLESIAERLDNNTSLETINIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALPKGLHNLTSLQELTIIGGELPSLEEDGLPTNLHSLDIRGNMEIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPKADDKGSGTALPLPASLTSLWIEDFPNLERLSSSIVDLQNLTILYLVECRKLKYFPDKGLPSSLLKLYIYGCPLITEKCRKDGGQYWDLLTHIPSVF
cccccccccccccccccEEEcccccEEEcccccccccccccccccEEEEcccccccccccccccccccccccccEEEEEcccccccccccccccccEEEEEccccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEEEccccccccHHHHHHHHcccccccEEEcccccccccccHHHHHHHHHHHccccccccEEEEEcccccEEccccccccccccEEEEEcccccEEcccccccccccEEEEEcccccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccEEEEEcccccccHHccccccccccEEEEEcccccEEccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccEEEEcccccHHHHHHHccccccccccccEEEEEcccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEccccHHHHHcccccccccccccccccccc
cccccccccccccccEEEEccccccEEccHHHcccccccccHHHcEEEccccHHHHHccccccccccccccccEEEEEcccccccccccccccccEEEEEcccccccccccccccccEEEcccccccccccccccccHHHHHHHHcccccccccccHccccccccEEEEccccccccccHHHHHHccccccccEEEccccccHccccccccccccccccccccccEEEEEcccccHcccccccccccccEEEEEcccccccccccccccccccEEEEcccccHccccHHcccccccccEEEEEcccccccccccccccccccEEEEcccccHccccHHcccHHHHHHHHcccccccEccccccccHHHcHHHcccccccccccccccccccEEEEEcccccHHcccHHccccccccEEEEcccccHccccccccccccccEEEEcccccHccccccccccccccEEEEccccHHHcccccccccccccEEEEccccccccccccccccHHHEEEccHHHHHHHHHHccccccccccccEEEEcccccHccccccccccHHccHHccccccccEEEEcccccHHHccHHccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHccccccccccccccccccc
mctalpsvgqlpslkhlAVCGMSRVkrlgsefygndapfpfpcletlrfenmrewedwiplrsgqgvegfpklRELHLISCSklqgtfpehlPALQMLVIQECKELLVSITSLPALCKLEIDGCKEVVWESAtdhlgsqnsevcretsnqvflagplkprlpkleelkinDMKEQTYIWKSHNELLQDICSLrrltidscpklQSLVAEEEKDQQQQLCELSCELEYLRLRYCEGLvklpqsslslsslkeIEIYGcsslvsfpevalpsklktiKIREYDAlkslpeawtcdtnssletLYIEHCRTLTYLagvqlprslkrldilscdniRTLTVEegiqsssgsrrhtSYLLEKLEiwncrsltcifsknelpatleslevgnlppslksLRVERCSKLESIAErldnntsletiniwrcenlkflpsgLHNLRQLQEIHiwncgnlvsfpegglpcakltrltihdckrlealpkglhnltSLQELTiiggelpsleedglptnlhsldiRGNMEIWKSMIERgrgfhrfsSLRHLtisgcdddmvsfppkaddkgsgtalplpasltslwiedfpnlerlsssivdlqNLTILYLVECrklkyfpdkglpssLLKLYIYgcplitekcrkdggqYWDLlthipsvf
mctalpsvgqlpslkhlAVCGMSRVKRLGSefygndapfpFPCLETLRFENMREWEDWIPLRSGQGVEGFPKLRELHLISCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKEVVWESATDHLGSQNSEVCRETSNQvflagplkprlpkleELKINDMKEQTYIWKSHNELLQDICSLRRLTIDSCPKLQSLVAEEEKDQQQQLCELSCELEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYGCSSLVSFPEVALPSKLKTIKIREYDalkslpeawtcdtnSSLETLYIEHCRTLTYLAGVQLPRSLKRLDILSCDNIRTLTveegiqsssgsrrhTSYLLEKLEIWNCRSLTCIFSKNELpatleslevgnlppslkSLRVERCSKLESiaerldnntsletinIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALPKGLHNLTSLQELTIIGGELPSLEEDGLPTNLHSLDIRGNMEIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPKADDKGSGTALPLPASLTSLWIEDFPNLERLSSSIVDLQNLTILYLVECRKLKYFPDKGLPSSLLKLYIYGCPLITEKCRKDGGQYWDLLTHIPSVF
MCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDAPFPFPCLETLRFENMREWEDWIPLRSGQGVEGFPKLRELHLISCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKEVVWESATDHLGSQNSEVCRETSNQVFLAGplkprlpkleelkINDMKEQTYIWKSHNELLQDICSLRRLTIDSCPKLQSLVAEEEKDqqqqlcelsceleylrlryCEGLVKLPQsslslsslKEIEIYGCSSLVSFPEVALPSKLKTIKIREYDALKSLPEAWTCDTNSSLETLYIEHCRTLTYLAGVQLPRSLKRLDILSCDNIRTLTVEEGIQSSSGSRRHTSYLLEKLEIWNCRSLTCIFSKNELPATLESLEVGNLPPSLKSLRVERCSKLESIAERLDNNTSLETINIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALPKGLHNLTSLQELTIIGGELPSLEEDGLPTNLHSLDIRGNMEIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPKADDKGSGTALPLPASLTSLWIEDFPNLERLSSSIVDLQNLTILYLVECRKLKYFPDKGLPSSLLKLYIYGCPLITEKCRKDGGQYWDLLTHIPSVF
***********PSLKHLAVCGMSRVKRLGSEFYGNDAPFPFPCLETLRFENMREWEDWIPLRSGQGVEGFPKLRELHLISCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKEVVWESATDHLG*****VCRETSNQVFLAGPLKPRLPKLEELKINDMKEQTYIWKSHNELLQDICSLRRLTIDSCPKLQSLVA*******QQLCELSCELEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYGCSSLVSFPEVALPSKLKTIKIREYDALKSLPEAWTCDTNSSLETLYIEHCRTLTYLAGVQLPRSLKRLDILSCDNIRTLTVEEGI********HTSYLLEKLEIWNCRSLTCIFSKNELPATLESLEVGN*******LRVERCSKLESIAERLDNNTSLETINIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALPKGLHNLTSLQELTIIGGELPSLEEDGLPTNLHSLDIRGNMEIWKSMIERGRGFHRF**********************************ASLTSLWIEDFPNLERLSSSIVDLQNLTILYLVECRKLKYFPDKGLPSSLLKLYIYGCPLITEKCRKDGGQYWDLLTHI****
MCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDAPFPFPCLETLRFENMREWEDWIPLRSGQGVEGFPKLRELHLISCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKE*****************CRETSN************PKLEELKINDMKEQTYIW***********SLRRLTIDSCPKLQSLVAEEEKDQQQQLCELSCELEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYGCSSLVSFPE*****KLKTIKIREYDALKSLPEAWTCDTNSSLETLYIEHCRTLTYLAGVQLPRSLKRLDILSCDNIRTLTV**************SYLLEKLEIWNCRSLTCIFSKNELPATLESLEVGNLPPSLKSLRVERCSKLESIAERLDNNTSLETINIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALPKGLHNLTSLQELTIIGGELPSLEEDGLPTNLHSLDIRGNMEIWKSMIE*GRGFHRFSSLRHLTISGCDDDMVSFPPKADDKGSGTALPLPASLTSLWIEDFPNLERLSSSIVDLQNLTILYLVECRKLKYFPDKGLPSSLLKLYIYGCPLITEKCRKDGGQYWDLLTHIPSVF
MCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDAPFPFPCLETLRFENMREWEDWIPLRSGQGVEGFPKLRELHLISCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKEVVWESATDHLGSQNSEVCRETSNQVFLAGPLKPRLPKLEELKINDMKEQTYIWKSHNELLQDICSLRRLTIDSCPKLQSLVA********QLCELSCELEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYGCSSLVSFPEVALPSKLKTIKIREYDALKSLPEAWTCDTNSSLETLYIEHCRTLTYLAGVQLPRSLKRLDILSCDNIRTLTVEEG*********HTSYLLEKLEIWNCRSLTCIFSKNELPATLESLEVGNLPPSLKSLRVERCSKLESIAERLDNNTSLETINIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALPKGLHNLTSLQELTIIGGELPSLEEDGLPTNLHSLDIRGNMEIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPKADDKGSGTALPLPASLTSLWIEDFPNLERLSSSIVDLQNLTILYLVECRKLKYFPDKGLPSSLLKLYIYGCPLITEKCRKDGGQYWDLLTHIPSVF
*CTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDAPFPFPCLETLRFENMREWEDWIPLRSGQGVEGFPKLRELHLISCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKEVVWESATDHLGSQNSEVCRETSNQVFLAGPLKPRLPKLEELKINDMKEQTYIWKSHNELLQDICSLRRLTIDSCPKLQSLVAEEEKDQQQQLCELSCELEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYGCSSLVSFPEVALPSKLKTIKIREYDALKSLPEAWTCDTNSSLETLYIEHCRTLTYLAGVQLPRSLKRLDILSCDNIRTLTVEEGIQSSSGSRRHTSYLLEKLEIWNCRSLTCIFSKNELPATLESLEVGNLPPSLKSLRVERCSKLESIAERLDNNTSLETINIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALPKGLHNLTSLQELTIIGGELPSLEEDGLPTNLHSLDIRGNMEIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPKADDKGSGTALPLPASLTSLWIEDFPNLERLSSSIVDLQNLTILYLVECRKLKYFPDKGLPSSLLKLYIYGCPLITEKCRKDGGQYWDLLTHIPSVF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDAPFPFPCLETLRFENMREWEDWIPLRSGQGVEGFPKLRELHLISCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKEVVWESATDHLGSQNSEVCRETSNQVFLAGPLKPRLPKLEELKINDMKEQTYIWKSHNELLQDICSLRRLTIDSCPKLQSLVAEEEKDQQQQLCELSCELEYLRLRYCEGLVKLPQSSLSLSSLKEIEIYGCSSLVSFPEVALPSKLKTIKIREYDALKSLPEAWTCDTNSSLETLYIEHCRTLTYLAGVQLPRSLKRLDILSCDNIRTLTVEEGIQSSSGSRRHTSYLLEKLEIWNCRSLTCIFSKNELPATLESLEVGNLPPSLKSLRVERCSKLESIAERLDNNTSLETINIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALPKGLHNLTSLQELTIIGGELPSLEEDGLPTNLHSLDIRGNMEIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPKADDKGSGTALPLPASLTSLWIEDFPNLERLSSSIVDLQNLTILYLVECRKLKYFPDKGLPSSLLKLYIYGCPLITEKCRKDGGQYWDLLTHIPSVF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query651 2.2.26 [Sep-21-2011]
Q9LRR51424 Putative disease resistan yes no 0.496 0.226 0.298 4e-22
Q9LRR41054 Putative disease resistan no no 0.339 0.209 0.306 4e-17
O23530 1301 Protein SUPPRESSOR OF npr no no 0.620 0.310 0.260 1e-10
Q7XA39988 Putative disease resistan N/A no 0.293 0.193 0.296 1e-09
Q7XBQ9970 Disease resistance protei N/A no 0.256 0.172 0.333 1e-09
P23799630 Putative adenylate cyclas N/A no 0.645 0.666 0.239 2e-08
P0CB16 1201 Putative disease resistan no no 0.407 0.220 0.278 4e-08
P26337630 Putative adenylate cyclas N/A no 0.437 0.452 0.238 4e-07
Q9LVT1623 Putative disease resistan no no 0.159 0.166 0.258 3e-06
Q9LZ25811 Probable disease resistan no no 0.187 0.150 0.271 3e-06
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score =  107 bits (266), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 116/388 (29%), Positives = 181/388 (46%), Gaps = 65/388 (16%)

Query: 268  LPSKLKTIKIREYDALKSLPEAWTCDTNSSLETLYIEHCRTLTYLAGVQLPRSLKRLDIL 327
            LP  L+++ I   D L SLPE  T ++  +L  L I  C +L    G   P +LK L I 
Sbjct: 1089 LPQNLQSLHIDSCDGLTSLPENLT-ESYPNLHELLIIACHSLESFPGSHPPTTLKTLYIR 1147

Query: 328  SCDNIRTLTVEEGIQSSSGSRRHTSYLLEKLEIWN-CRSLTCIFSKNELPATLESLEVGN 386
             C   + L   E +Q +   R ++   LE L I + C +L         P +L       
Sbjct: 1148 DC---KKLNFTESLQPT---RSYSQ--LEYLFIGSSCSNLV------NFPLSLF------ 1187

Query: 387  LPPSLKSLRVERCSKLESIAERLDNNTSLETINIWRCENLKFLPSGLHNLR-QLQEIHIW 445
              P L+SL +  C   ++ +                      + +GL + R  L+ + I 
Sbjct: 1188 --PKLRSLSIRDCESFKTFS----------------------IHAGLGDDRIALESLEIR 1223

Query: 446  NCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALPKGLHNLTSLQELTIIG-GELPSLEEDG 504
            +C NL +FP+GGLP  KL+ + + +CK+L+ALP+ L  LTSL  L II   E+ ++   G
Sbjct: 1224 DCPNLETFPQGGLPTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIETIPGGG 1283

Query: 505  LPTNLHSLDIRGNMEIWKSMIERGR-GFHRFSSLRHLTISGCDDDMVSFPPKADDKGSGT 563
             P+NL +L I     +   +  R   G     +LR+L I G ++D+ SFP +        
Sbjct: 1284 FPSNLRTLCI----SLCDKLTPRIEWGLRDLENLRNLEIDGGNEDIESFPEEG------- 1332

Query: 564  ALPLPASLTSLWIEDFPNLERLS-SSIVDLQNLTILYLVECRKLKYFPDKGLPSSLLKLY 622
               LP S+ SL I  F NL+ L+     D + +  + +  C KL+   D+ LP  L  L 
Sbjct: 1333 --LLPKSVFSLRISRFENLKTLNRKGFHDTKAIETMEISGCDKLQISIDEDLP-PLSCLR 1389

Query: 623  IYGCPLITEKCRKDGGQYWDLLTHIPSV 650
            I  C L+TE   +   +++ +L +IP V
Sbjct: 1390 ISSCSLLTETFAEVETEFFKVL-NIPYV 1416
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|P23799|ESAG8_TRYBB Putative adenylate cyclase regulatory protein OS=Trypanosoma brucei brucei GN=ESAG8 PE=2 SV=1 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|P26337|ESA8C_TRYEQ Putative adenylate cyclase regulatory protein OS=Trypanosoma equiperdum GN=ESAG8C PE=2 SV=1 Back     alignment and function description
>sp|Q9LVT1|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1 Back     alignment and function description
>sp|Q9LZ25|DRL30_ARATH Probable disease resistance protein At5g04720 OS=Arabidopsis thaliana GN=At5g04720 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query651
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.890 0.407 0.375 1e-89
45826061739 resistance protein [Quercus suber] 0.878 0.774 0.376 5e-88
400131587 1388 FB_MR5 [Malus x robusta] 0.860 0.403 0.379 5e-87
356554923 1399 PREDICTED: putative disease resistance R 0.860 0.400 0.363 5e-85
225449649 1418 PREDICTED: putative disease resistance p 0.904 0.415 0.370 1e-79
224132254552 predicted protein [Populus trichocarpa] 0.784 0.925 0.402 3e-79
359495024 1390 PREDICTED: putative disease resistance p 0.886 0.415 0.365 4e-75
359495026 2204 PREDICTED: uncharacterized protein LOC10 0.861 0.254 0.365 4e-74
359487255 1336 PREDICTED: putative disease resistance p 0.791 0.385 0.352 2e-73
147860511 1406 hypothetical protein VITISV_014536 [Viti 0.817 0.378 0.373 2e-72
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
 Score =  337 bits (864), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 253/674 (37%), Positives = 346/674 (51%), Gaps = 94/674 (13%)

Query: 2    CTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDAPFPFPCLETLRFENMREWEDWIPL 61
            C +LP VGQLP LK L + GM+ VK +G EFYG     PF  LETL FE+M  W +WIPL
Sbjct: 800  CNSLPPVGQLPFLKDLLIKGMAGVKSVGREFYGESCSRPFQSLETLHFEDMPRWVNWIPL 859

Query: 62   RSGQGV-EGFPKLRELHLISCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLE 120
                GV E F  L +L +I C  L    P+HLP+L+ LVI  C  ++VS+++LP LC L 
Sbjct: 860  ----GVNEAFACLHKLSIIRCHNLVRKLPDHLPSLKKLVIHGCWNMVVSVSNLPMLCVLV 915

Query: 121  IDGCKEVVWESATDHLGSQNSEVCRETSNQVFLAGPLKPRLPKLEELKINDMKEQTYIWK 180
            I+GCK V  ES+    GS  S    + S        L   + K+E LKI D ++ T +W+
Sbjct: 916  IEGCKRVECESSVG-FGSPYSMAFSKISEFGNATAGLMHGVSKVEYLKIVDSEKLTTLWE 974

Query: 181  SHNELLQDICSLRRLTIDSCPKLQSLVAEEEKDQQQQLCELSCELEYLRLRYCEGLVKLP 240
               E L  +  LR L+I+ CP                                  LV  P
Sbjct: 975  KIPEGLHRLKFLRELSIEDCPT---------------------------------LVSFP 1001

Query: 241  QSSLSLSSLKEIEIYGCSSLVS-FPEVALPSKLKTIKIREYDALKSLPEAWTCDTNSSLE 299
             S    S LK I+I  CS L S  PE  L S+                       N+ LE
Sbjct: 1002 ASGFP-SMLKVIQIKSCSGLKSLLPEGTLHSR----------------------ENACLE 1038

Query: 300  TLYIEHCRTLTYLAGVQLPRSLKRLDILSCDNIRTL-------TVEEGIQSSSGSRRHTS 352
             L +  C ++  +A  QLP +LK+L+I  C N++ +       +   G+     + R  +
Sbjct: 1039 RLCVVRCDSMKSIARGQLPTTLKKLEISHCMNLQCVLDEGEGSSSSSGMHDEDINNRSKT 1098

Query: 353  YLLEKLEIWNCRSLTCIFSKNELPATLESL------------EVGNLPPSLKSLRVERCS 400
            + L+ L+I +C SLT + S  +LPATL  L              G LP +L+ L ++  S
Sbjct: 1099 H-LQYLDIKSCPSLTTLTSSGKLPATLTHLLLRECPKLMCLSSTGKLPAALQYLEIQSIS 1157

Query: 401  KLESIAERLDNNTSLETINIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPC 460
            KL+ IAERL  NTSLE I IW C  LK LP  LHNL +L++  I+ C +  SFP  GLP 
Sbjct: 1158 KLQKIAERLHQNTSLECIKIWNCHGLKSLPEDLHNLSKLRQFLIFWCQSFSSFPAAGLP- 1216

Query: 461  AKLTRLTIHDCKRLEALPKGLHNLTSLQELTIIG--GELPSLEEDGLPTNLHSLDIRGNM 518
            + L  L I +CK L+ALP G+ NLTSLQ+L I      LPS +E GLPTNL  L++  ++
Sbjct: 1217 SNLRVLGIKNCKNLKALPNGMRNLTSLQKLDISHRLDSLPSPQE-GLPTNLIELNMH-DL 1274

Query: 519  EIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPKADDKGSGTALPLPASLTSLWIED 578
            + +K M E   G  + +SL  L+I G   D+ S+P    ++ +G  + LP SL+ L I  
Sbjct: 1275 KFYKPMFE--WGLQQPTSLIKLSIHGECLDVDSYP---GERENGVMMLLPNSLSILCISY 1329

Query: 579  FPNLERLS-SSIVDLQNLTILYLVECRKLKYFPDKGLPSSLLKLYIYGCPLITEKCRKDG 637
            F NLE LS     +L +L  L +  C KL   P +GLP SL +L I  CPL+++ C  + 
Sbjct: 1330 FQNLECLSPKGFQNLTSLNQLKIYNCLKLTSLPKEGLPPSLTQLEIRNCPLLSQHCNNEK 1389

Query: 638  GQYWDLLTHIPSVF 651
            GQ W  + HIP V 
Sbjct: 1390 GQEWSKIAHIPCVL 1403

Source: Quercus suber

Species: Quercus suber

Genus: Quercus

Family: Fagaceae

Order: Fagales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|45826061|gb|AAS77675.1| resistance protein [Quercus suber] Back     alignment and taxonomy information
>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224132254|ref|XP_002328223.1| predicted protein [Populus trichocarpa] gi|222837738|gb|EEE76103.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359495024|ref|XP_002267933.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495026|ref|XP_003634900.1| PREDICTED: uncharacterized protein LOC100854556 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487255|ref|XP_002269744.2| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147860511|emb|CAN79726.1| hypothetical protein VITISV_014536 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query651
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.522 0.238 0.311 4.4e-35
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.155 0.095 0.425 7.5e-20
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.497 0.163 0.248 1.4e-15
TAIR|locus:2163426 1187 TAO1 "target of AVRB operation 0.457 0.251 0.278 1.3e-13
TAIR|locus:2098110 1219 AT3G44670 [Arabidopsis thalian 0.313 0.167 0.308 2.2e-12
TAIR|locus:21479921189 AT5G11250 [Arabidopsis thalian 0.531 0.291 0.263 1.2e-11
TAIR|locus:2053405 1215 AT2G14080 [Arabidopsis thalian 0.536 0.287 0.268 2e-11
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.563 0.283 0.245 2.2e-11
TAIR|locus:2151506 1127 RPS6 "RESISTANT TO P. SYRINGAE 0.403 0.233 0.281 1.3e-10
TAIR|locus:2170408 1139 AT5G46270 [Arabidopsis thalian 0.379 0.216 0.267 2.3e-10
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 285 (105.4 bits), Expect = 4.4e-35, Sum P(2) = 4.4e-35
 Identities = 122/392 (31%), Positives = 198/392 (50%)

Query:   278 REYDALKSLPEAWTCDTNSSLETLYIEHCRTLTYLAGVQLPRSLKRLDILSCDNIRTLTV 337
             R  +A+K  P  +  D  + +E L +     +++L  ++LP++L+ L I SCD + +L  
Sbjct:  1058 RSSEAIK--PSQYD-DDETDMEYLKVTD---ISHL--MELPQNLQSLHIDSCDGLTSLP- 1108

Query:   338 EEGIQSSSGSRRHTSYLLEKLEIWNCRSLTCIFSKNELPATLESLEVGNLPPS--LKSLR 395
              E +  S  +       L +L I  C SL   F  +  P TL++L + +       +SL+
Sbjct:  1109 -ENLTESYPN-------LHELLIIACHSLES-FPGSHPPTTLKTLYIRDCKKLNFTESLQ 1159

Query:   396 VERC-SKLE-----SIAERLDNNT-----SLETINIWRCENLK-F-LPSGLHNLR-QLQE 441
               R  S+LE     S    L N        L +++I  CE+ K F + +GL + R  L+ 
Sbjct:  1160 PTRSYSQLEYLFIGSSCSNLVNFPLSLFPKLRSLSIRDCESFKTFSIHAGLGDDRIALES 1219

Query:   442 IHIWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALPKGLHNLTSLQELTIIG-GELPSL 500
             + I +C NL +FP+GGLP  KL+ + + +CK+L+ALP+ L  LTSL  L II   E+ ++
Sbjct:  1220 LEIRDCPNLETFPQGGLPTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIETI 1279

Query:   501 EEDGLPTNLHSLDIRGNMEIWKSMIERGR-GFHRFSSLRHLTISGCDDDMVSFPPKADDK 559
                G P+NL +L I     +   +  R   G     +LR+L I G ++D+ SFP    ++
Sbjct:  1280 PGGGFPSNLRTLCI----SLCDKLTPRIEWGLRDLENLRNLEIDGGNEDIESFP----EE 1331

Query:   560 GSGTALPLPASLTSLWIEDFPNLERLS-SSIVDLQNLTILYLVECRKLKYFPDKGLPSSL 618
             G      LP S+ SL I  F NL+ L+     D + +  + +  C KL+   D+ LP  L
Sbjct:  1332 GL-----LPKSVFSLRISRFENLKTLNRKGFHDTKAIETMEISGCDKLQISIDEDLPP-L 1385

Query:   619 LKLYIYGCPLITEKCRKDGGQYWDLLTHIPSV 650
               L I  C L+TE   +   +++ +L +IP V
Sbjct:  1386 SCLRISSCSLLTETFAEVETEFFKVL-NIPYV 1416
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151506 RPS6 "RESISTANT TO P. SYRINGAE 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170408 AT5G46270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query651
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-13
PLN03210 1153 PLN03210, PLN03210, Resistant to P 8e-11
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-07
PLN03210 1153 PLN03210, PLN03210, Resistant to P 8e-07
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 72.6 bits (178), Expect = 4e-13
 Identities = 75/262 (28%), Positives = 111/262 (42%), Gaps = 35/262 (13%)

Query: 387 LPPSLKSLRVE----RC-----------------SKLESIAERLDNNTSLETINIWRCEN 425
           LPP L+ LR +    RC                 SKLE + + + + T L  I++   +N
Sbjct: 587 LPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKN 646

Query: 426 LKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALPKGLHNLT 485
           LK +P  L     L+ + + +C +LV  P       KL  L +  C+ LE LP G+ NL 
Sbjct: 647 LKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLK 704

Query: 486 SLQELTIIG-GELPSLEEDGLPTNLHSLDIRGNMEIWKSMIERGRGFHRFSSLRHLTISG 544
           SL  L + G   L S  +  + TN+  LD+        + IE      R  +L  L +  
Sbjct: 705 SLYRLNLSGCSRLKSFPD--ISTNISWLDLDE------TAIEEFPSNLRLENLDELIL-- 754

Query: 545 CDDDMVSFPPKADDKGSGTALPLPASLTSLWIEDFPNLERLSSSIVDLQNLTILYLVECR 604
           C+        +         + L  SLT L++ D P+L  L SSI +L  L  L +  C 
Sbjct: 755 CEMKSEKLWERVQPLTPLMTM-LSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCI 813

Query: 605 KLKYFPDKGLPSSLLKLYIYGC 626
            L+  P      SL  L + GC
Sbjct: 814 NLETLPTGINLESLESLDLSGC 835

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 651
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.84
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.57
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.46
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.42
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.37
KOG4341483 consensus F-box protein containing LRR [General fu 99.33
KOG4237498 consensus Extracellular matrix protein slit, conta 99.28
KOG0617264 consensus Ras suppressor protein (contains leucine 99.28
KOG4341483 consensus F-box protein containing LRR [General fu 99.28
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.21
KOG0617264 consensus Ras suppressor protein (contains leucine 99.2
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.06
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.93
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.83
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.71
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.68
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.66
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.66
PRK15386 426 type III secretion protein GogB; Provisional 98.6
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.59
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.54
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.54
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.52
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.4
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.37
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.36
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.3
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.26
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.19
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.17
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.05
PRK15386426 type III secretion protein GogB; Provisional 98.04
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.01
PLN03150623 hypothetical protein; Provisional 97.97
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.95
PLN03150623 hypothetical protein; Provisional 97.81
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.66
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.65
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.57
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.41
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.4
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.39
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.38
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.36
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.35
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.33
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.11
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.04
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.29
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.27
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.02
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.69
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.49
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.32
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.97
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.79
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.26
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.99
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.16
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.16
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 89.56
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 82.86
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 81.22
smart0037026 LRR Leucine-rich repeats, outliers. 81.22
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.5e-36  Score=351.49  Aligned_cols=414  Identities=17%  Similarity=0.123  Sum_probs=296.7

Q ss_pred             CCCcceEEccccCCceeeecccCcccccccCccEEecCCCCCcccchhhhhhhhhhhhhhccCCccEEeccCCcCccccC
Q 006296          161 LPKLEELKINDMKEQTYIWKSHNELLQDICSLRRLTIDSCPKLQSLVAEEEKDQQQQLCELSCELEYLRLRYCEGLVKLP  240 (651)
Q Consensus       161 ~~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~l~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~  240 (651)
                      +++|+.|.+.++...   . ..+..+.++++|++|++++|.-...++.     .+..+    ++|++|++++|.....+|
T Consensus       187 l~~L~~L~L~~n~l~---~-~~p~~l~~l~~L~~L~L~~n~l~~~~p~-----~l~~l----~~L~~L~L~~n~l~~~~p  253 (968)
T PLN00113        187 LTSLEFLTLASNQLV---G-QIPRELGQMKSLKWIYLGYNNLSGEIPY-----EIGGL----TSLNHLDLVYNNLTGPIP  253 (968)
T ss_pred             CcCCCeeeccCCCCc---C-cCChHHcCcCCccEEECcCCccCCcCCh-----hHhcC----CCCCEEECcCceeccccC
Confidence            455555555554321   1 2334457788888888888743323322     34555    888999998888767788


Q ss_pred             CCcCCCCCcCEEEeeCCCCCcccC-CCCCCCCCcEEEecccccccccCcccccCCCCCccEEEeccCCCcceecCc-cCC
Q 006296          241 QSSLSLSSLKEIEIYGCSSLVSFP-EVALPSKLKTIKIREYDALKSLPEAWTCDTNSSLETLYIEHCRTLTYLAGV-QLP  318 (651)
Q Consensus       241 ~~~~~l~~L~~L~l~~~~~~~~~~-~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~-~~~  318 (651)
                      ..++++++|++|++++|...+.+| .+..+++|++|++++|.....++..+.  .+++|+.|++.+|......+.. ..+
T Consensus       254 ~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~--~l~~L~~L~l~~n~~~~~~~~~~~~l  331 (968)
T PLN00113        254 SSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVI--QLQNLEILHLFSNNFTGKIPVALTSL  331 (968)
T ss_pred             hhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHc--CCCCCcEEECCCCccCCcCChhHhcC
Confidence            888888899999998876544444 356678889999988875556665555  6888899998888744444433 556


Q ss_pred             CCccEEEeeccCCccccccccccccCCCCccccccccceEEEccCCCcccccccCCCchhhhhhhcCCCCccccEEEEec
Q 006296          319 RSLKRLDILSCDNIRTLTVEEGIQSSSGSRRHTSYLLEKLEIWNCRSLTCIFSKNELPATLESLEVGNLPPSLKSLRVER  398 (651)
Q Consensus       319 ~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~  398 (651)
                      ++|+.|++.+|.....+         |..+..+.. |+.|+++++ +++.     .+|..+...      ++++.|++.+
T Consensus       332 ~~L~~L~L~~n~l~~~~---------p~~l~~~~~-L~~L~Ls~n-~l~~-----~~p~~~~~~------~~L~~L~l~~  389 (968)
T PLN00113        332 PRLQVLQLWSNKFSGEI---------PKNLGKHNN-LTVLDLSTN-NLTG-----EIPEGLCSS------GNLFKLILFS  389 (968)
T ss_pred             CCCCEEECcCCCCcCcC---------ChHHhCCCC-CcEEECCCC-eeEe-----eCChhHhCc------CCCCEEECcC
Confidence            78888888887654333         444555544 888988873 4432     122222211      6789999999


Q ss_pred             cCchhhhhhhhccCCCCCeEEeccCCCccccCCCCCCCcccceEecccCCCccccCCCCCCcccccEEEeeccccccccc
Q 006296          399 CSKLESIAERLDNNTSLETINIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALP  478 (651)
Q Consensus       399 ~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~l~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~~~~~~~~~  478 (651)
                      |.+.+..+..++.+++|+.|++++|.....+|..+..+++|+.|++++|.....++..+..+++|+.|++++|...+.+|
T Consensus       390 n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p  469 (968)
T PLN00113        390 NSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLP  469 (968)
T ss_pred             CEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecC
Confidence            98888888888899999999999987777788888899999999999987666666667778899999999998777776


Q ss_pred             ccCCCCCCccEEEeecCCCCCccC--CCCCCCcceEEecCCCCcchhhhccCccccccCCccEEEEecCCCCccc-CCCC
Q 006296          479 KGLHNLTSLQELTIIGGELPSLEE--DGLPTNLHSLDIRGNMEIWKSMIERGRGFHRFSSLRHLTISGCDDDMVS-FPPK  555 (651)
Q Consensus       479 ~~~~~l~~L~~L~L~~~~l~~~~~--~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~l~~-~~~~  555 (651)
                      ..+ +.++|+.|++++|.+.....  ...+++|++|++++|.... .++.   .+..+++|++|+|++|  .+.. ++..
T Consensus       470 ~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~-~~p~---~~~~l~~L~~L~Ls~N--~l~~~~p~~  542 (968)
T PLN00113        470 DSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSG-EIPD---ELSSCKKLVSLDLSHN--QLSGQIPAS  542 (968)
T ss_pred             ccc-ccccceEEECcCCccCCccChhhhhhhccCEEECcCCccee-eCCh---HHcCccCCCEEECCCC--cccccCChh
Confidence            654 45889999999988764322  2456889999999996543 3433   6788999999999996  5543 3333


Q ss_pred             CCCCCCCCCCCCCcccceEeeccCCCccccccccccCCCccEEEeccCCCccccCCCCCcccccEEEEcCCc
Q 006296          556 ADDKGSGTALPLPASLTSLWIEDFPNLERLSSSIVDLQNLTILYLVECRKLKYFPDKGLPSSLLKLYIYGCP  627 (651)
Q Consensus       556 ~~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~l~~L~~L~i~~c~~l~~l~~~~~~~~L~~l~i~~c~  627 (651)
                      .         ..+++|+.|++++|+....+|..+..+++|+++++++|+....+|..+....+....+.+++
T Consensus       543 ~---------~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~  605 (968)
T PLN00113        543 F---------SEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNI  605 (968)
T ss_pred             H---------hCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCc
Confidence            3         46789999999996655688888889999999999998777778876544444444445544

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query651
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 6e-06
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 80/163 (49%), Gaps = 20/163 (12%)
Query: 355 LEKLEIWNCRSLTCIFSKNELPATLESLEVGNLPP---SLKSLRVERCSKLESIAERLDN 411
           L +L I  C  LT      ELP  L S +         +L+SLR+E  + + S+   + N
Sbjct: 152 LRELSIRACPELT------ELPEPLASTDASGEHQGLVNLQSLRLE-WTGIRSLPASIAN 204
Query: 412 NTSLETINIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPE--GGLPCAKLTRLTIH 469
             +L+++ I R   L  L   +H+L +L+E+ +  C  L ++P   GG   A L RL + 
Sbjct: 205 LQNLKSLKI-RNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGR--APLKRLILK 261
Query: 470 DCKRLEALPKGLHNLTSLQELTIIG----GELPSLEEDGLPTN 508
           DC  L  LP  +H LT L++L + G      LPSL    LP N
Sbjct: 262 DCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQ-LPAN 303

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query651
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-06
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-04
4fdw_A401 Leucine rich hypothetical protein; putative cell s 5e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 96.6 bits (241), Expect = 5e-22
 Identities = 65/344 (18%), Positives = 102/344 (29%), Gaps = 53/344 (15%)

Query: 296 SSLETLYIEHCRTLTYLAGVQLPRSLKRLDILSCDNIRTLTVEEGIQSSSGSRRHTSYLL 355
           S  E LY +    L           L +       +           +S+          
Sbjct: 12  SGRENLYFQGSTALR-----PYHDVLSQWQRHYNADRNRWHSAWRQANSN---------N 57

Query: 356 EKLEIWNCRSLTCIFSKNELPATLESLEVGNLPPSLKSLRVERCSKLESIAERLDNNTSL 415
            ++E    R+L            LE        P   +L +     L    ++    + L
Sbjct: 58  PQIETRTGRALK------ATADLLEDATQ----PGRVALELRSV-PLPQFPDQAFRLSHL 106

Query: 416 ETINIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLE 475
           + + I     L  LP  +     L+ + +     L + P       +L  L+I  C  L 
Sbjct: 107 QHMTIDAA-GLMELPDTMQQFAGLETLTLARN-PLRALPASIASLNRLRELSIRACPELT 164

Query: 476 ALPKGL---------HNLTSLQELTIIGGELPSL-EEDGLPTNLHSLDIRGNMEIWKSMI 525
            LP+ L           L +LQ L +    + SL        NL SL IR +      + 
Sbjct: 165 ELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNS-----PLS 219

Query: 526 ERGRGFHRFSSLRHLTISGCDDDMVSFPPKADDKGSGTALPLPASLTSLWIEDFPNLERL 585
             G   H    L  L + GC   + ++PP                L  L ++D  NL  L
Sbjct: 220 ALGPAIHHLPKLEELDLRGCTA-LRNYPP------IFGGRA---PLKRLILKDCSNLLTL 269

Query: 586 SSSIVDLQNLTILYLVECRKLKYFPDK-GLPSSLLKLYIYGCPL 628
              I  L  L  L L  C  L   P       +   + +     
Sbjct: 270 PLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPHLQ 313
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query651
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.98
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.76
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.76
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.73
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.73
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.7
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.69
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.68
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.67
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.65
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.64
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.64
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.6
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.6
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.6
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.58
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.58
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.57
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.54
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.53
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.53
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.49
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.49
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.47
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.46
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.46
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.46
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.45
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.45
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.45
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.41
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.38
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.37
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.36
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.35
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.35
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.34
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.33
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.33
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.3
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.29
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.27
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.27
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.26
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.25
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.22
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.2
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.19
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.16
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.02
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.02
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.02
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.01
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.98
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.97
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.96
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.93
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.9
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.9
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.88
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.85
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.7
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.68
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.68
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.68
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.57
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.39
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.33
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.32
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.3
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.27
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.19
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.18
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.16
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.91
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.52
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.42
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.21
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.93
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.18
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 91.71
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 89.86
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 89.16
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.3e-45  Score=411.75  Aligned_cols=578  Identities=17%  Similarity=0.065  Sum_probs=324.7

Q ss_pred             CCCCCCccEEEeccCccceE-eCcc-cccCCCCCCCCccceeecccccccccceeccCCCCccCCCcccEEeeccCCCcc
Q 006296            8 VGQLPSLKHLAVCGMSRVKR-LGSE-FYGNDAPFPFPCLETLRFENMREWEDWIPLRSGQGVEGFPKLRELHLISCSKLQ   85 (651)
Q Consensus         8 ~~~l~~L~~L~l~~~~~~~~-~~~~-~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~   85 (651)
                      ++++++|++|++++|. +.. ++.. .+     ..+++|++|+++++. +....+   ...+..+++|++|++++|. +.
T Consensus        96 ~~~l~~L~~L~Ls~n~-l~~~~~~~~~l-----~~l~~L~~L~Ls~n~-l~~~~~---~~~~~~l~~L~~L~Ls~n~-l~  164 (768)
T 3rgz_A           96 FKCSASLTSLDLSRNS-LSGPVTTLTSL-----GSCSGLKFLNVSSNT-LDFPGK---VSGGLKLNSLEVLDLSANS-IS  164 (768)
T ss_dssp             CCCCTTCCEEECCSSE-EEEEGGGGGGG-----GGCTTCCEEECCSSE-EECCSS---CCSCCCCTTCSEEECCSSC-CE
T ss_pred             hccCCCCCEEECCCCc-CCCcCCChHHH-----hCCCCCCEEECcCCc-cCCcCC---HHHhccCCCCCEEECCCCc-cC
Confidence            5555555555555552 222 2220 11     225555555555542 211111   0111345555555555542 22


Q ss_pred             ccc------cCcCCCcceEEEcccccc-hhccCCCCccceEEeCCCCCceeecccccCCCCCcccccccccccccc-CCC
Q 006296           86 GTF------PEHLPALQMLVIQECKEL-LVSITSLPALCKLEIDGCKEVVWESATDHLGSQNSEVCRETSNQVFLA-GPL  157 (651)
Q Consensus        86 ~~~------~~~l~~L~~L~l~~~~~l-~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~-~~~  157 (651)
                      +..      ...+++|++|++++|... ......+++|++|++++|........  +..++.|+.+++..+..... ...
T Consensus       165 ~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--l~~l~~L~~L~Ls~n~l~~~~~~~  242 (768)
T 3rgz_A          165 GANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF--LGDCSALQHLDISGNKLSGDFSRA  242 (768)
T ss_dssp             EETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB--CTTCCSCCEEECCSSCCCSCHHHH
T ss_pred             CcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc--cccCCCCCEEECcCCcCCCcccHH
Confidence            222      223455555555555421 12334555555555555544332221  34445555555544432210 001


Q ss_pred             CCCCCCcceEEccccCCceeeecccCcccccccCccEEecCCCCCcccchhhhhhhhhhhhhhccCCccEEeccCCcCcc
Q 006296          158 KPRLPKLEELKINDMKEQTYIWKSHNELLQDICSLRRLTIDSCPKLQSLVAEEEKDQQQQLCELSCELEYLRLRYCEGLV  237 (651)
Q Consensus       158 ~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~l~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~  237 (651)
                      ...+++|+.|.+.++.-..   ..+.   ..+++|++|++++|.-...++..        +...+++|++|++++|....
T Consensus       243 l~~l~~L~~L~Ls~n~l~~---~~~~---~~l~~L~~L~L~~n~l~~~ip~~--------~~~~~~~L~~L~Ls~n~l~~  308 (768)
T 3rgz_A          243 ISTCTELKLLNISSNQFVG---PIPP---LPLKSLQYLSLAENKFTGEIPDF--------LSGACDTLTGLDLSGNHFYG  308 (768)
T ss_dssp             TTTCSSCCEEECCSSCCEE---SCCC---CCCTTCCEEECCSSEEEESCCCC--------SCTTCTTCSEEECCSSEEEE
T ss_pred             HhcCCCCCEEECCCCcccC---ccCc---cccCCCCEEECcCCccCCccCHH--------HHhhcCcCCEEECcCCcCCC
Confidence            1234444444444443211   1111   14555555555555211122111        11112556666666665544


Q ss_pred             ccCCCcCCCCCcCEEEeeCCCCCcccCC--CCCCCCCcEEEecccccccccCcccccCCCC-CccEEEeccCCCcceecC
Q 006296          238 KLPQSSLSLSSLKEIEIYGCSSLVSFPE--VALPSKLKTIKIREYDALKSLPEAWTCDTNS-SLETLYIEHCRTLTYLAG  314 (651)
Q Consensus       238 ~~~~~~~~l~~L~~L~l~~~~~~~~~~~--~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~-~L~~L~l~~~~~~~~~~~  314 (651)
                      .+|..++++++|++|++++|...+.+|.  +..+++|++|++++|.....++..+.  .++ +|++|++++|.....++.
T Consensus       309 ~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~--~l~~~L~~L~Ls~N~l~~~~~~  386 (768)
T 3rgz_A          309 AVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT--NLSASLLTLDLSSNNFSGPILP  386 (768)
T ss_dssp             CCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHH--HHTTTCSEEECCSSEEEEECCT
T ss_pred             ccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHH--hhhcCCcEEEccCCCcCCCcCh
Confidence            5555566666666666666543334442  44556666666666653334444443  233 566666666653323332


Q ss_pred             c-cC--CCCccEEEeeccCCccccccccccccCCCCccccccccceEEEccCCCcccccccCCCchhhhhhhcCCCCccc
Q 006296          315 V-QL--PRSLKRLDILSCDNIRTLTVEEGIQSSSGSRRHTSYLLEKLEIWNCRSLTCIFSKNELPATLESLEVGNLPPSL  391 (651)
Q Consensus       315 ~-~~--~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~L  391 (651)
                      . ..  +++|+.|++.+|.....+         |..+..+.. |++|+++++ .++.     .+|..+..+      ++|
T Consensus       387 ~~~~~~~~~L~~L~L~~n~l~~~~---------p~~l~~l~~-L~~L~Ls~N-~l~~-----~~p~~l~~l------~~L  444 (768)
T 3rgz_A          387 NLCQNPKNTLQELYLQNNGFTGKI---------PPTLSNCSE-LVSLHLSFN-YLSG-----TIPSSLGSL------SKL  444 (768)
T ss_dssp             TTTCSTTCCCCEEECCSSEEEEEC---------CGGGGGCTT-CCEEECCSS-EEES-----CCCGGGGGC------TTC
T ss_pred             hhhhcccCCccEEECCCCcccccc---------CHHHhcCCC-CCEEECcCC-cccC-----cccHHHhcC------CCC
Confidence            2 11  455666666665433222         445555554 888888773 4442     123332222      678


Q ss_pred             cEEEEeccCchhhhhhhhccCCCCCeEEeccCCCccccCCCCCCCcccceEecccCCCccccCCCCCCcccccEEEeecc
Q 006296          392 KSLRVERCSKLESIAERLDNNTSLETINIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPCAKLTRLTIHDC  471 (651)
Q Consensus       392 ~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~l~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~~  471 (651)
                      +.|++++|.+.+.++..+..+++|++|++++|.....+|..+..+++|++|++++|...+.+|..+..+++|+.|++++|
T Consensus       445 ~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N  524 (768)
T 3rgz_A          445 RDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNN  524 (768)
T ss_dssp             CEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSS
T ss_pred             CEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCC
Confidence            88888888887777777888888888888887666677777888888888888888655677777777888888888888


Q ss_pred             cccccccccCCCCCCccEEEeecCCCC-Ccc-------------------------------------------------
Q 006296          472 KRLEALPKGLHNLTSLQELTIIGGELP-SLE-------------------------------------------------  501 (651)
Q Consensus       472 ~~~~~~~~~~~~l~~L~~L~L~~~~l~-~~~-------------------------------------------------  501 (651)
                      ...+.+|..+..+++|++|++++|.+. .++                                                 
T Consensus       525 ~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  604 (768)
T 3rgz_A          525 SFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQL  604 (768)
T ss_dssp             CCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGG
T ss_pred             cccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhh
Confidence            777778888888888888888876443 111                                                 


Q ss_pred             ----------------------CCCCCCCcceEEecCCCCcchhhhccCccccccCCccEEEEecCCCCcc-cCCCCCCC
Q 006296          502 ----------------------EDGLPTNLHSLDIRGNMEIWKSMIERGRGFHRFSSLRHLTISGCDDDMV-SFPPKADD  558 (651)
Q Consensus       502 ----------------------~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~l~-~~~~~~~~  558 (651)
                                            ..+.+++|+.|++++|... ..++.   .++.+++|+.|++++|  .+. .+|...  
T Consensus       605 ~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~-g~ip~---~l~~l~~L~~L~Ls~N--~l~g~ip~~l--  676 (768)
T 3rgz_A          605 NRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLS-GYIPK---EIGSMPYLFILNLGHN--DISGSIPDEV--  676 (768)
T ss_dssp             GGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCB-SCCCG---GGGGCTTCCEEECCSS--CCCSCCCGGG--
T ss_pred             hccccccccccccceecccCchhhhccccccEEECcCCccc-ccCCH---HHhccccCCEEeCcCC--ccCCCCChHH--
Confidence                                  1122468999999999644 34444   7899999999999997  555 666655  


Q ss_pred             CCCCCCCCCCcccceEeeccCCCccccccccccCCCccEEEeccCCCccccCCCCCcccccEEEEcCCcch----hhhcc
Q 006296          559 KGSGTALPLPASLTSLWIEDFPNLERLSSSIVDLQNLTILYLVECRKLKYFPDKGLPSSLLKLYIYGCPLI----TEKCR  634 (651)
Q Consensus       559 ~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~l~~L~~L~i~~c~~l~~l~~~~~~~~L~~l~i~~c~~l----~~~~~  634 (651)
                             ..+++|++|+++++.--..+|..+..+++|++|++++|+--..+|....+.++....+.+||.+    -..|.
T Consensus       677 -------~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~  749 (768)
T 3rgz_A          677 -------GDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCD  749 (768)
T ss_dssp             -------GGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCC
T ss_pred             -------hCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcCCC
Confidence                   4789999999999444458888999999999999999765566887655555555556666532    22788


Q ss_pred             ccCccccccccccCCCC
Q 006296          635 KDGGQYWDLLTHIPSVF  651 (651)
Q Consensus       635 ~~~~~~~~~~~~~~~~~  651 (651)
                      ...+++|++|+|+|.++
T Consensus       750 ~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          750 PSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             SCC--------------
T ss_pred             CCccCCCCCCCCccccC
Confidence            89999999999999864
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 651
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 41.9 bits (97), Expect = 2e-04
 Identities = 42/345 (12%), Positives = 96/345 (27%), Gaps = 33/345 (9%)

Query: 225 LEYLRLRYC-----EGLVKLPQ-SSLSLSSLK---EIEIYGCSSLVSFPEVALPSKLKTI 275
           +  L+         +G+  L   + ++ S+ +      +   + LV            T 
Sbjct: 46  VTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITP 105

Query: 276 KIREYDALKSLPEAWTCDTNSSLETLYIEHCRTLTYLAGVQLPRSLKRLDILSCDNIRTL 335
                +                L+ L   +   L+      +        +        +
Sbjct: 106 LANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQV 165

Query: 336 TVEEGIQSSSGSRRHTSYLLEKLEIWNCRSLTCIFSKNELPATLESLEVGNLPPSLKSLR 395
           T  + + + +   R      +  +I     LT + S       +  +    +  +L  L 
Sbjct: 166 TDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELS 225

Query: 396 VERC--SKLESIAE-------RLDNNTSLETINIWRCENLKFLPSGLHNLRQLQEIH--- 443
           +       + ++A         L NN       +     L  L  G + +  +  +    
Sbjct: 226 LNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLT 285

Query: 444 ----IWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALPKGLHNLTSLQELTIIGGELPS 499
               +    N +           LT LT++     +  P  + +LT LQ L     ++  
Sbjct: 286 ALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD 343

Query: 500 LEEDGLPTNLHSLDIRGNMEIWKSMIERGRGFHRFSSLRHLTISG 544
           +      TN++ L    N       I         + +  L ++ 
Sbjct: 344 VSSLANLTNINWLSAGHN------QISDLTPLANLTRITQLGLND 382
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query651
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.72
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.69
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.68
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.65
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.65
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.64
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.57
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.57
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.5
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.45
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.39
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.38
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.17
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.15
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.14
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.13
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.1
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.09
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.08
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.0
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.87
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.77
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.66
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.66
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.64
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.52
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.82
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.69
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.96
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.59
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.3
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.86  E-value=3.3e-20  Score=189.10  Aligned_cols=189  Identities=18%  Similarity=0.200  Sum_probs=94.1

Q ss_pred             ccCCCCCeEEeccCCCccccCCCCCCCcccceEecccCCCccccCCCCCCcccccEEEeecccccccccccCCCCCCccE
Q 006296          410 DNNTSLETINIWRCENLKFLPSGLHNLRQLQEIHIWNCGNLVSFPEGGLPCAKLTRLTIHDCKRLEALPKGLHNLTSLQE  489 (651)
Q Consensus       410 ~~l~~L~~L~l~~~~~~~~l~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~  489 (651)
                      ..+++++.+++++|. ++.++ ....+++|++|++++| .++.++ .+..+++|+.+++++|. +..++ .+..+++|++
T Consensus       194 ~~l~~~~~l~l~~n~-i~~~~-~~~~~~~L~~L~l~~n-~l~~~~-~l~~l~~L~~L~l~~n~-l~~~~-~~~~~~~L~~  267 (384)
T d2omza2         194 AKLTNLESLIATNNQ-ISDIT-PLGILTNLDELSLNGN-QLKDIG-TLASLTNLTDLDLANNQ-ISNLA-PLSGLTKLTE  267 (384)
T ss_dssp             GGCTTCSEEECCSSC-CCCCG-GGGGCTTCCEEECCSS-CCCCCG-GGGGCTTCSEEECCSSC-CCCCG-GGTTCTTCSE
T ss_pred             ccccccceeeccCCc-cCCCC-cccccCCCCEEECCCC-CCCCcc-hhhcccccchhccccCc-cCCCC-cccccccCCE
Confidence            344455555555532 22221 1233455555555555 233332 23344455555555554 22222 2445555666


Q ss_pred             EEeecCCCCCccCCCCCCCcceEEecCCCCcchhhhccCccccccCCccEEEEecCCCCcccCCCCCCCCCCCCCCCCCc
Q 006296          490 LTIIGGELPSLEEDGLPTNLHSLDIRGNMEIWKSMIERGRGFHRFSSLRHLTISGCDDDMVSFPPKADDKGSGTALPLPA  569 (651)
Q Consensus       490 L~L~~~~l~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~l~~~~~~~~~~~~~~~~~~~~  569 (651)
                      |+++++.+..++....++.++.++++.|....  +    ..+..++++++|++++|  .+..++..          ..++
T Consensus       268 L~l~~~~l~~~~~~~~~~~l~~l~~~~n~l~~--~----~~~~~~~~l~~L~ls~n--~l~~l~~l----------~~l~  329 (384)
T d2omza2         268 LKLGANQISNISPLAGLTALTNLELNENQLED--I----SPISNLKNLTYLTLYFN--NISDISPV----------SSLT  329 (384)
T ss_dssp             EECCSSCCCCCGGGTTCTTCSEEECCSSCCSC--C----GGGGGCTTCSEEECCSS--CCSCCGGG----------GGCT
T ss_pred             eeccCcccCCCCcccccccccccccccccccc--c----cccchhcccCeEECCCC--CCCCCccc----------ccCC
Confidence            66655555554444445556666665553221  1    12455566666666664  44444321          2456


Q ss_pred             ccceEeeccCCCccccccccccCCCccEEEeccCCCccccCCCCCcccccEEEEcC
Q 006296          570 SLTSLWIEDFPNLERLSSSIVDLQNLTILYLVECRKLKYFPDKGLPSSLLKLYIYG  625 (651)
Q Consensus       570 ~L~~L~l~~c~~l~~l~~~~~~l~~L~~L~i~~c~~l~~l~~~~~~~~L~~l~i~~  625 (651)
                      +|++|++++ +.++.++ .+..+++|++|++++| +++.+++..-+++|+.|++++
T Consensus       330 ~L~~L~L~~-n~l~~l~-~l~~l~~L~~L~l~~N-~l~~l~~l~~l~~L~~L~L~~  382 (384)
T d2omza2         330 KLQRLFFAN-NKVSDVS-SLANLTNINWLSAGHN-QISDLTPLANLTRITQLGLND  382 (384)
T ss_dssp             TCCEEECCS-SCCCCCG-GGGGCTTCCEEECCSS-CCCBCGGGTTCTTCSEEECCC
T ss_pred             CCCEEECCC-CCCCCCh-hHcCCCCCCEEECCCC-cCCCChhhccCCCCCEeeCCC
Confidence            666666666 3555555 3556666666666653 455554433345666666654
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure