Citrus Sinensis ID: 006311

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-

MQYIFISTIICCIFLLLDIWVQEGSSSVYMPPKNSENLMKKEAAPEVLKKPSSPLSRKTPSSLKPALSPLPNDCTNQQTKGNRVWVQKGTSPVYLTHKNNENLMKKEAMPEVLTKPSYRSSHKSPSSSNPTPSPLPSDSTNQQTKGNDTWVQKGTLPVYMTPKNNENFMKKEVVHEVLKKPSSPLFHKASSSSKPTLSPLPTDSTNQQKKASFIWVQKGATNYKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLTEAYRSCNSMFFSQLFTEEVG

ccEEEEEcHHHHHHEEHHHEHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEcccEEEccccccccccHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHccccccccHHHHHHHHHccccHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccEEEEEEccccccccccccccEEEEEEccccccEEEEEEEEEEcccEEEEEEcccccccccccccEEEEEEEcHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccccEEEccccccccccccHHHHHcccccccccccccHHHHccccEEEEEccccccccccccccccccEEEEcccccccccHHHHHHccccccccEEEEEccccccccEEEcHHHHHccccccHHHHHHccccccccccccccccHHEccc

ccEEEEHHHHHHHHHHHHHHEHcccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEEEEcccccEEEEEccEccccccccccccccccEEEEEEccHHHccccccccEEEEccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHcccHccccccccHHHHHccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccEEEEEEEEEEcccEEEEEEEccccccccEEEEccEEEEEEcccccccEEEEEEEEEccccEEEEccHHccccccccccEEEEEEEccccHHHHHHHHHHHHHHcccccccHHHccccccccccccccccccccHHHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHcccccEEEEEccccccccccHHHHHHHHHHHcccccHHHHHHHHccEEEEEEcccccccccccccccEEEEEEEccccccccccEEEEHEccccccEEEEEccccccccEEccHHHHHccccHHHHHHHHHHHHHcccHHHcccHcEEcccc

MQYIFISTIICCIFLLLDIWvqegsssvymppknsenlmkkeaapevlkkpssplsrktpsslkpalsplpndctnqqtkgnrvwvqkgtspvylthknnenlmkkeampevltkpsyrsshkspsssnptpsplpsdstnqqtkgndtwvqkgtlpvymtpknnenfMKKEVVHEVlkkpssplfhkasssskptlsplptdstnqqkkASFIWVQkgatnykipKDIEDLIkkdivpkvlkkpllpstyKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDkslknknleesdetdDKLFVAFEidsvperrpfllsrdfvyaqrsggkskkfqGFLYRVVKWTTVLVEFEedfhsqhqpnhkydvsfsFNRVCLKRAHEAVADASdslfrnylfpdcasrksipypslcpysnykldsdsnsaVHQILSfegqspyllegplcnnfvlsktgNVVREAVLQIRRrspksrilicapwnRTCDKLMECLMKDIPASEMFRANAAfreadgvsdeIFQVSLVErecfscppleelrqykviSSTFVSSfrlhnqgitaghfSHIFlidassatepETMIVLGNLANENTRVIVtgaphnspsrvrsdiarknglkmSYFERLCLTEAYRSCNSMFFSQLFTEEVG

MQYIFISTIICCIFLLLDIWVQEGSSSVYMPPKNSENLMKKEAApevlkkpssplsrktpsslkpalsplpndctnqqtkgnrvwvqkgtspvylthknnenlmkkeaMPEVLTKPSyrsshkspsssnptpsplpsdSTNQQTKGNDTWVQKGTLPVYMTPKNNENFMKKEVVHEVLKKPSsplfhkasssskptlsplptdstnqqKKASFiwvqkgatnykiPKDIedlikkdivpkvlkkpllpstYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKslknknleesdetddKLFVAFEIdsvperrpfllSRDFVYAqrsggkskkfqgflYRVVKWTTVLVEFEEDfhsqhqpnhkydVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLqirrrspksrilicapwnrTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVtgaphnspsrvrsdiarkngLKMSYFERLCLTEAYRSCNSMFFSQLFTEEVG

MQYIFISTIICCIFLLLDIWVQEGSSSVYMPPKNSENLMKKEAAPEVLKKPSSPLSRKTpsslkpalsplpNDCTNQQTKGNRVWVQKGTSPVYLTHKNNENLMKKEAMPEVLTKpsyrsshkspsssnptpsplpsdsTNQQTKGNDTWVQKGTLPVYMTPKNNENFMKKEVVHEVLKKPSSPLFHKAsssskptlsplptdstNQQKKASFIWVQKGATNYKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLTEAYRSCNSMFFSQLFTEEVG

**YIFISTIICCIFLLLDIWVQE************************************************************VWVQKG**PVYL******************************************************WVQKGTLPVYM***************************************************SFIWVQKGATNYKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKS**************KLFVAFEIDSVPERRPFLLSRDFVY************GFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTG***************KNGLKMSYFERLCLTEAYRSCNSMFFSQLF*****

*QYIFISTIICCIFLLLDIW*********************************************************************************************************************************************************************************SPLPTDSTNQQK*****WVQKGATNYKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLTEAYRSCNSMFFSQLFTEEVG

MQYIFISTIICCIFLLLDIWVQEGSSSVYMPPKNSENLMKKE**********************PALSPLPNDCTNQQTKGNRVWVQKGTSPVYLTHKNNENLMKKEAMPE*********************************KGNDTWVQKGTLPVYMTPKNNENFMKKEVVHEVLKKPS**************************KKASFIWVQKGATNYKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLTEAYRSCNSMFFSQLFTEEVG

MQYIFISTIICCIFLLLDIWVQEGSSSVYMPPKNSENLMKKEAAPEVLKKPSSPLSRKTPSSLKPALSPL********TKGNRVWVQKGTSPVYLTHKNNENLMKKEAMPEVLTKP********PSSSNPTPSPLPSDSTNQQTKGNDTWVQKGTLPVYMTPKNNENFMKKEVVHEVLKKPSSPL******SSKPTLSPLPTDSTNQQKKASFIWVQKGATNYKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLTEAYRSCNSMFFSQLFT*E**

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		651	2.2.26 [Sep-21-2011]
Q8GYD9		1002	Probable RNA helicase SDE	yes	no	0.599	0.389	0.301	5e-53
Q1LXK4		1013	Putative helicase mov-10-	no	no	0.520	0.334	0.306	4e-32
Q5ZKD7		967	Putative helicase MOV-10	yes	no	0.585	0.394	0.248	2e-26
Q1LXK5		1015	Putative helicase mov-10-	no	no	0.557	0.357	0.280	1e-25
P23249		1004	Putative helicase MOV-10	yes	no	0.482	0.312	0.277	1e-24
Q6J5K9		1274	Probable RNA helicase arm	yes	no	0.608	0.310	0.237	3e-24
Q0V8H6		1003	Putative helicase MOV-10	yes	no	0.542	0.351	0.261	5e-24
Q9HCE1		1003	Putative helicase MOV-10	yes	no	0.542	0.351	0.255	4e-23
Q9BXT6		1211	Putative helicase Mov10l1	no	no	0.319	0.171	0.317	5e-20
Q99MV5		1187	Putative helicase Mov10l1	no	no	0.308	0.169	0.313	1e-18

>sp\|Q8GYD9\|SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana GN=SDE3 PE=1 SV=1	Back alignment and function desciption

 Score =  209 bits (532), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 131/434 (30%), Positives = 224/434 (51%), Gaps = 44/434 (10%)

Query: 223 YKIPKDIEDLIKKDIVPKVLKKPLLPSTYKDYFAALLYAEDF-YEEKWSGFQLFNVTLEL 281
           Y+IPK+I ++I+    P  L + L    Y +Y+  LL  E+   EE    + + NV+++ 
Sbjct: 217 YEIPKEIREMIENKEFPDDLNEGLTARNYANYYKTLLIMEELQLEEDMRAYDMENVSMKR 276

Query: 282 HKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRS--GGKSKK 339
                                   ++++ E+  + ERRP L+  DF++ + +   G    
Sbjct: 277 RG----------------------IYLSLEVPGLAERRPSLVHGDFIFVRHAYDDGTDHA 314

Query: 340 FQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLFRN 399
           +QGF++RV +   V ++F  +FH +H     Y+V F++NR+  +R ++AV DA++ L  N
Sbjct: 315 YQGFVHRV-EADEVHMKFASEFHQRHTAGSVYNVRFTYNRINTRRLYQAV-DAAEMLDPN 372

Query: 400 YLFPDCASRKSI----PYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFV 455
           +LFP   S K +    P+  + P     L+++   ++  +L  +G  PY++ GP      
Sbjct: 373 FLFPSLHSGKRMIKTKPFVPISP----ALNAEQICSIEMVLGCKGAPPYVIHGPPGT--- 425

Query: 456 LSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLMECLM----KDIPASEMFRANAA 511
             KT  +V EA++Q+      +R+L+CAP N   D ++E L+      I  +E+FR NAA
Sbjct: 426 -GKTMTLV-EAIVQLYTTQRNARVLVCAPSNSAADHILEKLLCLEGVRIKDNEIFRLNAA 483

Query: 512 FREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIF 571
            R  + +  EI +    +   F CPPL+ L +YK++ ST++S+  L+ +G+  GHF+HI 
Sbjct: 484 TRSYEEIKPEIIRFCFFDELIFKCPPLKALTRYKLVVSTYMSASLLNAEGVNRGHFTHIL 543

Query: 572 LIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLT 631
           L +A  A+EPE MI + NL    T V++ G P      + S  A   GL  SY ERL   
Sbjct: 544 LDEAGQASEPENMIAVSNLCLTETVVVLAGDPRQLGPVIYSRDAESLGLGKSYLERLFEC 603

Query: 632 EAYRSCNSMFFSQL 645
           + Y   +  + ++L
Sbjct: 604 DYYCEGDENYVTKL 617

Probable RNA helicase required for post-transcriptional gene silencing (PTGS), a process that provides protection in plants against virus infection and can suppress expression of transgenes Plays a central role in RNA interference (RNAi) process, a process that mediates mRNA destruction of translational repression. Required for the assembly of the RISC complex, a complex required for target RNA destruction or repression. May be required in the RISC assembly to unwind miRNAs, in the production of single-stranded miRNA from the double-stranded miRNA, a key step in RISC formation.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3

>sp\|Q1LXK4\|M10B1_DANRE Putative helicase mov-10-B.1 OS=Danio rerio GN=mov10b.1 PE=2 SV=2	Back alignment and function description

>sp\|Q5ZKD7\|MOV10_CHICK Putative helicase MOV-10 OS=Gallus gallus GN=MOV10 PE=2 SV=1	Back alignment and function description

>sp\|Q1LXK5\|M10B2_DANRE Putative helicase mov-10-B.2 OS=Danio rerio GN=mov10b.2 PE=3 SV=1	Back alignment and function description

>sp\|P23249\|MOV10_MOUSE Putative helicase MOV-10 OS=Mus musculus GN=Mov10 PE=1 SV=2	Back alignment and function description

>sp\|Q6J5K9\|ARMI_DROME Probable RNA helicase armi OS=Drosophila melanogaster GN=armi PE=2 SV=3	Back alignment and function description

>sp\|Q0V8H6\|MOV10_BOVIN Putative helicase MOV-10 OS=Bos taurus GN=MOV10 PE=2 SV=1	Back alignment and function description

>sp\|Q9HCE1\|MOV10_HUMAN Putative helicase MOV-10 OS=Homo sapiens GN=MOV10 PE=1 SV=2	Back alignment and function description

>sp\|Q9BXT6\|M10L1_HUMAN Putative helicase Mov10l1 OS=Homo sapiens GN=MOV10L1 PE=1 SV=1	Back alignment and function description

>sp\|Q99MV5\|M10L1_MOUSE Putative helicase Mov10l1 OS=Mus musculus GN=Mov10l1 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		651
224094027		687	predicted protein [Populus trichocarpa]	0.694	0.657	0.617	1e-151
224081336		773	predicted protein [Populus trichocarpa]	0.694	0.584	0.605	1e-149
356497432		886	PREDICTED: probable RNA helicase SDE3-li	0.606	0.445	0.311	1e-55
168029561		885	RNA helicase [Physcomitrella patens subs	0.579	0.425	0.330	5e-55
224112955		894	hypothetical protein POPTRDRAFT_789212 [	0.606	0.441	0.322	2e-53
357450659		940	hypothetical protein MTR_2g049990 [Medic	0.605	0.419	0.311	8e-53
115450873		959	Os03g0160400 [Oryza sativa Japonica Grou	0.602	0.408	0.309	9e-53
357480981		940	hypothetical protein MTR_5g006890 [Medic	0.605	0.419	0.316	1e-52
242036863		968	hypothetical protein SORBIDRAFT_01g04643	0.602	0.404	0.320	2e-52
293331505		973	uncharacterized protein LOC100382450 [Ze	0.597	0.399	0.318	3e-52

>gi\|224094027\|ref\|XP_002310063.1\| predicted protein [Populus trichocarpa] gi\|222852966\|gb\|EEE90513.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  541 bits (1395), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 281/455 (61%), Positives = 337/455 (74%), Gaps = 3/455 (0%)

Query: 194 KPTLSPLPTDSTNQQKKASFIWVQKGATN-YKIPKDIEDLIKKDIVPKVLKKPLLPSTYK 252
           KPTLS +  DS  +Q K S++WVQKG +  Y IPKDIEDLIK+D VP VL KPL  STYK
Sbjct: 214 KPTLSQVSPDSIKEQTKVSYMWVQKGMSPIYAIPKDIEDLIKRDKVPGVLNKPLSLSTYK 273

Query: 253 DYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEI 312
           DYFAALLYAEDFY EKWS F+L N+TL+L +A I  KS +N+   E+ E DDK+FV FEI
Sbjct: 274 DYFAALLYAEDFYIEKWSEFKLENITLKLQRAEIIKKSRRNEYRNETYEKDDKIFVEFEI 333

Query: 313 DSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYD 372
           DS  ERRPFLLSRDF +A+ SG  ++  QG +YRV + T V+VEF +DF  QH    KYD
Sbjct: 334 DSCCERRPFLLSRDFAFARPSGQMTEPCQGIIYRVERSTRVVVEFGKDFLLQHHSTRKYD 393

Query: 373 VSFSFNRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAV 432
           VSFSFNRVCLKRAH A+  ASD LF+++LFPD  S+K  P  +   + N+KLD   +SAV
Sbjct: 394 VSFSFNRVCLKRAHHAIEAASDPLFKSFLFPDGVSKKIFPISTPLHFCNHKLDVYQSSAV 453

Query: 433 HQILSFEGQSPYLLEGPLC-NNFV-LSKTGNVVREAVLQIRRRSPKSRILICAPWNRTCD 490
            +ILSF+G  PY++EGPLC N F  LS+TG V++EAVLQI + S K RILICAP NRTCD
Sbjct: 454 REILSFQGPPPYIVEGPLCLNKFSELSRTGLVIQEAVLQIYQSSSKLRILICAPINRTCD 513

Query: 491 KLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFSCPPLEELRQYKVISST 550
            LM+ L  DIP S+MFRANAAFRE DGV  +I      + ECF+CP L+ELR+++VI ST
Sbjct: 514 LLMQSLNNDIPKSDMFRANAAFREIDGVPIDILPSCAYKGECFTCPSLQELRKFRVILST 573

Query: 551 FVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRV 610
           FVSSFRL N+GI AGHFSHIFL+DASSATEPE M+ L NLA+E T VIVTGAP N    V
Sbjct: 574 FVSSFRLRNEGIAAGHFSHIFLVDASSATEPEAMVPLANLASEETAVIVTGAPGNHSGWV 633

Query: 611 RSDIARKNGLKMSYFERLCLTEAYRSCNSMFFSQL 645
           RS+IARKNGL  SYFERL  ++ YRS    F +QL
Sbjct: 634 RSNIARKNGLMTSYFERLRHSKPYRSLLPKFITQL 668

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224081336\|ref\|XP_002306375.1\| predicted protein [Populus trichocarpa] gi\|222855824\|gb\|EEE93371.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356497432\|ref\|XP_003517564.1\| PREDICTED: probable RNA helicase SDE3-like [Glycine max]	Back alignment and taxonomy information

>gi\|168029561\|ref\|XP_001767294.1\| RNA helicase [Physcomitrella patens subsp. patens] gi\|162681549\|gb\|EDQ67975.1\| RNA helicase [Physcomitrella patens subsp. patens]	Back alignment and taxonomy information

>gi\|224112955\|ref\|XP_002332671.1\| hypothetical protein POPTRDRAFT_789212 [Populus trichocarpa] gi\|222836465\|gb\|EEE74872.1\| hypothetical protein POPTRDRAFT_789212 [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357450659\|ref\|XP_003595606.1\| hypothetical protein MTR_2g049990 [Medicago truncatula] gi\|355484654\|gb\|AES65857.1\| hypothetical protein MTR_2g049990 [Medicago truncatula]	Back alignment and taxonomy information

>gi|115450873|ref|NP_001049037.1| Os03g0160400 [Oryza sativa Japonica Group] gi|108706305|gb|ABF94100.1| RNA helicase SDE3, putative, expressed [Oryza sativa Japonica Group] gi|108706306|gb|ABF94101.1| RNA helicase SDE3, putative, expressed [Oryza sativa Japonica Group] gi|113547508|dbj|BAF10951.1| Os03g0160400 [Oryza sativa Japonica Group] gi|125585000|gb|EAZ25664.1| hypothetical protein OsJ_09495 [Oryza sativa Japonica Group]

Back alignment and taxonomy information

>gi\|357480981\|ref\|XP_003610776.1\| hypothetical protein MTR_5g006890 [Medicago truncatula] gi\|355512111\|gb\|AES93734.1\| hypothetical protein MTR_5g006890 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|242036863\|ref\|XP_002465826.1\| hypothetical protein SORBIDRAFT_01g046430 [Sorghum bicolor] gi\|241919680\|gb\|EER92824.1\| hypothetical protein SORBIDRAFT_01g046430 [Sorghum bicolor]	Back alignment and taxonomy information

>gi\|293331505\|ref\|NP_001168662.1\| uncharacterized protein LOC100382450 [Zea mays] gi\|223950013\|gb\|ACN29090.1\| unknown [Zea mays] gi\|413957055\|gb\|AFW89704.1\| putative RNA helicase family protein [Zea mays]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		651
TAIR\|locus:2200996		1002	SDE3 "SILENCING DEFECTIVE" [Ar	0.628	0.408	0.290	6.9e-46
ZFIN\|ZDB-GENE-030131-9089		1013	mov10b.1 "Moloney leukemia vir	0.540	0.347	0.311	1.5e-30
ZFIN\|ZDB-GENE-091230-8		1001	mov10a "Moloney leukemia virus	0.628	0.408	0.288	4.1e-30
UNIPROTKB\|F1NNW1		735	MOV10 "Putative helicase MOV-1	0.614	0.544	0.255	6.3e-25
ZFIN\|ZDB-GENE-060526-371		1015	mov10b.2 "Moloney leukemia vir	0.583	0.374	0.282	7.2e-25
UNIPROTKB\|Q5ZKD7		967	MOV10 "Putative helicase MOV-1	0.614	0.413	0.255	3.9e-24
ZFIN\|ZDB-GENE-061013-333		1106	zgc:154086 "zgc:154086" [Danio	0.353	0.207	0.295	4e-24
MGI\|MGI:97054		1004	Mov10 "Moloney leukemia virus	0.600	0.389	0.259	1.1e-21
UNIPROTKB\|Q0V8H6		1003	MOV10 "Putative helicase MOV-1	0.569	0.369	0.266	1.6e-21
UNIPROTKB\|Q9HCE1		1003	MOV10 "Putative helicase MOV-1	0.539	0.349	0.262	3e-21

TAIR\|locus:2200996 SDE3 "SILENCING DEFECTIVE" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 491 (177.9 bits), Expect = 6.9e-46, P = 6.9e-46
 Identities = 126/433 (29%), Positives = 225/433 (51%)

Query:   229 IEDLIKKDIVPKVLKK------PL--LPSTYKDYFAALLYAEDFYEEKWS-GFQLFNVTL 279
             ++D +K     KV+++      PL  +P   ++      + +D  E   +  +  +  TL
Sbjct:   193 VDDYVKGSRPSKVVERSFRNRLPLYEIPKEIREMIENKEFPDDLNEGLTARNYANYYKTL 252

Query:   280 ELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFLLSRDFVYAQRS--GGKS 337
              + +    ++ ++  ++E        ++++ E+  + ERRP L+  DF++ + +   G  
Sbjct:   253 LIMEELQLEEDMRAYDMENVSMKRRGIYLSLEVPGLAERRPSLVHGDFIFVRHAYDDGTD 312

Query:   338 KKFQGFLYRVVKWTTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASDSLF 397
               +QGF++RV +   V ++F  +FH +H     Y+V F++NR+  +R ++AV DA++ L 
Sbjct:   313 HAYQGFVHRV-EADEVHMKFASEFHQRHTAGSVYNVRFTYNRINTRRLYQAV-DAAEMLD 370

Query:   398 RNYLFPDCAS-RKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVL 456
              N+LFP   S ++ I      P S   L+++   ++  +L  +G  PY++ GP       
Sbjct:   371 PNFLFPSLHSGKRMIKTKPFVPISP-ALNAEQICSIEMVLGCKGAPPYVIHGPPGTG--- 426

Query:   457 SKTGNVVREAVLQIRRRSPKSRILICAPWNRTCDKLME---CLMK-DIPASEMFRANAAF 512
              KT  +V EA++Q+      +R+L+CAP N   D ++E   CL    I  +E+FR NAA 
Sbjct:   427 -KTMTLV-EAIVQLYTTQRNARVLVCAPSNSAADHILEKLLCLEGVRIKDNEIFRLNAAT 484

Query:   513 READGVSDEIFQVSLVERECFSCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFL 572
             R  + +  EI +    +   F CPPL+ L +YK++ ST++S+  L+ +G+  GHF+HI L
Sbjct:   485 RSYEEIKPEIIRFCFFDELIFKCPPLKALTRYKLVVSTYMSASLLNAEGVNRGHFTHILL 544

Query:   573 IDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCLTE 632
              +A  A+EPE MI + NL    T V++ G P      + S  A   GL  SY ERL   +
Sbjct:   545 DEAGQASEPENMIAVSNLCLTETVVVLAGDPRQLGPVIYSRDAESLGLGKSYLERLFECD 604

Query:   633 AYRSCNSMFFSQL 645
              Y   +  + ++L
Sbjct:   605 YYCEGDENYVTKL 617

GO:0005737 "cytoplasm" evidence=ISM

GO:0003724 "RNA helicase activity" evidence=ISS

GO:0009616 "virus induced gene silencing" evidence=IMP

GO:0005515 "protein binding" evidence=IPI

GO:0035194 "posttranscriptional gene silencing by RNA" evidence=IMP

ZFIN\|ZDB-GENE-030131-9089 mov10b.1 "Moloney leukemia virus 10, homolog, b.1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-091230-8 mov10a "Moloney leukemia virus 10, homolog, a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NNW1 MOV10 "Putative helicase MOV-10" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-060526-371 mov10b.2 "Moloney leukemia virus 10, homolog, b.2" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZKD7 MOV10 "Putative helicase MOV-10" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-061013-333 zgc:154086 "zgc:154086" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:97054 Mov10 "Moloney leukemia virus 10" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q0V8H6 MOV10 "Putative helicase MOV-10" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9HCE1 MOV10 "Putative helicase MOV-10" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		651
pfam13086		220	pfam13086, AAA_11, AAA domain	4e-08

>gnl\|CDD\|221912 pfam13086, AAA_11, AAA domain	Back alignment and domain information

 Score = 53.9 bits (130), Expect = 4e-08
 Identities = 44/212 (20%), Positives = 79/212 (37%), Gaps = 62/212 (29%)

Query: 423 KLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGN--VVREAVLQIRRRSPKSRIL 480
           +L+     A+ + LS       L++GP         TG    + E + Q+   +P  ++L
Sbjct: 1   ELNDSQREAIKKALS--SSDITLIQGPP-------GTGKTTTIVEIIKQLLSNAPGKKVL 51

Query: 481 ICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSL---VERECFSCPP 537
           +CAP N   D ++E L++     ++ R  +  RE   + +++ Q SL   +E +      
Sbjct: 52  VCAPSNSAVDNILERLLEQKFGLKIVRIGSPARE---IHEDVLQYSLEYLLEAKFEQLLK 108

Query: 538 L-----------------------------------------EELRQYKVISSTFVSSFR 556
                                                     E L +  V+ +T   +  
Sbjct: 109 RIRKLKSLLEEKSKLKRERRKLRSEIKKLKKELERLRKSIRKEILDEADVVCTTLSGAGS 168

Query: 557 LHNQGITAGHFSHIFLID-ASSATEPETMIVL 587
              +G+    F  +  ID A+ ATEPET+I L
Sbjct: 169 SLLEGLK--KFDVVI-IDEAAQATEPETLIPL 197

This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 220

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		651
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	100.0
KOG1803		649	consensus DNA helicase [Replication, recombination	100.0
TIGR00376		637	DNA helicase, putative. The gene product may repre	100.0
KOG1804		775	consensus RNA helicase [RNA processing and modific	100.0
KOG1805		1100	consensus DNA replication helicase [Replication, r	100.0
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	99.98
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	99.77
KOG1807		1025	consensus Helicases [Replication, recombination an	99.72
COG1112		767	Superfamily I DNA and RNA helicases and helicase s	99.65
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	99.64
PRK10875		615	recD exonuclease V subunit alpha; Provisional	99.62
KOG1804		775	consensus RNA helicase [RNA processing and modific	99.57
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	99.55
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	99.52
PRK13889		988	conjugal transfer relaxase TraA; Provisional	99.48
PRK13826		1102	Dtr system oriT relaxase; Provisional	99.46
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	99.38
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	99.37
KOG1806		1320	consensus DEAD box containing helicases [Replicati	99.33
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	99.31
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	99.25
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	99.24
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	99.22
PRK11773		721	uvrD DNA-dependent helicase II; Provisional	99.16
KOG1801		827	consensus tRNA-splicing endonuclease positive effe	99.15
TIGR01075		715	uvrD DNA helicase II. Designed to identify uvrD me	99.13
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	99.13
PF13245		76	AAA_19: Part of AAA domain	99.13
TIGR01073		726	pcrA ATP-dependent DNA helicase PcrA. Designed to	99.11
TIGR01074		664	rep ATP-dependent DNA helicase Rep. Designed to id	99.09
smart00487		201	DEXDc DEAD-like helicases superfamily.	99.09
PRK10536		262	hypothetical protein; Provisional	98.98
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	98.96
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	98.8
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	98.78
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	98.76
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	98.75
COG0210		655	UvrD Superfamily I DNA and RNA helicases [DNA repl	98.71
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	98.6
COG4096		875	HsdR Type I site-specific restriction-modification	98.56
PF01443		234	Viral_helicase1: Viral (Superfamily 1) RNA helicas	98.55
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	98.52
PRK05580		679	primosome assembly protein PriA; Validated	98.49
PHA02558		501	uvsW UvsW helicase; Provisional	98.49
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	98.37
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	98.37
PTZ00424		401	helicase 45; Provisional	98.35
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	98.33
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	98.3
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	98.3
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	98.29
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	98.29
PRK01172		674	ski2-like helicase; Provisional	98.28
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	98.28
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	98.27
PRK11054		684	helD DNA helicase IV; Provisional	98.27
COG1198		730	PriA Primosomal protein N' (replication factor Y)	98.26
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	98.26
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	98.22
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	98.21
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	98.18
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	98.16
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	98.14
PRK02362		737	ski2-like helicase; Provisional	98.11
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	98.05
PRK10689		1147	transcription-repair coupling factor; Provisional	98.04
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	98.03
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	97.99
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	97.98
PRK13766		773	Hef nuclease; Provisional	97.95
PTZ00110		545	helicase; Provisional	97.95
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	97.95
COG0507		696	RecD ATP-dependent exoDNAse (exonuclease V), alpha	97.94
PRK09401		1176	reverse gyrase; Reviewed	97.9
TIGR00595		505	priA primosomal protein N'. All proteins in this f	97.9
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	97.89
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	97.87
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	97.85
COG3972		660	Superfamily I DNA and RNA helicases [General funct	97.85
PRK00254		720	ski2-like helicase; Provisional	97.81
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	97.79
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	97.79
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	97.79
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	97.72
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	97.7
PLN03025		319	replication factor C subunit; Provisional	97.68
PRK13767		876	ATP-dependent helicase; Provisional	97.64
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	97.61
PRK04296		190	thymidine kinase; Provisional	97.6
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	97.58
PRK14701		1638	reverse gyrase; Provisional	97.58
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	97.58
PHA02653		675	RNA helicase NPH-II; Provisional	97.54
TIGR02785		1232	addA_Gpos recombination helicase AddA, Firmicutes	97.53
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	97.51
COG1702		348	PhoH Phosphate starvation-inducible protein PhoH,	97.47
KOG0354		746	consensus DEAD-box like helicase [General function	97.45
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	97.41
COG2256		436	MGS1 ATPase related to the helicase subunit of the	97.41
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	97.39
PRK04914		956	ATP-dependent helicase HepA; Validated	97.37
PRK14088		440	dnaA chromosomal replication initiation protein; P	97.37
PRK08181		269	transposase; Validated	97.36
COG1204		766	Superfamily II helicase [General function predicti	97.35
KOG4284		980	consensus DEAD box protein [Transcription]	97.33
PRK09694		878	helicase Cas3; Provisional	97.31
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	97.27
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	97.26
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	97.25
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	97.22
PRK12402		337	replication factor C small subunit 2; Reviewed	97.22
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	97.19
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	97.19
PRK06526		254	transposase; Provisional	97.15
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	97.15
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	97.13
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	97.11
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	97.11
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	97.08
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	97.05
PRK14974		336	cell division protein FtsY; Provisional	97.05
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	97.04
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	97.04
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	97.03
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	96.99
PRK00411		394	cdc6 cell division control protein 6; Reviewed	96.94
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	96.93
PRK14873		665	primosome assembly protein PriA; Provisional	96.9
PRK12422		445	chromosomal replication initiation protein; Provis	96.9
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	96.89
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	96.87
PRK00440		319	rfc replication factor C small subunit; Reviewed	96.87
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	96.84
PRK14087		450	dnaA chromosomal replication initiation protein; P	96.84
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	96.81
PRK13342		413	recombination factor protein RarA; Reviewed	96.81
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	96.8
PHA02544		316	44 clamp loader, small subunit; Provisional	96.78
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	96.75
PRK04195		482	replication factor C large subunit; Provisional	96.74
PF13173		128	AAA_14: AAA domain	96.73
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	96.7
TIGR00609		1087	recB exodeoxyribonuclease V, beta subunit. All pro	96.65
PRK13341		725	recombination factor protein RarA/unknown domain f	96.61
smart00382		148	AAA ATPases associated with a variety of cellular	96.57
PF05127		177	Helicase_RecD: Helicase; InterPro: IPR007807 This	96.57
PRK07952		244	DNA replication protein DnaC; Validated	96.54
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	96.53
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	96.52
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	96.51
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	96.5
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	96.49
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	96.48
KOG0987		540	consensus DNA helicase PIF1/RRM3 [Cell cycle contr	96.48
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	96.47
PRK14086		617	dnaA chromosomal replication initiation protein; P	96.46
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	96.44
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	96.44
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	96.43
PHA03333		752	putative ATPase subunit of terminase; Provisional	96.41
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	96.4
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	96.4
PRK07940		394	DNA polymerase III subunit delta'; Validated	96.39
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	96.39
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	96.38
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	96.38
COG4889		1518	Predicted helicase [General function prediction on	96.37
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	96.35
TIGR02784		1141	addA_alphas double-strand break repair helicase Ad	96.33
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	96.32
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	96.29
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	96.29
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	96.28
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	96.27
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	96.26
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	96.25
PRK08084		235	DNA replication initiation factor; Provisional	96.22
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	96.22
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	96.2
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	96.19
PF00004		132	AAA: ATPase family associated with various cellula	96.16
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	96.15
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	96.15
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	96.15
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	96.14
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	96.13
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	96.13
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	96.13
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	96.12
PRK08058		329	DNA polymerase III subunit delta'; Validated	96.12
COG1205		851	Distinct helicase family with a unique C-terminal	96.11
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	96.09
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	96.08
PRK12377		248	putative replication protein; Provisional	96.08
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	96.07
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	96.05
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	96.02
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	95.99
PTZ00112		1164	origin recognition complex 1 protein; Provisional	95.99
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	95.96
PRK05707		328	DNA polymerase III subunit delta'; Validated	95.91
PRK10876		1181	recB exonuclease V subunit beta; Provisional	95.9
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	95.88
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	95.85
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	95.85
COG1201		814	Lhr Lhr-like helicases [General function predictio	95.85
PRK06893		229	DNA replication initiation factor; Validated	95.85
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	95.82
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	95.82
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	95.79
PRK07471		365	DNA polymerase III subunit delta'; Validated	95.79
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	95.72
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	95.72
PRK08903		227	DnaA regulatory inactivator Hda; Validated	95.71
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	95.67
PRK00771		437	signal recognition particle protein Srp54; Provisi	95.66
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	95.65
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	95.63
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	95.62
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	95.61
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	95.6
PRK08116		268	hypothetical protein; Validated	95.56
COG1484		254	DnaC DNA replication protein [DNA replication, rec	95.52
PRK09112		351	DNA polymerase III subunit delta'; Validated	95.51
PF03237		384	Terminase_6: Terminase-like family; InterPro: IPR0	95.51
PRK13909		910	putative recombination protein RecB; Provisional	95.41
COG0714		329	MoxR-like ATPases [General function prediction onl	95.4
PRK09200		790	preprotein translocase subunit SecA; Reviewed	95.39
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	95.39
COG1074		1139	RecB ATP-dependent exoDNAse (exonuclease V) beta s	95.36
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	95.35
KOG2028		554	consensus ATPase related to the helicase subunit o	95.35
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	95.35
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	95.32
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	95.25
PRK00149		450	dnaA chromosomal replication initiation protein; R	95.21
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	95.18
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	95.18
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	95.13
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	95.11
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	95.11
TIGR01547		396	phage_term_2 phage terminase, large subunit, PBSX	95.08
PRK08769		319	DNA polymerase III subunit delta'; Validated	95.08
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	95.07
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	95.07
PHA02533		534	17 large terminase protein; Provisional	95.07
COG3854		308	SpoIIIAA ncharacterized protein conserved in bacte	95.05
PRK03992		389	proteasome-activating nucleotidase; Provisional	95.03
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	95.03
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	95.03
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	95.0
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	94.98
PRK09183		259	transposase/IS protein; Provisional	94.95
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	94.92
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	94.9
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	94.89
PRK10867		433	signal recognition particle protein; Provisional	94.85
PRK05564		313	DNA polymerase III subunit delta'; Validated	94.85
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	94.83
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	94.8
PRK13833		323	conjugal transfer protein TrbB; Provisional	94.77
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	94.76
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	94.74
PRK06851		367	hypothetical protein; Provisional	94.73
PRK13531		498	regulatory ATPase RavA; Provisional	94.7
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	94.7
PRK08727		233	hypothetical protein; Validated	94.65
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	94.64
COG1435		201	Tdk Thymidine kinase [Nucleotide transport and met	94.62
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	94.6
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	94.59
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	94.53
CHL00181		287	cbbX CbbX; Provisional	94.49
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	94.42
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	94.41
PRK06067		234	flagellar accessory protein FlaH; Validated	94.4
PHA03368		738	DNA packaging terminase subunit 1; Provisional	94.39
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	94.35
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	94.31
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	94.3
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	94.3
PRK05642		234	DNA replication initiation factor; Validated	94.28
PRK06871		325	DNA polymerase III subunit delta'; Validated	94.23
PF05729		166	NACHT: NACHT domain	94.23
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	94.23
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	94.17
PRK04328		249	hypothetical protein; Provisional	94.15
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	94.11
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	94.1
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	94.1
PRK06835		329	DNA replication protein DnaC; Validated	94.03
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	94.03
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	93.99
cd01983		99	Fer4_NifH The Fer4_NifH superfamily contains a var	93.98
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	93.97
PHA02244		383	ATPase-like protein	93.95
PRK05973		237	replicative DNA helicase; Provisional	93.9
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	93.9
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	93.89
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	93.88
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	93.86
cd01394		218	radB RadB. The archaeal protein radB shares simila	93.84
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	93.83
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	93.82
COG3973		747	Superfamily I DNA and RNA helicases [General funct	93.81
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	93.81
TIGR02237		209	recomb_radB DNA repair and recombination protein R	93.78
PRK07399		314	DNA polymerase III subunit delta'; Validated	93.78
PRK06620		214	hypothetical protein; Validated	93.77
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	93.76
PRK08533		230	flagellar accessory protein FlaH; Reviewed	93.74
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	93.73
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	93.73
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	93.71
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	93.63
cd00983		325	recA RecA is a bacterial enzyme which has roles in	93.59
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	93.52
COG4178		604	ABC-type uncharacterized transport system, permeas	93.49
cd03115		173	SRP The signal recognition particle (SRP) mediates	93.48
PHA03372		668	DNA packaging terminase subunit 1; Provisional	93.42
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	93.4
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	93.36
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	93.35
PRK08939		306	primosomal protein DnaI; Reviewed	93.34
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	93.27
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	93.27
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	93.24
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	93.23
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	93.23
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	93.2
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	93.18
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	93.15
PRK06921		266	hypothetical protein; Provisional	93.15
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	93.14
PRK05298		652	excinuclease ABC subunit B; Provisional	93.04
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	93.0
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	92.97
PHA00729		226	NTP-binding motif containing protein	92.96
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	92.93
PHA02624		647	large T antigen; Provisional	92.92
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	92.89
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	92.88
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	92.83
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	92.82
KOG0736		953	consensus Peroxisome assembly factor 2 containing	92.81
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	92.8
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	92.78
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	92.73
CHL00195		489	ycf46 Ycf46; Provisional	92.61
PRK09354		349	recA recombinase A; Provisional	92.6
CHL00095		821	clpC Clp protease ATP binding subunit	92.56
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	92.5
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	92.46
TIGR02533		486	type_II_gspE general secretory pathway protein E.	92.46
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	92.45
PRK10436		462	hypothetical protein; Provisional	92.44
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	92.41
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	92.39
PRK06964		342	DNA polymerase III subunit delta'; Validated	92.38
KOG0781		587	consensus Signal recognition particle receptor, al	92.37
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	92.36
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	92.35
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	92.23
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	92.22
PRK06090		319	DNA polymerase III subunit delta'; Validated	92.18
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	92.17
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	92.15
KOG1533		290	consensus Predicted GTPase [General function predi	92.15
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	92.14
KOG1123		776	consensus RNA polymerase II transcription initiati	92.02
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	92.0
TIGR00064		272	ftsY signal recognition particle-docking protein F	91.97
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	91.81
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	91.78
PRK00131		175	aroK shikimate kinase; Reviewed	91.77
PRK08118		167	topology modulation protein; Reviewed	91.75
PRK15483		986	type III restriction-modification system StyLTI en	91.75
PRK09302		509	circadian clock protein KaiC; Reviewed	91.71
PRK07993		334	DNA polymerase III subunit delta'; Validated	91.7
KOG4439		901	consensus RNA polymerase II transcription terminat	91.62
PRK13765		637	ATP-dependent protease Lon; Provisional	91.58
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	91.54
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	91.46
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	91.41
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	91.41
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	91.41
PRK14531		183	adenylate kinase; Provisional	91.36
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	91.35
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	91.34
KOG0387		923	consensus Transcription-coupled repair protein CSB	91.33
cd01428		194	ADK Adenylate kinase (ADK) catalyzes the reversibl	91.31
PRK15455		644	PrkA family serine protein kinase; Provisional	91.31
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	91.29
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	91.28
CHL00176		638	ftsH cell division protein; Validated	91.27
PHA02774		613	E1; Provisional	91.23
KOG0343		758	consensus RNA Helicase [RNA processing and modific	91.17
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	91.17
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	91.16
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	91.14
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	91.14
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	91.13
PRK14532		188	adenylate kinase; Provisional	91.11
PF13476		202	AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V	91.11
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	91.1
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	91.1
PRK10416		318	signal recognition particle-docking protein FtsY;	91.04
PRK03839		180	putative kinase; Provisional	91.0
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	90.95
PRK11823		446	DNA repair protein RadA; Provisional	90.87
PRK02496		184	adk adenylate kinase; Provisional	90.78
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	90.77
PRK09302		509	circadian clock protein KaiC; Reviewed	90.75
PF00406		151	ADK: Adenylate kinase; InterPro: IPR000850 Adenyla	90.72
PF13555		62	AAA_29: P-loop containing region of AAA domain	90.68
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	90.55
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	90.52
COG1074		1139	RecB ATP-dependent exoDNAse (exonuclease V) beta s	90.49
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	90.42
cd01672		200	TMPK Thymidine monophosphate kinase (TMPK), also k	90.41
PRK14530		215	adenylate kinase; Provisional	90.4
PF12846		304	AAA_10: AAA-like domain	90.35
KOG3928		461	consensus Mitochondrial ribosome small subunit com	90.33
PRK05917		290	DNA polymerase III subunit delta'; Validated	90.29
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	90.28
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	90.24
PRK14528		186	adenylate kinase; Provisional	90.19
COG1202		830	Superfamily II helicase, archaea-specific [General	90.15
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	90.12
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	90.12
PRK08154		309	anaerobic benzoate catabolism transcriptional regu	90.1
PRK06696		223	uridine kinase; Validated	90.1
COG0593		408	DnaA ATPase involved in DNA replication initiation	90.09
TIGR00041		195	DTMP_kinase thymidylate kinase. Function: phosphor	90.08
PRK07261		171	topology modulation protein; Provisional	90.07
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	90.06
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	90.05
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	90.03
PRK14527		191	adenylate kinase; Provisional	90.02
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	90.01
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	89.93
PRK06762		166	hypothetical protein; Provisional	89.91
PF00265		176	TK: Thymidine kinase; InterPro: IPR001267 Thymidin	89.9
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	89.89
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	89.88
PRK00279		215	adk adenylate kinase; Reviewed	89.88
PRK06547		172	hypothetical protein; Provisional	89.88
PRK06851		367	hypothetical protein; Provisional	89.84
PRK12608		380	transcription termination factor Rho; Provisional	89.83
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	89.82
PRK05541		176	adenylylsulfate kinase; Provisional	89.78
PRK10865		857	protein disaggregation chaperone; Provisional	89.78
TIGR01351		210	adk adenylate kinases. Adenylate kinase (EC 2.7.4.	89.76
TIGR01313		163	therm_gnt_kin carbohydrate kinase, thermoresistant	89.75
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	89.73
PRK08233		182	hypothetical protein; Provisional	89.72
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	89.71
PLN02200		234	adenylate kinase family protein	89.68
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	89.58
COG0610		962	Type I site-specific restriction-modification syst	89.57
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	89.44
PRK11608		326	pspF phage shock protein operon transcriptional ac	89.43
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	89.42
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	89.42
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	89.38
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	89.27
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	89.26
TIGR00609		1087	recB exodeoxyribonuclease V, beta subunit. All pro	89.22
PRK05818		261	DNA polymerase III subunit delta'; Validated	89.22
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	89.21
COG1936		180	Predicted nucleotide kinase (related to CMP and AM	89.18
PRK10865		857	protein disaggregation chaperone; Provisional	89.11
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	89.04
PTZ00088		229	adenylate kinase 1; Provisional	89.03
PF07726		131	AAA_3: ATPase family associated with various cellu	89.02
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	88.93
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	88.9
TIGR02784		1141	addA_alphas double-strand break repair helicase Ad	88.85
PRK09087		226	hypothetical protein; Validated	88.81
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	88.8
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	88.78
PRK12904		830	preprotein translocase subunit SecA; Reviewed	88.76
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	88.75
PRK13947		171	shikimate kinase; Provisional	88.75
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	88.72
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	88.71
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	88.7
KOG1132		945	consensus Helicase of the DEAD superfamily [Replic	88.7
COG0606		490	Predicted ATPase with chaperone activity [Posttran	88.65
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	88.65
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	88.64
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	88.64
PRK13107		908	preprotein translocase subunit SecA; Reviewed	88.59
PRK00889		175	adenylylsulfate kinase; Provisional	88.52
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	88.48
PRK13909		910	putative recombination protein RecB; Provisional	88.33
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	88.31
KOG0346		569	consensus RNA helicase [RNA processing and modific	88.31
TIGR00959		428	ffh signal recognition particle protein. This mode	88.25
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	88.23

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

Probab=100.00  E-value=3.1e-47  Score=417.30  Aligned_cols=371  Identities=22%  Similarity=0.268  Sum_probs=283.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHhc-ccccceeEeechhhhhhhccccccccCCcCCCCcEEEEEEeCCCCCCCCCC
Q 006311          244 KPLLPSTYKDYFAALLYAEDFYEEKWSG-FQLFNVTLELHKAAIYDKSLKNKNLEESDETDDKLFVAFEIDSVPERRPFL  322 (651)
Q Consensus       244 ~~Lt~~nY~~~f~~LL~lEE~~~~~i~~-y~~~~v~l~~~~~~~~~~~l~~~~~g~~~~~~g~~~~~L~vpglaE~rPsl  322 (651)
                      ..-....|...|..|+.+|..+...+++ -..++++++|..                 ..+.+.++.|..|.+ ++.-.+
T Consensus       235 ry~da~~y~~vf~pliklea~ydk~~Kes~~q~~~tvRW~~-----------------gLnkk~~a~f~~~k~-~~e~kl  296 (935)
T KOG1802|consen  235 RYEDAYEYQNVFSPLIKLEADYDKRLKESQTQENGTVRWDI-----------------GLNKKRLAYFTLPKL-DSELKL  296 (935)
T ss_pred             cccchHHHhhhcchhhhhhhhhhhhhhhhcccccceEEeee-----------------ccccceEEEEecCCC-cchhcc
Confidence            3345789999999999999877665544 456788899842                 224567888888887 666789


Q ss_pred             CCCCEEEEEECCCCceeEE--EEEEEEecc--cEEEEEEcCCccCCCCCCccEEEEEEeCcchHHHHHHHHHHhhh--hc
Q 006311          323 LSRDFVYAQRSGGKSKKFQ--GFLYRVVKW--TTVLVEFEEDFHSQHQPNHKYDVSFSFNRVCLKRAHEAVADASD--SL  396 (651)
Q Consensus       323 ~~GD~V~v~~~~~~~~~y~--G~V~~v~~~--~~V~L~~~~~~~~~~~~~~~~~V~F~~nr~~~rr~h~Al~~~~~--~~  396 (651)
                      ..||.+.++..++....|+  |+|.++...  +++.|++...-...-+....|.|+|.++-++|.||..|+..+..  ..
T Consensus       297 ~~GdE~~L~y~~~~~~~w~~~g~v~~~pd~~~dE~~lEl~~~~~~p~e~~~~Ftvd~vwk~ts~drm~~alk~la~D~~~  376 (935)
T KOG1802|consen  297 AIGDEIRLTYSGGLVLPWNGIGSVLKIPDNNGDEVKLELEFSQDPPIEVTHGFTVDFVWKSTSFDRMQLALKLLAVDEKK  376 (935)
T ss_pred             ccCCeeEEEecCCcCCcccccceEEecCCCCcceeEEEeecCCCCCcccccceEEEEEEcCccHHHHHHHHHHhhhcccc
Confidence            9999999999876543355  777777663  57766654321122235668999999999999999999987642  11


Q ss_pred             c-----ccccCCCCC---CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHhccCCCceEEeCcCCCCCCCCchhHHHHHHHH
Q 006311          397 F-----RNYLFPDCA---SRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREAVL  468 (651)
Q Consensus       397 ~-----~~~LfP~~~---~~~~~~~~~~~~~~~~~LN~~Q~~AV~~iL~~~~~~p~LI~GPPGTGKT~s~~~~TlveaI~  468 (651)
                      +     ..+|+-...   .+...|. .+..+..++||.+|..||+++|+   .+..|||||||||||     .|.+++|.
T Consensus       377 vs~y~y~klLgh~~~~~~~k~~LP~-~~s~~~lpkLN~SQ~~AV~~VL~---rplsLIQGPPGTGKT-----vtsa~IVy  447 (935)
T KOG1802|consen  377 VSGYLYHKLLGHPVEDSSLKKLLPR-RFSVPNLPKLNASQSNAVKHVLQ---RPLSLIQGPPGTGKT-----VTSATIVY  447 (935)
T ss_pred             chhhhhhHHhcCcchhhhhcccCch-hhcCCCchhhchHHHHHHHHHHc---CCceeeecCCCCCce-----ehhHHHHH
Confidence            1     222222111   1122222 22233457999999999999999   789999999999999     99999999


Q ss_pred             HHHHhCCCCeEEEEccChhhHHHHHHHHHhhCCCcchhhhccccccccCCcH---------------HHHHhhhcc---c
Q 006311          469 QIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSD---------------EIFQVSLVE---R  530 (651)
Q Consensus       469 qll~~~~~~rILVcApSNsAaD~l~~rL~~~l~~~~i~Rv~a~~R~~~~v~~---------------~l~~y~~~~---~  530 (651)
                      ++.+. ...+||||||||.|+|+|++++++  .+.+++|+.+.+|+...-+.               ++.......   +
T Consensus       448 hl~~~-~~~~VLvcApSNiAVDqLaeKIh~--tgLKVvRl~aksRE~~~S~vs~L~lh~~~~~~~~pELq~l~klkde~g  524 (935)
T KOG1802|consen  448 HLARQ-HAGPVLVCAPSNIAVDQLAEKIHK--TGLKVVRLCAKSREDIESDVSFLSLHEQLRNMDKPELQKLLKLKDEGG  524 (935)
T ss_pred             HHHHh-cCCceEEEcccchhHHHHHHHHHh--cCceEeeeehhhhhhccCCccHHHHHHHHhccCcHHHHHHHhhhhhcc
Confidence            99997 678999999999999999999987  66899999999987422111               111111110   0


Q ss_pred             -------ccc----CCChhhhhcccceEeeehhcchhhhhcCCCCCCccEEEEecCCCCChHhHHHHHhccccCCCeEEE
Q 006311          531 -------ECF----SCPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIV  599 (651)
Q Consensus       531 -------~~f----~~p~~~~L~~~rIVvtT~ssa~~l~~~~~~~~~F~~IiIDEAsQatEpE~LIpL~~la~~~~rvVL  599 (651)
                             ..|    +...++.+.++.||+|||.+||...   +....|..|+||||.|++|||+||||...++   ++||
T Consensus       525 elS~sD~~k~~~lk~~~e~ell~~AdVIccTcv~Agd~r---l~~~kfr~VLiDEaTQatEpe~LiPlvlG~k---q~Vl  598 (935)
T KOG1802|consen  525 ELSSSDEKKYRKLKRAAEKELLNQADVICCTCVGAGDRR---LSKFKFRTVLIDEATQATEPECLIPLVLGAK---QLVL  598 (935)
T ss_pred             cccchhhHHHHHHHHHHHHHHHhhcCEEEEecccccchh---hccccccEEEEecccccCCcchhhhhhhcce---eEEE
Confidence                   011    1234678899999999999998755   4445799999999999999999999997666   9999


Q ss_pred             EeCCCCCCccccChHHHhCCCCccHHHHHHcC--------Cccccc-------CccchhhhhhcCC
Q 006311          600 TGAPHNSPSRVRSDIARKNGLKMSYFERLCLT--------EAYRSC-------NSMFFSQLFTEEV  650 (651)
Q Consensus       600 aGD~~QL~PvV~S~~a~~~GL~~SLfERL~~~--------~~Y~~~-------~~~fvtkL~~N~v  650 (651)
                      ||||+||||++..+.|...||.+||||||+..        -+|++|       +..|+..-++|||
T Consensus       599 VGDh~QLgpvi~~kK~a~Agl~qsLferli~lg~~P~~L~vQYRmhP~lSefpsn~fY~G~LqnGV  664 (935)
T KOG1802|consen  599 VGDHKQLGPVIMCKKAATAGLSQSLFERLISLGIKPIRLQVQYRMHPALSEFPSNMFYEGELQNGV  664 (935)
T ss_pred             eccccccCceeeeHHHHHhHHHHHHHHHHHhccCCceEEEEeeeeChhhhhcchhhhccchhhcCc
Confidence            99999999999999999999999999999873        689999       7899999999998

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>KOG1804 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>KOG1807 consensus Helicases [Replication, recombination and repair]	Back alignment and domain information

>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>KOG1804 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair]	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>PRK11773 uvrD DNA-dependent helicase II; Provisional	Back alignment and domain information

>KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification]	Back alignment and domain information

>TIGR01075 uvrD DNA helicase II	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>TIGR01073 pcrA ATP-dependent DNA helicase PcrA	Back alignment and domain information

>TIGR01074 rep ATP-dependent DNA helicase Rep	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>COG3972 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00609 recB exodeoxyribonuclease V, beta subunit	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>KOG0987 consensus DNA helicase PIF1/RRM3 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type	Back alignment and domain information

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK10876 recB exonuclease V subunit beta; Provisional	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging []	Back alignment and domain information

>PRK13909 putative recombination protein RecB; Provisional	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PHA02533 17 large terminase protein; Provisional	Back alignment and domain information

>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PHA03368 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PHA03372 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>PHA02624 large T antigen; Provisional	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>KOG1533 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional	Back alignment and domain information

>PRK09302 circadian clock protein KaiC; Reviewed	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14531 adenylate kinase; Provisional	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PHA02774 E1; Provisional	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK14532 adenylate kinase; Provisional	Back alignment and domain information

>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PRK02496 adk adenylate kinase; Provisional	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK09302 circadian clock protein KaiC; Reviewed	Back alignment and domain information

>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>KOG3928 consensus Mitochondrial ribosome small subunit component, mediator of apoptosis DAP3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>PRK14528 adenylate kinase; Provisional	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00041 DTMP_kinase thymidylate kinase	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>PRK14527 adenylate kinase; Provisional	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>PRK00279 adk adenylate kinase; Reviewed	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>PRK12608 transcription termination factor Rho; Provisional	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR01351 adk adenylate kinases	Back alignment and domain information

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PLN02200 adenylate kinase family protein	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR00609 recB exodeoxyribonuclease V, beta subunit	Back alignment and domain information

>PRK05818 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>PTZ00088 adenylate kinase 1; Provisional	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>PRK13909 putative recombination protein RecB; Provisional	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		651
2gk6_A		624	Regulator of nonsense transcripts 1; UPF1, helicas	2e-31
2xzl_A		802	ATP-dependent helicase NAM7; hydrolase-RNA complex	3e-30
2wjy_A		800	Regulator of nonsense transcripts 1; nonsense medi	6e-30
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-04

>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624	Back alignment and structure

 Score =  128 bits (323), Expect = 2e-31
 Identities = 94/460 (20%), Positives = 151/460 (32%), Gaps = 97/460 (21%)

Query: 248 PSTYKDYFAALLYAEDFYEEKWSGFQLFNVTLELHKAAIYDKSLKNKNLEE-----SDET 302
            S Y+D +         Y+  +       V LE    A YDK LK    ++      D  
Sbjct: 3   GSRYEDAYQ--------YQNIFGPL----VKLE----ADYDKKLKESQTQDNITVRWDLG 46

Query: 303 DDKLFVAFEIDSVPERRPFLLSRDFVYAQRSGGKSKKFQGFLYRVVKWTT----VLVEFE 358
            +K  +A+      +    L+  D +  +  G  +  ++G  + +         + +E  
Sbjct: 47  LNKKRIAYFTLPKTDSDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELR 106

Query: 359 EDFHSQHQPNHKYDVSFSFNRVCLKRAHEAV------ADASDSLFRNYLF----PDCASR 408
               +  +  H + V F +      R   A+        +      + L      D   +
Sbjct: 107 SSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIK 166

Query: 409 KSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVV-REAV 467
             +P           L+     AV  +L    +   L++GP         TG  V    +
Sbjct: 167 CQLPKRFTAQ-GLPDLNHSQVYAVKTVLQ---RPLSLIQGPP-------GTGKTVTSATI 215

Query: 468 LQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSL 527
           +    R     +L+CAP N   D+L E + +     ++ R  A  REA         +  
Sbjct: 216 VYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGL--KVVRLCAKSREAIDSPVSFLALHN 273

Query: 528 VERECFSCPPLEELRQYK------------------------------VISSTFVSSFRL 557
             R   S P L++L+Q K                              VI  T V +   
Sbjct: 274 QIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDP 333

Query: 558 HNQGITAGHFSHIFLID-ASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIAR 616
               +    F  I  ID ++ ATEPE M+ +   A    ++I+ G        V    A 
Sbjct: 334 R---LAKMQFRSIL-IDESTQATEPECMVPVVLGAK---QLILVGDHCQLGPVVMCKKAA 386

Query: 617 KNGLKMSYFERLC--------LTEAYRSCN--SMFFSQLF 646
           K GL  S FERL         L   YR     S F S +F
Sbjct: 387 KAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIF 426

PyMOL of 2gk6

>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802	Back alignment and structure

>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		651
4b3f_X		646	DNA-binding protein smubp-2; hydrolase, helicase;	100.0
2gk6_A		624	Regulator of nonsense transcripts 1; UPF1, helicas	100.0
2wjy_A		800	Regulator of nonsense transcripts 1; nonsense medi	100.0
2xzl_A		802	ATP-dependent helicase NAM7; hydrolase-RNA complex	100.0
1w36_D		608	RECD, exodeoxyribonuclease V alpha chain; recombin	99.68
3e1s_A		574	Exodeoxyribonuclease V, subunit RECD; alpha and be	99.67
3upu_A		459	ATP-dependent DNA helicase DDA; RECA-like domain,	99.64
3lfu_A		647	DNA helicase II; SF1 helicase, ATP-binding, DNA da	99.46
1uaa_A		673	REP helicase, protein (ATP-dependent DNA helicase	99.18
3vkw_A		446	Replicase large subunit; alpha/beta domain, helica	99.18
1pjr_A		724	PCRA; DNA repair, DNA replication, SOS response, h	99.13
3b6e_A		216	Interferon-induced helicase C domain-containing P;	98.96
1qde_A		224	EIF4A, translation initiation factor 4A; DEAD box	98.95
2gxq_A		207	Heat resistant RNA dependent ATPase; RNA helicase,	98.94
2pl3_A		236	Probable ATP-dependent RNA helicase DDX10; DEAD, s	98.93
1rif_A		282	DAR protein, DNA helicase UVSW; bacteriophage, REC	98.88
1hv8_A		367	Putative ATP-dependent RNA helicase MJ0669; RNA-bi	98.86
1vec_A		206	ATP-dependent RNA helicase P54; DEAD-box protein,	98.85
1t6n_A		220	Probable ATP-dependent RNA helicase; RECA-like fol	98.84
3iuy_A		228	Probable ATP-dependent RNA helicase DDX53; REC-A-l	98.82
2fz4_A		237	DNA repair protein RAD25; RECA-like domain, DNA da	98.79
3dkp_A		245	Probable ATP-dependent RNA helicase DDX52; DEAD, A	98.77
3bor_A		237	Human initiation factor 4A-II; translation initiat	98.76
2oxc_A		230	Probable ATP-dependent RNA helicase DDX20; DEAD, s	98.73
2oca_A		510	DAR protein, ATP-dependent DNA helicase UVSW; ATP-	98.73
1wp9_A		494	ATP-dependent RNA helicase, putative; ATPase, DNA	98.7
1s2m_A		400	Putative ATP-dependent RNA helicase DHH1; ATP-bind	98.68
3pey_A		395	ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A	98.68
3fht_A		412	ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box	98.67
3h1t_A		590	Type I site-specific restriction-modification syst	98.66
1q0u_A		219	Bstdead; DEAD protein, RNA binding protein; 1.85A	98.64
1wrb_A		253	DJVLGB; RNA helicase, DEAD BOX, VASA, structural g	98.64
3eiq_A		414	Eukaryotic initiation factor 4A-I; PDCD4, anti-onc	98.64
3ber_A		249	Probable ATP-dependent RNA helicase DDX47; DEAD, A	98.64
2z0m_A		337	337AA long hypothetical ATP-dependent RNA helicase	98.64
1fuu_A		394	Yeast initiation factor 4A; IF4A, helicase, DEAD-b	98.63
3fe2_A		242	Probable ATP-dependent RNA helicase DDX5; DEAD, AD	98.63
3ly5_A		262	ATP-dependent RNA helicase DDX18; alpha-beta, stru	98.62
4a2p_A		556	RIG-I, retinoic acid inducible protein I; hydrolas	98.62
1xti_A		391	Probable ATP-dependent RNA helicase P47; alpha-bet	98.62
3tbk_A		555	RIG-I helicase domain; DECH helicase, ATP binding,	98.6
2j0s_A		410	ATP-dependent RNA helicase DDX48; mRNA processing,	98.6
3fmo_B		300	ATP-dependent RNA helicase DDX19B; nuclear porin,	98.57
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	98.54
2fwr_A		472	DNA repair protein RAD25; DNA unwinding, XPB, DNA	98.52
3fho_A		508	ATP-dependent RNA helicase DBP5; mRNA export, ATPa	98.52
3fmp_B		479	ATP-dependent RNA helicase DDX19B; nuclear porin,	98.5
2ykg_A		696	Probable ATP-dependent RNA helicase DDX58; hydrola	98.49
2i4i_A		417	ATP-dependent RNA helicase DDX3X; DEAD, structural	98.46
3llm_A		235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	98.44
1z63_A		500	Helicase of the SNF2/RAD54 hamily; protein-DNA com	98.42
4gl2_A		699	Interferon-induced helicase C domain-containing P;	98.42
4a2q_A		797	RIG-I, retinoic acid inducible protein I; hydrolas	98.42
2va8_A		715	SSO2462, SKI2-type helicase; hydrolase, DNA repair	98.39
2db3_A		434	ATP-dependent RNA helicase VASA; DEAD-BOX, protein	98.35
2p6r_A		702	Afuhel308 helicase; protein-DNA complex, SF2 helic	98.3
4a4z_A		997	Antiviral helicase SKI2; hydrolase, ATPase, mRNA d	98.28
3l9o_A		1108	ATP-dependent RNA helicase DOB1; REC-A fold, winge	98.28
4a2w_A		936	RIG-I, retinoic acid inducible protein I; hydrolas	98.27
3i5x_A		563	ATP-dependent RNA helicase MSS116; protein-RNA com	98.27
1gm5_A		780	RECG; helicase, replication restart; HET: DNA ADP;	98.26
3sqw_A		579	ATP-dependent RNA helicase MSS116, mitochondrial;	98.25
2zj8_A		720	DNA helicase, putative SKI2-type helicase; RECA fo	98.23
3dmq_A		968	RNA polymerase-associated protein RAPA; SWF2/SNF2,	98.17
2eyq_A		1151	TRCF, transcription-repair coupling factor; MFD, S	98.17
4ddu_A		1104	Reverse gyrase; topoisomerase, DNA supercoiling, a	98.16
2xgj_A		1010	ATP-dependent RNA helicase DOB1; hydrolase-RNA com	98.14
1z3i_X		644	Similar to RAD54-like; recombination ATPase helica	98.14
3mwy_W		800	Chromo domain-containing protein 1; SWI2/SNF2 ATPa	98.09
3u4q_A		1232	ATP-dependent helicase/nuclease subunit A; helicas	98.0
2l8b_A		189	Protein TRAI, DNA helicase I; RECD, hydrolase; NMR	97.94
1gku_B		1054	Reverse gyrase, TOP-RG; topoisomerase, DNA superco	97.92
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	97.9
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	97.9
3o8b_A		666	HCV NS3 protease/helicase; ntpase, RNA, translocat	97.9
3crv_A		551	XPD/RAD3 related DNA helicase; XPD helicase DNA re	97.89
2w00_A		1038	HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri	97.88
2vl7_A		540	XPD; helicase, unknown function; 2.25A {Sulfolobus	97.74
2v1x_A		591	ATP-dependent DNA helicase Q1; DNA strand annealin	97.69
2jlq_A		451	Serine protease subunit NS3; ribonucleoprotein, nu	97.59
2b8t_A		223	Thymidine kinase; deoxyribonucleoside kinase, zinc	97.59
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	97.52
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	97.51
2zpa_A		671	Uncharacterized protein YPFI; RNA modification enz	97.5
1oyw_A		523	RECQ helicase, ATP-dependent DNA helicase; winged	97.45
2orw_A		184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	97.41
2chg_A		226	Replication factor C small subunit; DNA-binding pr	97.41
2z83_A		459	Helicase/nucleoside triphosphatase; hydrolase, mem	97.35
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	97.32
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	97.32
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	97.25
1xx6_A		191	Thymidine kinase; NESG, northeast structural genom	97.15
2whx_A		618	Serine protease/ntpase/helicase NS3; transcription	97.14
2j9r_A		214	Thymidine kinase; TK1, DNK, lasso, transferase, AT	97.14
1yks_A		440	Genome polyprotein [contains: flavivirin protease	97.06
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	97.05
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	97.04
1ojl_A		304	Transcriptional regulatory protein ZRAR; response	97.02
1w4r_A		195	Thymidine kinase; type II, human, cytosolic, phosp	97.02
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	96.9
3bos_A		242	Putative DNA replication factor; P-loop containing	96.9
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	96.89
2gno_A		305	DNA polymerase III, gamma subunit-related protein;	96.86
1w36_B		1180	RECB, exodeoxyribonuclease V beta chain; recombina	96.84
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	96.84
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	96.79
2o0j_A		385	Terminase, DNA packaging protein GP17; nucleotide-	96.54
3cpe_A		592	Terminase, DNA packaging protein GP17; large termi	96.53
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	96.53
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	96.46
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	96.46
3rc3_A		677	ATP-dependent RNA helicase SUPV3L1, mitochondrial;	96.44
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	96.41
1g5t_A		196	COB(I)alamin adenosyltransferase; P-loop protein,	96.31
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	96.29
2qz4_A		262	Paraplegin; AAA+, SPG7, protease, ADP, structural	96.28
3e2i_A		219	Thymidine kinase; Zn-binding, ATP-binding, DNA syn	96.24
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	96.23
3kl4_A		433	SRP54, signal recognition 54 kDa protein; signal r	96.18
4a15_A		620	XPD helicase, ATP-dependent DNA helicase TA0057; h	96.13
1ofh_A		310	ATP-dependent HSL protease ATP-binding subunit HSL	96.12
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	96.05
2orv_A		234	Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2	95.99
3eie_A		322	Vacuolar protein sorting-associated protein 4; AAA	95.94
3co5_A		143	Putative two-component system transcriptional RES	95.94
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	95.9
4b4t_M		434	26S protease regulatory subunit 6A; hydrolase, AAA	95.89
2bjv_A		265	PSP operon transcriptional activator; AAA, transcr	95.86
2r62_A		268	Cell division protease FTSH homolog; ATPase domain	95.83
3cf0_A		301	Transitional endoplasmic reticulum ATPase; AAA, P9	95.78
3b9p_A		297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	95.71
1g8p_A		350	Magnesium-chelatase 38 kDa subunit; parallel beta	95.66
4b4t_K		428	26S protease regulatory subunit 6B homolog; hydrol	95.65
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	95.64
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	95.59
1lv7_A		257	FTSH; alpha/beta domain, four helix bundle, hydrol	95.59
1c4o_A		664	DNA nucleotide excision repair enzyme UVRB; uvrabc	95.55
4b4t_L		437	26S protease subunit RPT4; hydrolase, AAA-atpases,	95.55
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	95.54
4b4t_J		405	26S protease regulatory subunit 8 homolog; hydrola	95.52
2chq_A		319	Replication factor C small subunit; DNA-binding pr	95.52
3dm5_A		443	SRP54, signal recognition 54 kDa protein; protein-	95.48
3hws_A		363	ATP-dependent CLP protease ATP-binding subunit CL;	95.47
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	95.45
2r44_A		331	Uncharacterized protein; putative ATPase, structur	95.45
4b4t_H		467	26S protease regulatory subunit 7 homolog; hydrola	95.43
1tf5_A		844	Preprotein translocase SECA subunit; ATPase, helic	95.42
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	95.35
1tue_A		212	Replication protein E1; helicase, replication, E1E	95.31
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	95.29
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	95.29
3pxg_A		468	Negative regulator of genetic competence CLPC/MEC;	95.29
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	95.28
2fsf_A		853	Preprotein translocase SECA subunit; ATPase, DNA-R	95.21
3t15_A		293	Ribulose bisphosphate carboxylase/oxygenase activ	95.16
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	95.12
4fcw_A		311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	95.12
3uk6_A		368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	95.11
4b4t_I		437	26S protease regulatory subunit 4 homolog; hydrola	95.08
3d8b_A		357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	95.04
3pfi_A		338	Holliday junction ATP-dependent DNA helicase RUVB;	95.03
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	95.01
3pvs_A		447	Replication-associated recombination protein A; ma	94.96
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	94.96
2zan_A		444	Vacuolar protein sorting-associating protein 4B; S	94.95
3vfd_A		389	Spastin; ATPase, microtubule severing, hydrolase;	94.86
1nkt_A		922	Preprotein translocase SECA 1 subunit; preprotein	94.85
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	94.81
2qgz_A		308	Helicase loader, putative primosome component; str	94.8
2c9o_A		456	RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-	94.72
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	94.65
2dr3_A		247	UPF0273 protein PH0284; RECA superfamily ATPase, h	94.5
1in4_A		334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	94.32
1um8_A		376	ATP-dependent CLP protease ATP-binding subunit CL;	94.26
3hu3_A		489	Transitional endoplasmic reticulum ATPase; VCP, tr	94.12
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	94.11
3nbx_X		500	ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu	94.04
2ipc_A		997	Preprotein translocase SECA subunit; nucleotide bi	94.0
1ixz_A		254	ATP-dependent metalloprotease FTSH; AAA domain fol	93.86
1u0j_A		267	DNA replication protein; AAA+ protein, P-loop atpa	93.71
2x8a_A		274	Nuclear valosin-containing protein-like; nuclear p	93.63
3io5_A		333	Recombination and repair protein; storage dimer, i	93.49
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	93.36
3bh0_A		315	DNAB-like replicative helicase; ATPase, replicatio	93.13
2d7d_A		661	Uvrabc system protein B; helicase, protein-DNA-ADP	93.08
2z0h_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	93.01
2w0m_A		235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	92.9
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	92.86
3hr8_A		356	Protein RECA; alpha and beta proteins (A/B, A+B),	92.79
3k1j_A		604	LON protease, ATP-dependent protease LON; ATP-bind	92.79
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	92.74
2zts_A		251	Putative uncharacterized protein PH0186; KAIC like	92.64
3u4q_B		1166	ATP-dependent helicase/deoxyribonuclease subunit;	92.57
2r2a_A		199	Uncharacterized protein; zonular occludens toxin,	92.55
2ce7_A		476	Cell division protein FTSH; metalloprotease; HET:	92.5
1iy2_A		278	ATP-dependent metalloprotease FTSH; AAA domain fol	92.35
1cr0_A		296	DNA primase/helicase; RECA-type protein fold, tran	92.34
2zr9_A		349	Protein RECA, recombinase A; recombination, RECA m	92.15
1g41_A		444	Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep	92.07
1xp8_A		366	RECA protein, recombinase A; recombination, radior	91.78
1u94_A		356	RECA protein, recombinase A; homologous recombinat	91.78
3kb2_A		173	SPBC2 prophage-derived uncharacterized protein YOR	91.61
2dhr_A		499	FTSH; AAA+ protein, hexameric Zn metalloprotease,	91.59
1ly1_A		181	Polynucleotide kinase; PNK, phosphatase, transfera	91.51
3lw7_A		179	Adenylate kinase related protein (ADKA-like); AMP,	91.2
3cf2_A		806	TER ATPase, transitional endoplasmic reticulum ATP	91.19
1qhx_A		178	CPT, protein (chloramphenicol phosphotransferase);	91.13
2cvh_A		220	DNA repair and recombination protein RADB; filamen	91.12
2r6a_A		454	DNAB helicase, replicative helicase; replication,	91.11
3m6a_A		543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	91.07
1nks_A		194	Adenylate kinase; thermophilic, transferase; HET:	91.04
3iij_A		180	Coilin-interacting nuclear ATPase protein; alpha a	91.0
3trf_A		185	Shikimate kinase, SK; amino acid biosynthesis, tra	90.76
2r8r_A		228	Sensor protein; KDPD, PFAM02702, MCSG, structural	90.7
1kht_A		192	Adenylate kinase; phosphotransferase, signaling pr	90.62
3umf_A		217	Adenylate kinase; rossmann fold, transferase; 2.05	90.58
1p9r_A		418	General secretion pathway protein E; bacterial typ	90.55
2plr_A		213	DTMP kinase, probable thymidylate kinase; TMP-bind	90.53
2pbr_A		195	DTMP kinase, thymidylate kinase; transferase, nucl	90.49
1kag_A		173	SKI, shikimate kinase I; transferase, structural g	90.32
4eun_A		200	Thermoresistant glucokinase; putative sugar kinase	90.29
3cf2_A		806	TER ATPase, transitional endoplasmic reticulum ATP	90.29
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	90.26
1gvn_B		287	Zeta; postsegregational killing system, plasmid; 1	90.19
1nlf_A		279	Regulatory protein REPA; replicative DNA helicase	90.13
1n0w_A		243	DNA repair protein RAD51 homolog 1; DNA repair, ho	90.12
1via_A		175	Shikimate kinase; structural genomics, transferase	90.02
2yvu_A		186	Probable adenylyl-sulfate kinase; transferase, str	89.99
3sr0_A		206	Adenylate kinase; phosphoryl transfer analogue, AL	89.82
2rhm_A		193	Putative kinase; P-loop containing nucleoside trip	89.77
2vli_A		183	Antibiotic resistance protein; transferase, tunica	89.76
3vaa_A		199	Shikimate kinase, SK; structural genomics, center	89.74
2iyv_A		184	Shikimate kinase, SK; transferase, aromatic amino	89.69
1nn5_A		215	Similar to deoxythymidylate kinase (thymidylate K;	89.65
4a1f_A		338	DNAB helicase, replicative DNA helicase; hydrolase	89.47
3bgw_A		444	DNAB-like replicative helicase; ATPase, replicatio	89.43
1zak_A		222	Adenylate kinase; ATP:AMP-phosphotransferase, tran	89.43
3t61_A		202	Gluconokinase; PSI-biology, structural genomics, p	89.38
1ypw_A		806	Transitional endoplasmic reticulum ATPase; AAA, P9	89.31
2c95_A		196	Adenylate kinase 1; transferase, AP4A, nucleotide	89.26
3cm0_A		186	Adenylate kinase; ATP-binding, cytoplasm, nucleoti	89.17
2v3c_C		432	SRP54, signal recognition 54 kDa protein; nucleoti	89.13
3dl0_A		216	Adenylate kinase; phosphotransferase, zinc coordin	89.07
2q6t_A		444	DNAB replication FORK helicase; hydrolase; 2.90A {	89.07
3fb4_A		216	Adenylate kinase; psychrophIle, phosphotransferase	89.06
1tev_A		196	UMP-CMP kinase; ploop, NMP binding region, LID reg	89.05
1zp6_A		191	Hypothetical protein ATU3015; alpha-beta protein.,	89.05
2cdn_A		201	Adenylate kinase; phosphoryl transfer, associative	88.92
1aky_A		220	Adenylate kinase; ATP:AMP phosphotransferase, myok	88.89
4edh_A		213	DTMP kinase, thymidylate kinase; structural genomi	88.84
1knq_A		175	Gluconate kinase; ALFA/beta structure, transferase	88.69
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	88.67
3b85_A		208	Phosphate starvation-inducible protein; PHOH2, ATP	88.65
2px0_A		296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	88.6
2z43_A		324	DNA repair and recombination protein RADA; archaea	88.6
3uie_A		200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	88.59
2qor_A		204	Guanylate kinase; phosphotransferase, purine metab	88.58
2bwj_A		199	Adenylate kinase 5; phosphoryl transfer reaction,	88.57
4eaq_A		229	DTMP kinase, thymidylate kinase; structural genomi	88.55
1e6c_A		173	Shikimate kinase; phosphoryl transfer, ADP, shikim	88.52
3a4m_A		260	L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m	88.51
3f9v_A		595	Minichromosome maintenance protein MCM; replicativ	88.49
1v5w_A		343	DMC1, meiotic recombination protein DMC1/LIM15 hom	88.38
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	88.38
2jaq_A		205	Deoxyguanosine kinase; transferase, deoxyribonucle	88.36
1y63_A		184	LMAJ004144AAA protein; structural genomics, protei	88.23
1qf9_A		194	UMP/CMP kinase, protein (uridylmonophosphate/cytid	87.93
2wwf_A		212	Thymidilate kinase, putative; transferase, malaria	87.86
2ze6_A		253	Isopentenyl transferase; crown GALL tumor, cytokin	87.84
2p5t_B		253	PEZT; postsegregational killing system, phosphoryl	87.76
1ex7_A		186	Guanylate kinase; substrate-induced FIT, domain mo	87.74
1ye8_A		178	Protein THEP1, hypothetical UPF0334 kinase-like pr	87.62
1ak2_A		233	Adenylate kinase isoenzyme-2; nucleoside monophosp	87.58
3tlx_A		243	Adenylate kinase 2; structural genomics, structura	87.39
3p32_A		355	Probable GTPase RV1496/MT1543; structural genomics	87.28
1zd8_A		227	GTP:AMP phosphotransferase mitochondrial; ATP:AMP	87.22
2bbw_A		246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	87.2
1xjc_A		169	MOBB protein homolog; structural genomics, midwest	87.14
1e4v_A		214	Adenylate kinase; transferase(phosphotransferase);	87.13
2xb4_A		223	Adenylate kinase; ATP-binding, nucleotide-binding,	87.12
1zuh_A		168	Shikimate kinase; alpha-beta protein, transferase;	87.04
3v9p_A		227	DTMP kinase, thymidylate kinase; ssgcid, STRU geno	86.94
2pt5_A		168	Shikimate kinase, SK; aromatic amino acid biosynth	86.92
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	86.84
1q57_A		503	DNA primase/helicase; dntpase, DNA replication, tr	86.84
3lv8_A		236	DTMP kinase, thymidylate kinase; structural genomi	86.84
3tau_A		208	Guanylate kinase, GMP kinase; structural genomics,	86.83
1m7g_A		211	Adenylylsulfate kinase; APS kinase, transferase, s	86.8
2v54_A		204	DTMP kinase, thymidylate kinase; nucleotide biosyn	86.79
3be4_A		217	Adenylate kinase; malaria, cryptosporidium parvum	86.79
2bdt_A		189	BH3686; alpha-beta protein, structural genomics, P	86.77
2j41_A		207	Guanylate kinase; GMP, GMK, transferase, ATP-bindi	86.74
2ehv_A		251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	86.69
1ypw_A		806	Transitional endoplasmic reticulum ATPase; AAA, P9	86.55
3c8u_A		208	Fructokinase; YP_612366.1, putative fructose trans	86.36
2fna_A		357	Conserved hypothetical protein; structural genomic	86.25
1vma_A		306	Cell division protein FTSY; TM0570, structural gen	86.25
1ukz_A		203	Uridylate kinase; transferase; HET: ADP AMP; 1.90A	86.16
1rz3_A		201	Hypothetical protein rbstp0775; MCSG, structural g	86.15
1pzn_A		349	RAD51, DNA repair and recombination protein RAD51,	86.1
2wsm_A		221	Hydrogenase expression/formation protein (HYPB); m	86.08
3tr0_A		205	Guanylate kinase, GMP kinase; purines, pyrimidines	86.05
1svm_A		377	Large T antigen; AAA+ fold, viral protein; HET: AT	86.0
1kgd_A		180	CASK, peripheral plasma membrane CASK; maguk, guan	85.97
1cke_A		227	CK, MSSA, protein (cytidine monophosphate kinase);	85.88
1f2t_A		149	RAD50 ABC-ATPase; DNA double-strand break repair,	85.86
4a74_A		231	DNA repair and recombination protein RADA; hydrola	85.75
3l0o_A		427	Transcription termination factor RHO; helicase, RH	85.68
2i1q_A		322	DNA repair and recombination protein RADA; ATPase,	85.65
4ag6_A		392	VIRB4 ATPase, type IV secretory pathway VIRB4 comp	85.61
3cmu_A		2050	Protein RECA, recombinase A; homologous recombinat	85.59
2vhj_A		331	Ntpase P4, P4; non- hydrolysable ATP analogue, hyd	85.58
2j37_W		504	Signal recognition particle 54 kDa protein (SRP54)	85.58
4tmk_A		213	Protein (thymidylate kinase); ATP:DTMP phosphotran	85.54
3a00_A		186	Guanylate kinase, GMP kinase; domain movement, dim	85.48
3ice_A		422	Transcription termination factor RHO; transcriptio	85.42
3kta_A		182	Chromosome segregation protein SMC; structural mai	85.3
1w36_B		1180	RECB, exodeoxyribonuclease V beta chain; recombina	84.77
1e9r_A		437	Conjugal transfer protein TRWB; coupling protein,	84.3
3qks_A		203	DNA double-strand break repair RAD50 ATPase; RECA-	83.76
3jvv_A		356	Twitching mobility protein; hexameric P-loop ATPas	83.75
1gtv_A		214	TMK, thymidylate kinase; transferase, transferase	83.62
1j8m_F		297	SRP54, signal recognition 54 kDa protein; signalin	83.61
1lvg_A		198	Guanylate kinase, GMP kinase; transferase; HET: AD	83.49
1zu4_A		320	FTSY; GTPase, signal recognition particle, SRP, re	83.44
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	83.3
1ltq_A		301	Polynucleotide kinase; phosphatase, alpha/beta, P-	83.27
3u4q_A		1232	ATP-dependent helicase/nuclease subunit A; helicas	83.2
2hf9_A		226	Probable hydrogenase nickel incorporation protein	82.87
1rj9_A		304	FTSY, signal recognition protein; SRP-GTPase domai	82.86
2eyu_A		261	Twitching motility protein PILT; pilus retraction	82.8
1jjv_A		206	Dephospho-COA kinase; P-loop nucleotide-binding fo	82.58
2ewv_A		372	Twitching motility protein PILT; pilus retraction	82.45
4akg_A		2695	Glutathione S-transferase class-MU 26 kDa isozyme	82.44
2if2_A		204	Dephospho-COA kinase; alpha-beta protein, structur	82.17
4gp7_A		171	Metallophosphoesterase; polynucleotide kinase phos	82.13
2pez_A		179	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	82.11
1np6_A		174	Molybdopterin-guanine dinucleotide biosynthesis pr	82.06
3cmw_A		1706	Protein RECA, recombinase A; homologous recombinat	81.39
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	81.29
3cmw_A		1706	Protein RECA, recombinase A; homologous recombinat	81.06
3b9q_A		302	Chloroplast SRP receptor homolog, alpha subunit CP	81.05
3cmu_A		2050	Protein RECA, recombinase A; homologous recombinat	80.98
3ake_A		208	Cytidylate kinase; CMP kinase, CMP complex, open c	80.96
2qm8_A		337	GTPase/ATPase; G protein, G3E, metallochaperone, c	80.84
3lnc_A		231	Guanylate kinase, GMP kinase; ALS collaborative cr	80.52
2v9p_A		305	Replication protein E1; AAA+ molecular motor, DNA	80.23
1uf9_A		203	TT1252 protein; P-loop, nucleotide binding domain,	80.22
3ney_A		197	55 kDa erythrocyte membrane protein; structural ge	80.2
3r20_A		233	Cytidylate kinase; structural genomics, seattle st	80.19
3e70_C		328	DPA, signal recognition particle receptor; FTSY, S	80.16

>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A	Back alignment and structure

Probab=100.00  E-value=1.4e-48  Score=446.88  Aligned_cols=362  Identities=24%  Similarity=0.248  Sum_probs=261.1

Q ss_pred             CHHHHHHHHHHHHHHHHHHHH-HHhcccccceeEeechhhhhhhcccccccc------CCcCCCCcEEEEEEeCCCCCC-
Q 006311          247 LPSTYKDYFAALLYAEDFYEE-KWSGFQLFNVTLELHKAAIYDKSLKNKNLE------ESDETDDKLFVAFEIDSVPER-  318 (651)
Q Consensus       247 t~~nY~~~f~~LL~lEE~~~~-~i~~y~~~~v~l~~~~~~~~~~~l~~~~~g------~~~~~~g~~~~~L~vpglaE~-  318 (651)
                      +.++|.++|..||.+|+.+.. ..+.. +.....+.       ..-.|.+++      ......|+.++.|+.+..... 
T Consensus         3 ~~~~~~~~~~~Ll~~E~~~e~~~~~~~-~~~~~~~~-------~~~~G~~~~~l~~~~~~~~~~g~~~~~~~~~~~~~~~   74 (646)
T 4b3f_X            3 AVESFVTKQLDLLELERDAEVEERRSW-QENISLKE-------LQSRGVCLLKLQVSSQRTGLYGRLLVTFEPRRYGSAA   74 (646)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHH-HHSSCHHH-------HGGGTSEEEEEEEEEEEECSSSCEEEEEEESCC---C
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHH-HhcCCHHH-------HHhCCceecceEEEEEEecCCCeEEEEEEecCCCCCC
Confidence            468999999999999975433 33221 11111100       001122221      112346788889987654332 


Q ss_pred             -CC--CCCCCCEEEEEECCC-CceeEEEEEEEEecccEEEEEEcCCc--cCCCCCCccEEEEEEeCcchHHHHHHHHHHh
Q 006311          319 -RP--FLLSRDFVYAQRSGG-KSKKFQGFLYRVVKWTTVLVEFEEDF--HSQHQPNHKYDVSFSFNRVCLKRAHEAVADA  392 (651)
Q Consensus       319 -rP--sl~~GD~V~v~~~~~-~~~~y~G~V~~v~~~~~V~L~~~~~~--~~~~~~~~~~~V~F~~nr~~~rr~h~Al~~~  392 (651)
                       -|  .+..||.|.++...+ ....++|+|+++.. ++|.|.|+...  .........|.+.+..|+++++||++|++.+
T Consensus        75 ~l~~~~~~~Gd~v~~~~~~~~~~~~~~g~v~~~~~-~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~al~~l  153 (646)
T 4b3f_X           75 ALPSNSFTSGDIVGLYDAANEGSQLATGILTRVTQ-KSVTVAFDESHDFQLSLDRENSYRLLKLANDVTYRRLKKALIAL  153 (646)
T ss_dssp             CCCCCCCCTTCEEEEEETTTTSCCCEEEEEEEEET-TEEEEECC-------CCCSSCCEEEEEECCHHHHHHHHHHHHHH
T ss_pred             CCccCCCCCCCEEEEEecCCCCCceEEEEEEEEeC-CEEEEEECCccccccccCCCCcEEEEEeccchHHHHHHHHHHHh
Confidence             22  578999999998644 34689999999999 99999997642  2223345679999999999999999999988


Q ss_pred             hh------hccccccCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHhccCCCceEEeCcCCCCCCCCchhHHHHHH
Q 006311          393 SD------SLFRNYLFPDCASRKSIPYPSLCPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVLSKTGNVVREA  466 (651)
Q Consensus       393 ~~------~~~~~~LfP~~~~~~~~~~~~~~~~~~~~LN~~Q~~AV~~iL~~~~~~p~LI~GPPGTGKT~s~~~~Tlvea  466 (651)
                      ..      ..+.++||+...+.+.... ....|.+..||++|++||..+|+.  .+++||+||||||||     +|++++
T Consensus       154 ~~~~~~~~~~l~~~l~~~~~p~~~~~~-~~~~~~~~~LN~~Q~~AV~~al~~--~~~~lI~GPPGTGKT-----~ti~~~  225 (646)
T 4b3f_X          154 KKYHSGPASSLIEVLFGRSAPSPASEI-HPLTFFNTCLDTSQKEAVLFALSQ--KELAIIHGPPGTGKT-----TTVVEI  225 (646)
T ss_dssp             HTCCSSTTHHHHHHHTTSSCCCCCCCC-CCCCCSSTTCCHHHHHHHHHHHHC--SSEEEEECCTTSCHH-----HHHHHH
T ss_pred             hhcccCchHHHHHHHcCCCCCCCcccc-CcccccCCCCCHHHHHHHHHHhcC--CCceEEECCCCCCHH-----HHHHHH
Confidence            63      2345678876553222211 234556789999999999999972  568999999999999     999999


Q ss_pred             HHHHHHhCCCCeEEEEccChhhHHHHHHHHHhhCCCcchhhhccccccccCCcHHHHHhhhcc-----------------
Q 006311          467 VLQIRRRSPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVE-----------------  529 (651)
Q Consensus       467 I~qll~~~~~~rILVcApSNsAaD~l~~rL~~~l~~~~i~Rv~a~~R~~~~v~~~l~~y~~~~-----------------  529 (651)
                      |.++++.  +.+||||||||.|||++++||..  .+.+++|++...|..+    .+..++...                 
T Consensus       226 I~~l~~~--~~~ILv~a~TN~AvD~i~erL~~--~~~~ilRlG~~~r~~~----~~~~~~l~~~~~~~~~~~~~~~~~~~  297 (646)
T 4b3f_X          226 ILQAVKQ--GLKVLCCAPSNIAVDNLVERLAL--CKQRILRLGHPARLLE----SIQQHSLDAVLARSDSAQIVADIRKD  297 (646)
T ss_dssp             HHHHHHT--TCCEEEEESSHHHHHHHHHHHHH--TTCCEEECSCCSSCCH----HHHTTBHHHHHTTTTCSSTHHHHHHH
T ss_pred             HHHHHhC--CCeEEEEcCchHHHHHHHHHHHh--cCCceEEecchhhhhh----hhhhhhHHHHHhhchHHHHHHHHHHH
Confidence            9999986  78999999999999999999986  4567899988766322    222111100                 


Q ss_pred             -cccc------------------------------CCChhhhhcccceEeeehhcchhhhh-cCCCCCCccEEEEecCCC
Q 006311          530 -RECF------------------------------SCPPLEELRQYKVISSTFVSSFRLHN-QGITAGHFSHIFLIDASS  577 (651)
Q Consensus       530 -~~~f------------------------------~~p~~~~L~~~rIVvtT~ssa~~l~~-~~~~~~~F~~IiIDEAsQ  577 (651)
                       ...+                              .....+.+..++||++||.+++.... ..+...+||+||||||+|
T Consensus       298 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~l~~~~vv~~t~~~a~~~~~~~~~~~~~Fd~vIIDEAsQ  377 (646)
T 4b3f_X          298 IDQVFVKNKKTQDKREKSNFRNEIKLLRKELKEREEAAMLESLTSANVVLATNTGASADGPLKLLPESYFDVVVIDECAQ  377 (646)
T ss_dssp             HTTSSTTTTC------CCSSHHHHHHHHHHHHHHHHHHHHHHHHHCSEEEEETTTTCSSSGGGGSCTTCCSEEEETTGGG
T ss_pred             HHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcceeeeehhhhhhhhHHHhhhhccCCEEEEcCccc
Confidence             0000                              00112457789999999998865322 224667899999999999


Q ss_pred             CChHhHHHHHhccccCCCeEEEEeCCCCCCccccChHHHhCCCCccHHHHHHc----------CCccccc
Q 006311          578 ATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRSDIARKNGLKMSYFERLCL----------TEAYRSC  637 (651)
Q Consensus       578 atEpE~LIpL~~la~~~~rvVLaGD~~QL~PvV~S~~a~~~GL~~SLfERL~~----------~~~Y~~~  637 (651)
                      ++||++|+||. .+   .++||||||+||||++.+..|...|++.||||||++          ..+||+|
T Consensus       378 ~~e~~~lipL~-~~---~~~ILVGD~~QLpP~v~~~~a~~~gl~~SlferL~~~~~~~~v~~L~~qYRmh  443 (646)
T 4b3f_X          378 ALEASCWIPLL-KA---RKCILAGDHKQLPPTTVSHKAALAGLSLSLMERLAEEYGARVVRTLTVQYRMH  443 (646)
T ss_dssp             SCHHHHTTTGG-GS---SEEEEEECTTSCCCCCSCHHHHHTTTTCCHHHHHHHHHGGGTEEECCEESSSC
T ss_pred             cchHHHHhhcc-cc---ceEEEcCCccccCceecchhhhhccccchHHHHHHHhcCCceeeecccccCCc
Confidence            99999999997 34   489999999999999999999999999999999975          3578887

PyMOL of 4b3f

>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A	Back alignment and structure

>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A	Back alignment and structure

>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D*	Back alignment and structure

>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A*	Back alignment and structure

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}	Back alignment and structure

>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A*	Back alignment and structure

>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus}	Back alignment and structure

>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B*	Back alignment and structure

>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens}	Back alignment and structure

>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A	Back alignment and structure

>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A	Back alignment and structure

>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens}	Back alignment and structure

>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23	Back alignment and structure

>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens}	Back alignment and structure

>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19	Back alignment and structure

>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens}	Back alignment and structure

>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A*	Back alignment and structure

>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A*	Back alignment and structure

>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4}	Back alignment and structure

>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A	Back alignment and structure

>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A*	Back alignment and structure

>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B	Back alignment and structure

>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus}	Back alignment and structure

>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19	Back alignment and structure

>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19	Back alignment and structure

>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens}	Back alignment and structure

>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens}	Back alignment and structure

>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A*	Back alignment and structure

>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A	Back alignment and structure

>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens}	Back alignment and structure

>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A*	Back alignment and structure

>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A	Back alignment and structure

>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus}	Back alignment and structure

>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A	Back alignment and structure

>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens}	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A*	Back alignment and structure

>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A*	Back alignment and structure

>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens}	Back alignment and structure

>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A*	Back alignment and structure

>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens}	Back alignment and structure

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens}	Back alignment and structure

>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A	Back alignment and structure

>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens}	Back alignment and structure

>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos}	Back alignment and structure

>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus}	Back alignment and structure

>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster}	Back alignment and structure

>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A	Back alignment and structure

>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A	Back alignment and structure

>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae}	Back alignment and structure

>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos}	Back alignment and structure

>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A	Back alignment and structure

>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19	Back alignment and structure

>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A*	Back alignment and structure

>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12}	Back alignment and structure

>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1	Back alignment and structure

>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A	Back alignment and structure

>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A*	Back alignment and structure

>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli}	Back alignment and structure

>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B*	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B*	Back alignment and structure

>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ...	Back alignment and structure

>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1*	Back alignment and structure

>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B*	Back alignment and structure

>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii}	Back alignment and structure

>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A*	Back alignment and structure

>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A	Back alignment and structure

>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A*	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12}	Back alignment and structure

>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A*	Back alignment and structure

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A	Back alignment and structure

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A	Back alignment and structure

>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A*	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A*	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus}	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium}	Back alignment and structure

>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A*	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B*	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A*	Back alignment and structure

>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A*	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A*	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}	Back alignment and structure

>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus}	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A	Back alignment and structure

>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A*	Back alignment and structure

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C	Back alignment and structure

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*	Back alignment and structure

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*	Back alignment and structure

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}	Back alignment and structure

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}	Back alignment and structure

>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G	Back alignment and structure

>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A*	Back alignment and structure

>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}	Back alignment and structure

>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis}	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A*	Back alignment and structure

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*	Back alignment and structure

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*	Back alignment and structure

>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}	Back alignment and structure

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A	Back alignment and structure

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}	Back alignment and structure

>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}	Back alignment and structure

>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A*	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}	Back alignment and structure

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*	Back alignment and structure

>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20	Back alignment and structure

>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A*	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli}	Back alignment and structure

>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus}	Back alignment and structure

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*	Back alignment and structure

>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A	Back alignment and structure

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}	Back alignment and structure

>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4}	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}	Back alignment and structure

>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B*	Back alignment and structure

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}	Back alignment and structure

>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus}	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii}	Back alignment and structure

>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B*	Back alignment and structure

>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58}	Back alignment and structure

>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E*	Back alignment and structure

>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20	Back alignment and structure

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*	Back alignment and structure

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...	Back alignment and structure

>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E*	Back alignment and structure

>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1	Back alignment and structure

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A	Back alignment and structure

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*	Back alignment and structure

>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus}	Back alignment and structure

>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1	Back alignment and structure

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A	Back alignment and structure

>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A*	Back alignment and structure

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*	Back alignment and structure

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*	Back alignment and structure

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A	Back alignment and structure

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A	Back alignment and structure

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1	Back alignment and structure

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A	Back alignment and structure

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii}	Back alignment and structure

>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV}	Back alignment and structure

>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A	Back alignment and structure

>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni}	Back alignment and structure

>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A*	Back alignment and structure

>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii}	Back alignment and structure

>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus}	Back alignment and structure

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2	Back alignment and structure

>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP}	Back alignment and structure

>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A*	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B*	Back alignment and structure

>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A	Back alignment and structure

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2	Back alignment and structure

>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix}	Back alignment and structure

>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A*	Back alignment and structure

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus}	Back alignment and structure

>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans}	Back alignment and structure

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A*	Back alignment and structure

>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A*	Back alignment and structure

>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori}	Back alignment and structure

>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1}	Back alignment and structure

>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1	Back alignment and structure

>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti}	Back alignment and structure

>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A	Back alignment and structure

>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus}	Back alignment and structure

>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B	Back alignment and structure

>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A*	Back alignment and structure

>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus}	Back alignment and structure

>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus}	Back alignment and structure

>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25	Back alignment and structure

>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A	Back alignment and structure

>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A*	Back alignment and structure

>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A*	Back alignment and structure

>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*	Back alignment and structure

>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*	Back alignment and structure

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*	Back alignment and structure

>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax}	Back alignment and structure

>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens}	Back alignment and structure

>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A	Back alignment and structure

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*	Back alignment and structure

>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A*	Back alignment and structure

>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus}	Back alignment and structure

>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*	Back alignment and structure

>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1	Back alignment and structure

>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A*	Back alignment and structure

>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A*	Back alignment and structure

>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A	Back alignment and structure

>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae}	Back alignment and structure

>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A	Back alignment and structure

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11	Back alignment and structure

>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A*	Back alignment and structure

>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum}	Back alignment and structure

>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A*	Back alignment and structure

>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A*	Back alignment and structure

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A	Back alignment and structure

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10	Back alignment and structure

>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A*	Back alignment and structure

>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A*	Back alignment and structure

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*	Back alignment and structure

>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis}	Back alignment and structure

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus}	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2	Back alignment and structure

>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A*	Back alignment and structure

>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A*	Back alignment and structure

>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A*	Back alignment and structure

>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II}	Back alignment and structure

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25	Back alignment and structure

>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus}	Back alignment and structure

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10	Back alignment and structure

>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A*	Back alignment and structure

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6	Back alignment and structure

>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11	Back alignment and structure

>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus}	Back alignment and structure

>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii}	Back alignment and structure

>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A	Back alignment and structure

>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A*	Back alignment and structure

>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A*	Back alignment and structure

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*	Back alignment and structure

>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima}	Back alignment and structure

>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A*	Back alignment and structure

>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A	Back alignment and structure

>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli}	Back alignment and structure

>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A*	Back alignment and structure

>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A	Back alignment and structure

>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A*	Back alignment and structure

>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A	Back alignment and structure

>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X*	Back alignment and structure

>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B*	Back alignment and structure

>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A*	Back alignment and structure

>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A*	Back alignment and structure

>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A*	Back alignment and structure

>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A*	Back alignment and structure

>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F	Back alignment and structure

>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1	Back alignment and structure

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A	Back alignment and structure

>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A*	Back alignment and structure

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*	Back alignment and structure

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*	Back alignment and structure

>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}	Back alignment and structure

>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1	Back alignment and structure

>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A*	Back alignment and structure

>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A	Back alignment and structure

>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus}	Back alignment and structure

>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A*	Back alignment and structure

>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A*	Back alignment and structure

>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A	Back alignment and structure

>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A*	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A*	Back alignment and structure

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}	Back alignment and structure

>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli}	Back alignment and structure

>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A*	Back alignment and structure

>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A*	Back alignment and structure

>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum}	Back alignment and structure

>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A*	Back alignment and structure

>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1	Back alignment and structure

>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0	Back alignment and structure

>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A*	Back alignment and structure

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		651
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	99.87
d1uaaa1		306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	99.6
d1pjra1		318	DEXX box DNA helicase {Bacillus stearothermophilus	99.44
g1qhh.1		623	DEXX box DNA helicase {Bacillus stearothermophilus	99.16
d1gkub1		237	Helicase-like "domain" of reverse gyrase {Archaeon	98.87
d2fz4a1		206	DNA repair protein RAD25 {Archaeoglobus fulgidus [	98.75
d1rifa_		282	DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]	98.7
d1wp9a1		200	putative ATP-dependent RNA helicase PF2015 {Pyroco	98.66
d1hv8a1		208	Putative DEAD box RNA helicase {Archaeon Methanoco	98.59
d1yksa1		140	YFV helicase domain {Yellow fever virus [TaxId: 11	98.58
d2p6ra3		202	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	98.58
d1a1va1		136	HCV helicase domain {Human hepatitis C virus (HCV)	98.56
d2eyqa3		233	Transcription-repair coupling factor, TRCF {Escher	98.53
d1gm5a3		264	RecG helicase domain {Thermotoga maritima [TaxId:	98.53
d1qdea_		212	Initiation factor 4a {Baker's yeast (Saccharomyces	98.5
d2g9na1		218	Initiation factor 4a {Human (Homo sapiens) [TaxId:	98.38
d2bmfa2		305	Dengue virus helicase {Dengue virus type 2 [TaxId:	98.37
d1z63a1		230	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	98.34
d1t6na_		207	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	98.33
d1veca_		206	DEAD box RNA helicase rck/p54 {Human (Homo sapiens	98.22
d2j0sa1		222	Probable ATP-dependent RNA helicase DDX48 {Human (	98.12
d1s2ma1		206	Putative ATP-dependent RNA helicase DHH1 {Baker's	98.1
d1oywa2		206	RecQ helicase domain {Escherichia coli [TaxId: 562	97.97
d1wrba1		238	putative ATP-dependent RNA helicase VlgB {Flatworm	97.92
d1q0ua_		209	Probable DEAD box RNA helicase YqfR {Bacillus stea	97.9
d1w36b1		485	Exodeoxyribonuclease V beta chain (RecB), N-termin	97.73
d1z3ix2		298	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	97.64
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	97.16
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	97.11
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	96.95
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	96.88
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	96.87
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	96.84
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	96.69
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	96.66
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	96.64
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	96.63
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	96.58
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	96.54
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	96.49
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	96.32
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	96.28
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	96.27
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	96.08
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	95.91
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	95.72
d2qy9a2		211	GTPase domain of the signal recognition particle r	95.55
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	95.5
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	95.36
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	95.24
d1vmaa2		213	GTPase domain of the signal recognition particle r	95.22
d1okkd2		207	GTPase domain of the signal recognition particle r	95.22
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	95.19
d1j8yf2		211	GTPase domain of the signal sequence recognition p	95.17
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	95.09
d1ls1a2		207	GTPase domain of the signal sequence recognition p	95.07
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	94.97
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	94.85
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	94.81
d1g8pa_		333	ATPase subunit of magnesium chelatase, BchI {Rhodo	94.7
d1svma_		362	Papillomavirus large T antigen helicase domain {Si	94.62
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	94.55
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	94.51
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	94.47
d1ny5a2		247	Transcriptional activator sigm54 (NtrC1), C-termin	94.46
d1t5la1		413	Nucleotide excision repair enzyme UvrB {Bacillus c	94.38
d1zina1		182	Adenylate kinase {Bacillus stearothermophilus [Tax	94.29
d1zaka1		189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	94.25
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	94.23
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	94.2
d2cdna1		181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	94.0
d1ckea_		225	CMP kinase {Escherichia coli [TaxId: 562]}	93.98
d1teva_		194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	93.98
d1tf7a1		242	Circadian clock protein KaiC {Synechococcus sp. st	93.94
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	93.93
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	93.93
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	93.91
d1ukza_		196	Uridylate kinase {Baker's yeast (Saccharomyces cer	93.64
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	93.6
d1zp6a1		176	Hypothetical protein Atu3015 {Agrobacterium tumefa	93.53
d3adka_		194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	93.48
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	93.43
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	93.42
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	93.41
d1w44a_		321	NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	93.32
d1p9ra_		401	Extracellular secretion NTPase EpsE {Vibrio choler	93.27
d1s3ga1		182	Adenylate kinase {Bacillus globisporus [TaxId: 145	93.14
d1akya1		180	Adenylate kinase {Baker's yeast (Saccharomyces cer	93.06
d2b8ta1		139	Thymidine kinase, TK1, N-terminal domain {Ureaplas	93.02
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	92.95
d1tuea_		205	Replication protein E1 helicase domain {Human papi	92.93
d1ak2a1		190	Adenylate kinase {Cow (Bos taurus), mitochondrial	92.9
d1w36b1		485	Exodeoxyribonuclease V beta chain (RecB), N-termin	92.69
d2ak3a1		189	Adenylate kinase {Cow (Bos taurus), mitochondrial	92.6
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	92.49
d1e4va1		179	Adenylate kinase {Escherichia coli [TaxId: 562]}	92.48
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	92.29
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	91.97
d1n0wa_		242	DNA repair protein Rad51, catalytic domain {Human	91.97
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	91.97
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	91.9
d1xx6a1		141	Thymidine kinase, TK1, N-terminal domain {Clostrid	91.81
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	91.62
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	91.61
d1u94a1		263	RecA protein, ATPase-domain {Escherichia coli [Tax	91.39
d1szpa2		251	DNA repair protein Rad51, catalytic domain {Baker'	91.13
d1nlfa_		274	Hexameric replicative helicase repA {Escherichia c	90.94
d1pzna2		254	DNA repair protein Rad51, catalytic domain {Archae	90.87
d2qm8a1		323	Metallochaperone MeaB {Methylobacterium extorquens	90.72
d1c4oa1		408	Nucleotide excision repair enzyme UvrB {Thermus th	90.71
d1yj5a2		172	5' polynucleotide kinase-3' phosphatase, C-termina	90.63
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	90.44
d1q3ta_		223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	90.31
d1yrba1		244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	90.26
d1lvga_		190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	90.15
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	90.02
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	89.55
d1xbta1		133	Thymidine kinase, TK1, N-terminal domain {Human (H	89.5
d1gkya_		186	Guanylate kinase {Baker's yeast (Saccharomyces cer	89.41
d1v5wa_		258	Meiotic recombination protein DMC1/LIM15 homolog {	89.41
d2i1qa2		258	DNA repair protein Rad51, catalytic domain {Archae	88.8
d1qvra3		315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	88.2
d1xp8a1		268	RecA protein, ATPase-domain {Deinococcus radiodura	87.71
d1g41a_		443	HslU {Haemophilus influenzae [TaxId: 727]}	87.62
d1g6oa_		323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	87.56
d1mo6a1		269	RecA protein, ATPase-domain {Mycobacterium tubercu	87.38
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	87.17
d1e9ra_		433	Bacterial conjugative coupling protein TrwB {Esche	86.65
d1m7ga_		208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	86.29
d1nija1		222	Hypothetical protein YjiA, N-terminal domain {Esch	86.15
d1znwa1		182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	85.36
d4tmka_		210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	85.26
d1u0ja_		267	Rep 40 protein helicase domain {Adeno-associated v	84.47
g1f2t.1		292	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	84.15
d1xpua3		289	Transcription termination factor Rho, ATPase domai	84.12
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	83.48
d1nn5a_		209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	83.23
d1odfa_		286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	82.4
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	82.32
d1kgda_		178	Guanylate kinase-like domain of Cask {Human (Homo	82.28
g1ii8.1		369	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	81.51
g1xew.1		329	Smc head domain {Pyrococcus furiosus [TaxId: 2261]	81.45
d1gsia_		208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	81.19
d1w1wa_		427	Smc head domain {Baker's yeast (Saccharomyces cere	80.37

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V alpha chain (RecD)
species: Escherichia coli [TaxId: 562]

Probab=99.87  E-value=4.8e-23  Score=218.43  Aligned_cols=218  Identities=15%  Similarity=0.140  Sum_probs=127.3

Q ss_pred             CcchHHHHHHHHHHhhhhccccccCCCCCCCCCCCCCCC-CCCCCCCCCHHHHHHHHHHHhccCCCceEEeCcCCCCCCC
Q 006311          378 NRVCLKRAHEAVADASDSLFRNYLFPDCASRKSIPYPSL-CPYSNYKLDSDSNSAVHQILSFEGQSPYLLEGPLCNNFVL  456 (651)
Q Consensus       378 nr~~~rr~h~Al~~~~~~~~~~~LfP~~~~~~~~~~~~~-~~~~~~~LN~~Q~~AV~~iL~~~~~~p~LI~GPPGTGKT~  456 (651)
                      +|+.++|.|++-..+.+. +.+..-+........ ...+ ..+....++++|+.|+..+++   .+.++|+|||||||| 
T Consensus       104 ~~lyl~~~~~~E~~ia~~-l~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~Q~~A~~~al~---~~~~vI~G~pGTGKT-  177 (359)
T d1w36d1         104 DRLYLNRMWCNERTVARF-FNEVNHAIEVDEALL-AQTLDKLFPVSDEINWQKVAAAVALT---RRISVISGGPGTGKT-  177 (359)
T ss_dssp             SEEEEHHHHHHHHHHHHH-HTSCCBCCCCCHHHH-HHHHHTTCCCTTSCCHHHHHHHHHHT---BSEEEEECCTTSTHH-
T ss_pred             CEeehHHHHHHHHHHHHH-HHHhcCCCCCChHHH-HHHHHHhccCcccccHHHHHHHHHHc---CCeEEEEcCCCCCce-
Confidence            467778888876665532 222222211100000 0000 111124578899999999998   679999999999999 


Q ss_pred             CchhHHHHHHHHHHHHh--CCCCeEEEEccChhhHHHHHHHHHhhCCCcchhhhccccccccCCcHHHHHhhhccccccC
Q 006311          457 SKTGNVVREAVLQIRRR--SPKSRILICAPWNRTCDKLMECLMKDIPASEMFRANAAFREADGVSDEIFQVSLVERECFS  534 (651)
Q Consensus       457 s~~~~TlveaI~qll~~--~~~~rILVcApSNsAaD~l~~rL~~~l~~~~i~Rv~a~~R~~~~v~~~l~~y~~~~~~~f~  534 (651)
                          +|+++++..+.+.  .++.+|++|||||.||+.+.+++.+..     .++..........+.+..           
T Consensus       178 ----t~i~~~l~~l~~~~~~~~~~I~l~ApTgkAA~~L~e~~~~~~-----~~~~~~~~~~~~~~~~~~-----------  237 (359)
T d1w36d1         178 ----TTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKAL-----RQLPLTDEQKKRIPEDAS-----------  237 (359)
T ss_dssp             ----HHHHHHHHHHHHTCSSCCCCEEEEBSSHHHHHHHHHHHTHHH-----HHSSCCSCCCCSCSCCCB-----------
T ss_pred             ----ehHHHHHHHHHHHHhccCCeEEEecCcHHHHHHHHHHHHHHH-----hhcCchhhhhhhhhhhhh-----------
Confidence                9998887776653  356799999999999999999986511     111110000000000000           


Q ss_pred             CChhhhhcccceEeeehhcchhhhhcCCCCCCccEEEEecCCCCChHhHHHHHhccccCCCeEEEEeCCCCCCccccC--
Q 006311          535 CPPLEELRQYKVISSTFVSSFRLHNQGITAGHFSHIFLIDASSATEPETMIVLGNLANENTRVIVTGAPHNSPSRVRS--  612 (651)
Q Consensus       535 ~p~~~~L~~~rIVvtT~ssa~~l~~~~~~~~~F~~IiIDEAsQatEpE~LIpL~~la~~~~rvVLaGD~~QL~PvV~S--  612 (651)
                             .-++....+... ..+........+||+||||||||+.++.....+. ....++++||+||++|||||-.+  
T Consensus       238 -------t~~~ll~~~~~~-~~~~~~~~~~l~~d~lIIDEaSmv~~~l~~~ll~-~~~~~~~lILvGD~~QLppV~~G~v  308 (359)
T d1w36d1         238 -------TLHRLLGAQPGS-QRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLID-ALPDHARVIFLGDRDQLASVEAGAV  308 (359)
T ss_dssp             -------TTTSCC------------CTTSCCSCSEEEECSGGGCBHHHHHHHHH-TCCTTCEEEEEECTTSGGGTSTTBC
T ss_pred             -------HHHHHHhhhhcc-hHHHHhhhcccccceeeehhhhccCHHHHHHHHH-HhcCCCEEEEECChhhccCCCCCcH
Confidence                   001111111111 1111122344579999999999999988766666 44567899999999999998433  


Q ss_pred             --hHHH--hCCCCccHHHHHHc
Q 006311          613 --DIAR--KNGLKMSYFERLCL  630 (651)
Q Consensus       613 --~~a~--~~GL~~SLfERL~~  630 (651)
                        +...  +.++..+..++|..
T Consensus       309 l~dl~~~~~~~~~~~~~~~l~r  330 (359)
T d1w36d1         309 LGDICAYANAGFTAERARQLSR  330 (359)
T ss_dssp             HHHHGGGGTTCCCHHHHHHHHH
T ss_pred             HHHHHHHHhcCCCHHHHHHHHH
Confidence              3222  34566555555443

PyMOL of d1w36d1

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}	Back information, alignment and structure

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}	Back information, alignment and structure

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}	Back information, alignment and structure

>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}	Back information, alignment and structure

>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}	Back information, alignment and structure

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	Back information, alignment and structure

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}	Back information, alignment and structure

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]}	Back information, alignment and structure

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}	Back information, alignment and structure

>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}	Back information, alignment and structure

>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure