Citrus Sinensis ID: 006360

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------65
MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKIIASVGLDKKLYTYDPGSRRPSSCITYEAPFSSLAFIDDDWILTAGTSNGRVVFYDIRGKPQPLTVLRACSSSEAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPSVTTSSVSLSTAVSGSRPNSRSGPSAEASSLTVGGTGEETPQRSYLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEGAKKDHLPIDKKPSSMLFPSSSRRFPYAEDGSNEHSVFDWKSSSTSKQDDARSFALLGSTPSPSSKSEDSSITPPEAWGGEKLSDKFALLRQPLNMPSRYGMSTSSGLTSSSMYSGLQDVSLSQTSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLSSSFPSLSLGTKGILGSGNLDSSRPSSLTLTHREPRRTYAERISTTSGTSLSVGSPKTKKTGAETKEELLSNFLSRSDTSAVVEPGIPPAINGGMSQSLKSPQPDPPQGSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENHQLRQLL
cccccccEEEEEEccccEEEEEcccccccccccccccccEEEEEEccccccEEEEEEccccEEEEEcccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccccEEEEEEccccccEEEEEEcccccEEEEcccccccEEEEccccccEEEccccccEEEEcccccEEEEEcccccEEEEEccccccEEEccccccccccEEEcccccEEEEcccccccccccccEEEccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
cccccccEEEEEccccEEEEEEcccccEEEEccccccccEEEEEEcccccEEEEEEccccEEEEEEccccccEEEccccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccccEEEEEcccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEcccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcHHccccccccccccccccccccHcccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHc
mynckdehlASISLSGDLILHNLasgakaaelkdpneqVLRVLDYSRNSRHLLVtagddgtlhlwdttgrspkvswlkqhsaptagisfssdDKIIAsvgldkklytydpgsrrpsscityeapfsslafidddwiltagtsngrvvfydirgkpqpltvLRACSSSEAVSSLCWqrakpvfidettCKAETALlggavgdsilmpdplpsvttssvSLSTavsgsrpnsrsgpsaeassltvggtgeetpqrsylrpggplarlhaprssynfkddmevfsplvdvqpitpsldklwdghegakkdhlpidkkpssmlfpsssrrfpyaedgsnehsvfdwkssstskqddarsfallgstpspssksedssitppeawggeklsdkFALLrqplnmpsrygmstssgltsssmysglqdvslsqtsissltdsnlsrenmrtkdvtsyqetsslgfpehlsssfpslslgtkgilgsgnldssrpssltlthreprrtyaeristtsgtslsvgspktkktgAETKEELLSNFlsrsdtsavvepgippainggmsqslkspqpdppqgsnftLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENHQLRQLL
MYNCKDEHLASISLSGDLILHNLASGAkaaelkdpnEQVLRVLDYSRNSRHLLvtagddgtlhLWDTTGRSPKVSWLKQHSaptagisfssddKIIASVgldkklytydpgsrrpssCITYEAPFSSLAFIDDDWILTAGTSNGRVVFYDIRGKPQPLTVLRACSSSEAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPSVTTSSVSLSTAVsgsrpnsrsgpsaeassltvggtgeetpqrsylrpggpLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEgakkdhlpidkkpssmlfpSSSRRFPYAEDGSNEHSVFDWKSSSTSKQDDARSFALLgstpspssksedssITPPEAWGGEKLSDKFALLRQPLNMPSRYGMSTSSGLTSSSMYSGLQDVSLSQTSISSltdsnlsrenmrtKDVTSYQETSSLGFPEHLSSSFPSLSLGTKGILgsgnldssrpssltlthreprrtyaeristtsgtslsvgspktkktgaeTKEELLSnflsrsdtsaVVEPGIPPAINGGMSQSLKSPQPDPPQGSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLrkenhqlrqll
MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKIIASVGLDKKLYTYDPGSRRPSSCITYEAPFSSLAFIDDDWILTAGTSNGRVVFYDIRGKPQPLTVLRACSSSEAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPsvttssvslstavsgsrpnsrsgpsAEASSLTVGGTGEETPQRSYLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEGAKKDHLPIDKKPSSMLFPSSSRRFPYAEDGSNEHSVFDWKSSSTSKQDDARSFALLGstpspssksedssitppEAWGGEKLSDKFALLRQPLNMPSRygmstssgltsssmysglQDVSLSQTSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLSSSFPSLSLGTKGILGSGNLDSSRPSSLTLTHREPRRTYAERIsttsgtslsvgsPktkktgaetkeeLLSNFLSRSDTSAVVEPGIPPAINGGMSQSLKSPQPDPPQGSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENHQLRQLL
***********ISLSGDLILHNLASG***********QVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKIIASVGLDKKLYTYDPGSRRPSSCITYEAPFSSLAFIDDDWILTAGTSNGRVVFYDIRGKPQPLTVLRACSSSEAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSIL*************************************************************************MEVFSPLVDVQPITPSLDKLW*************************************************************************************************************************************************************************************************************************************************************************************LQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHM*************************************
MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKIIASVGLDKKLYTYDPGSRRPSSCITYEAPFSSLAFIDDDWILTAGTSNGRVVFYDIRGKPQPLTVLRACSSSEAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPSVTTSSVSLSTAVSGSRPNSRSGPSAEASSLTVGGTGEETPQRSYLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEGAKKDH*PIDKKPSSMLFPS************NEHSVFDW*********************************PPEAWGGEKLSDKFALLRQPLNMPSRYGM**SSGLT**SMYSGLQD***********************************************************************************************************************************************************QLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVM****************************
MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKIIASVGLDKKLYTYDPGSRRPSSCITYEAPFSSLAFIDDDWILTAGTSNGRVVFYDIRGKPQPLTVLRA*********LCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPS*******************************************YLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEGAKKDHLPIDKKPSSMLFPSSSRRFPY***********************ARSFALL*****************PEAWGGEKLSDKFALLRQPLNMPSRY**************SGLQDVSLSQTSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLSSSFPSLSLGTKGILGSGNLDSSRPSSLTLTHREPRRTYAERI*******************AETKEELLSNFLSRSDTSAVVEPGIPPAINGGMSQ***********GSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENHQLRQLL
MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKIIASVGLDKKLYTYDPGSRRPSSCITYEAPFSSLAFIDDDWILTAGTSNGRVVFYDIRGKPQPLTVLRACSSSEAVSSLCWQRA************************************************RPN********************************************FKDDMEVFSPLVDV**ITP*L********G*KK************************************************************************************************************************************************************************************************************************************************************************GSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENHQLR*LL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKIIASVGLDKKLYTYDPGSRRPSSCITYEAPFSSLAFIDDDWILTAGTSNGRVVFYDIRGKPQPLTVLRACSSSEAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPSVTTSSVSLSTAVSGSRPNSRSGPSAEASSLTVGGTGEETPQRSYLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEGAKKDHLPIDKKPSSMLFPSSSRRFPYAEDGSNEHSVFDWKSSSTSKQDDARSFALLGSTPSPSSKSEDSSITPPEAWGGEKLSDKFALLRQPLNMPSRYGMSTSSGLTSSSMYSGLQDVSLSQTSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLSSSFPSLSLGTKGILGSGNLDSSRPSSLTLTHREPRRTYAERISTTSGTSLSVGSPKTKKTGAETKEELLSNFLSRSDTSAVVEPGIPPAINGGMSQSLKSPQPDPPQGSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query648 2.2.26 [Sep-21-2011]
Q3B7M6659 Protein NEDD1 OS=Bos taur yes no 0.266 0.262 0.323 2e-21
Q8NHV4660 Protein NEDD1 OS=Homo sap no no 0.324 0.318 0.280 8e-21
P33215660 Protein NEDD1 OS=Mus musc yes no 0.266 0.262 0.301 2e-19
Q54S59299 WD repeat-containing prot yes no 0.219 0.474 0.313 3e-08
Q555631693 Uncharacterized WD repeat N/A no 0.192 0.073 0.297 3e-05
B6GZA1673 Probable E3 ubiquitin lig yes no 0.222 0.213 0.298 6e-05
P29829346 Guanine nucleotide-bindin no no 0.163 0.306 0.293 0.0002
P90917412 Probable histone-binding yes no 0.172 0.271 0.277 0.0003
Q9VAT2621 DDB1- and CUL4-associated no no 0.095 0.099 0.370 0.0003
Q4X0M4 1263 Protein transport protein no no 0.195 0.100 0.301 0.0005
>sp|Q3B7M6|NEDD1_BOVIN Protein NEDD1 OS=Bos taurus GN=NEDD1 PE=2 SV=1 Back     alignment and function desciption
 Score =  105 bits (261), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 98/176 (55%), Gaps = 3/176 (1%)

Query: 2   YNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGT 61
           YN  D ++AS SLSG++ILH++ +   +      + Q +R L YS   + LL +  D+G 
Sbjct: 127 YNWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSIRHLKYSLFKKSLLGSVSDNGI 186

Query: 62  LHLWDTTGRSPKVSWLKQHSAPTAGISFS-SDDKIIASVGLDKKLYTYDPGSRRPSSCIT 120
           + LWD   +SP  ++   H AP +GI FS  ++ +  +VGLDK++  YD  S++    + 
Sbjct: 187 VTLWDVNSQSPYHNFDSTHKAPASGICFSPVNELLFVTVGLDKRIILYDTSSKKLVKTLV 246

Query: 121 YEAPFSSLAFIDDDWILTAGTSNGRVVFYDIRGKPQPLTVLRACSSSEAVSSLCWQ 176
            +AP +++ F+ D   L  G+S G++  YD+R    P+  + A  +S  V  + +Q
Sbjct: 247 ADAPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPIKTISAHKTS--VQCIAFQ 300
Required for mitosis progression. Promotes the nucleation of microtubules from the spindle.
Bos taurus (taxid: 9913)
>sp|Q8NHV4|NEDD1_HUMAN Protein NEDD1 OS=Homo sapiens GN=NEDD1 PE=1 SV=1 Back     alignment and function description
>sp|P33215|NEDD1_MOUSE Protein NEDD1 OS=Mus musculus GN=Nedd1 PE=2 SV=2 Back     alignment and function description
>sp|Q54S59|WDR61_DICDI WD repeat-containing protein 61 homolog OS=Dictyostelium discoideum GN=wdr61 PE=4 SV=1 Back     alignment and function description
>sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=4 SV=1 Back     alignment and function description
>sp|B6GZA1|SCONB_PENCW Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 Back     alignment and function description
>sp|P29829|GBB2_DROME Guanine nucleotide-binding protein subunit beta-2 OS=Drosophila melanogaster GN=Gbeta76C PE=1 SV=3 Back     alignment and function description
>sp|P90917|RBA1_CAEEL Probable histone-binding protein rba-1 OS=Caenorhabditis elegans GN=rba-1 PE=3 SV=1 Back     alignment and function description
>sp|Q9VAT2|DCA10_DROME DDB1- and CUL4-associated factor 10 homolog OS=Drosophila melanogaster GN=CG1523 PE=1 SV=1 Back     alignment and function description
>sp|Q4X0M4|SEC31_ASPFU Protein transport protein sec31 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec31 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query648
359486608 805 PREDICTED: uncharacterized protein LOC10 0.992 0.798 0.744 0.0
296086168 779 unnamed protein product [Vitis vinifera] 0.970 0.807 0.742 0.0
224101047 785 predicted protein [Populus trichocarpa] 0.979 0.808 0.724 0.0
449441356 799 PREDICTED: protein NEDD1-like [Cucumis s 0.984 0.798 0.721 0.0
356499133 795 PREDICTED: protein NEDD1-like [Glycine m 0.975 0.794 0.690 0.0
224109450 777 predicted protein [Populus trichocarpa] 0.961 0.801 0.712 0.0
356553817 846 PREDICTED: protein NEDD1-like [Glycine m 0.972 0.744 0.683 0.0
225459552 785 PREDICTED: protein NEDD1-like [Vitis vin 0.975 0.805 0.672 0.0
255566510 799 protein with unknown function [Ricinus c 0.984 0.798 0.710 0.0
357492447 819 Protein NEDD1 [Medicago truncatula] gi|3 0.984 0.778 0.645 0.0
>gi|359486608|ref|XP_002277667.2| PREDICTED: uncharacterized protein LOC100246247 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/670 (74%), Positives = 564/670 (84%), Gaps = 27/670 (4%)

Query: 1   MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDG 60
           MYNCKDEHLASISL+GDLILHNLASGA+AAELKDPNEQV RVLDYSR SRHLLVTAGDDG
Sbjct: 141 MYNCKDEHLASISLNGDLILHNLASGARAAELKDPNEQVSRVLDYSRISRHLLVTAGDDG 200

Query: 61  TLHLWDTTGRSPKVSWLKQHSAPTAGISFS-SDDKIIASVGLDKKLYTYDPGSRRPSSCI 119
           ++H+WDTTGRSPKVSWLKQHSAPTAG+SFS S+DKIIA+VGLDKKLYT+D GSRRPSSCI
Sbjct: 201 SIHMWDTTGRSPKVSWLKQHSAPTAGVSFSPSNDKIIATVGLDKKLYTFDTGSRRPSSCI 260

Query: 120 TYEAPFSSLAFIDDDWILTAGTSNGRVVFYDIRGKPQPLTVLRACSSSEAVSSLCWQRAK 179
            YEAPFSSLAF DD  IL AGTSNGRVVFYD+RGKPQP TVLRA SSSEAV+SLCWQR+K
Sbjct: 261 PYEAPFSSLAFRDDGLILAAGTSNGRVVFYDVRGKPQPFTVLRAYSSSEAVTSLCWQRSK 320

Query: 180 PVFIDETTCKAETALLGGAVGDSILMPDPLPSVTTSSVSLSTAVSGSRPNSRSGPSAEAS 239
           PV ++E+ C  ETALLGGAV DSILMPDPLPSVT+SS+SLSTA+  SR   RSGPS E S
Sbjct: 321 PVIVNESNCTPETALLGGAVEDSILMPDPLPSVTSSSLSLSTAIPASRNPGRSGPSTETS 380

Query: 240 SLTVG-----------GTGEETPQRSYLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQ 288
           SLT              T EETPQ+++LRPGG LARLHAPRS+YNFKDDMEVFSPLVD+Q
Sbjct: 381 SLTAASGGSVSSSLYLSTEEETPQKNHLRPGGTLARLHAPRSNYNFKDDMEVFSPLVDIQ 440

Query: 289 PITPSLDKLWDGHEGAKKDHLPIDKKPSSMLFPSSSRRFPYAEDGSNEHSVFDWKSSSTS 348
           PITPSLDKLWD HE AKKDHLP+DKKPSS+LFPSSSRRFP+ +DG+ +H +FDWKSSSTS
Sbjct: 441 PITPSLDKLWDNHEAAKKDHLPVDKKPSSLLFPSSSRRFPFVDDGAIDHPIFDWKSSSTS 500

Query: 349 KQDDAR-SFALLGSTPSPSSKSEDSSITPPEAWGGEKLSDKFALLRQPLNMPSRYGMSTS 407
           +QDD R S +LLGSTP+PSSKS + SITPPEAWGGE+LSDKFA  RQ  N+PSR+GM T+
Sbjct: 501 RQDDTRASLSLLGSTPAPSSKSGEDSITPPEAWGGERLSDKFAHHRQSANLPSRFGMLTT 560

Query: 408 SGLTSSSMYSGLQD--VSLSQTSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLSSS 465
           SGLTS SM SGLQD  VS SQTS+SSL++SNL   N+R KDV+S QET SLGF EH+  S
Sbjct: 561 SGLTSGSMLSGLQDLSVSTSQTSMSSLSNSNLGYANLRPKDVSSSQET-SLGFSEHVPFS 619

Query: 466 FPSLSLGTKGILGSGNLDSSRPSSLTLTHREPRR--TYAERISTTS----GTSLSVGSPK 519
             S+SLGTKG+ G  NL+   P+SL L    PRR  TYAERI TTS    G SLS+GSPK
Sbjct: 620 SISMSLGTKGVTGQTNLELPGPTSLNL----PRRFSTYAERIGTTSSFSDGISLSMGSPK 675

Query: 520 TKKTGAETKEELLSNFLSRSDTSAVVEPGIPPAINGGMSQSLKSP-QPDPPQGSNFTLQL 578
           TKK+GAET+EELL + LSR+D S  +EPGI P+INGG SQ  K+P Q D  QG++FTLQL
Sbjct: 676 TKKSGAETREELLHSLLSRTDISTAMEPGILPSINGGTSQPQKAPIQTDSQQGNSFTLQL 735

Query: 579 FQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLR 638
           FQRTL+ETL SFQKSIHEDM+NLHIEILRQFH+QET MS+VMSSIL+NQ ELMKE++SLR
Sbjct: 736 FQRTLDETLGSFQKSIHEDMKNLHIEILRQFHIQETDMSSVMSSILKNQVELMKEVQSLR 795

Query: 639 KENHQLRQLL 648
           KEN QLRQLL
Sbjct: 796 KENQQLRQLL 805

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296086168|emb|CBI31609.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224101047|ref|XP_002312120.1| predicted protein [Populus trichocarpa] gi|222851940|gb|EEE89487.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449441356|ref|XP_004138448.1| PREDICTED: protein NEDD1-like [Cucumis sativus] gi|449495290|ref|XP_004159790.1| PREDICTED: protein NEDD1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356499133|ref|XP_003518397.1| PREDICTED: protein NEDD1-like [Glycine max] Back     alignment and taxonomy information
>gi|224109450|ref|XP_002315198.1| predicted protein [Populus trichocarpa] gi|222864238|gb|EEF01369.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356553817|ref|XP_003545248.1| PREDICTED: protein NEDD1-like [Glycine max] Back     alignment and taxonomy information
>gi|225459552|ref|XP_002284487.1| PREDICTED: protein NEDD1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255566510|ref|XP_002524240.1| protein with unknown function [Ricinus communis] gi|223536517|gb|EEF38164.1| protein with unknown function [Ricinus communis] Back     alignment and taxonomy information
>gi|357492447|ref|XP_003616512.1| Protein NEDD1 [Medicago truncatula] gi|355517847|gb|AES99470.1| Protein NEDD1 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query648
TAIR|locus:2153629782 NEDD1 "AT5G05970" [Arabidopsis 0.961 0.796 0.527 1.7e-162
UNIPROTKB|Q3B7M6659 NEDD1 "Protein NEDD1" [Bos tau 0.256 0.251 0.329 2.3e-31
UNIPROTKB|E2R5C6734 NEDD1 "Uncharacterized protein 0.256 0.226 0.317 2.2e-30
UNIPROTKB|Q8NHV4660 NEDD1 "Protein NEDD1" [Homo sa 0.256 0.251 0.317 5e-30
UNIPROTKB|G3V3F1667 NEDD1 "Neural cell expressed, 0.256 0.248 0.317 5.2e-30
RGD|1307750659 Nedd1 "neural precursor cell e 0.256 0.251 0.305 2.4e-29
MGI|MGI:97293660 Nedd1 "neural precursor cell e 0.256 0.251 0.305 3.9e-29
UNIPROTKB|F1P0W9671 NEDD1 "Uncharacterized protein 0.246 0.238 0.333 8.2e-29
ZFIN|ZDB-GENE-040426-2906677 nedd1 "neural precursor cell e 0.254 0.243 0.327 1.8e-22
UNIPROTKB|F1SQR9390 NEDD1 "Uncharacterized protein 0.256 0.425 0.323 1.5e-19
TAIR|locus:2153629 NEDD1 "AT5G05970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1582 (562.0 bits), Expect = 1.7e-162, P = 1.7e-162
 Identities = 351/666 (52%), Positives = 423/666 (63%)

Query:     1 MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDG 60
             MYNCKDEHLAS+S+ GDLI+HNLASGA+A ELKDPN QVLR+LDYSR+SRHLLVTAGDDG
Sbjct:   142 MYNCKDEHLASVSVGGDLIVHNLASGARATELKDPNGQVLRLLDYSRSSRHLLVTAGDDG 201

Query:    61 TLHLWDTTGRSPKVSWLKQHSAPTAGISFS-SDDKIIASVGLDKKLYTYDPGSRRPSSCI 119
             T+HLWDTTGRSPK+SWLKQHSAPTAG+ FS S++KIIASVG+DKKLYTYD GSRR SSCI
Sbjct:   202 TVHLWDTTGRSPKMSWLKQHSAPTAGVCFSPSNEKIIASVGMDKKLYTYDSGSRRSSSCI 261

Query:   120 TYEAPFSSLAFIDDDWILTAGTSNGRVVFYDIRGKPQPLTVLRACSSSEAVSSLCWQRAK 179
              YEAPFSSLAF D+ +IL AGTSNGRVVFYDIRGKPQP+TVL A S+SE V+SL WQ +K
Sbjct:   262 AYEAPFSSLAFGDNGYILVAGTSNGRVVFYDIRGKPQPVTVLHAFSNSEDVTSLSWQTSK 321

Query:   180 PVFIDETTCKAETALLGGAVGDSILMPDPLPXXXXXXXXXXXXXXXXXXXXXXXXXAEAS 239
             PV ++E    +E ALLG  V DS+++PDPLP                           AS
Sbjct:   322 PVIVNEKNYTSEMALLGSTVEDSVVIPDPLPSTTPSASQSAMAPGSRGVSAST---VNAS 378

Query:   240 SLTVGGTGEETPQRSYLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWD 299
             S+      E+TP R++L P GPL RLHA R++ ++ DDM VFSP++DV     S++K W 
Sbjct:   379 SV------EQTPNRNHLWPSGPLGRLHALRANDSYNDDMGVFSPIIDVS----SVEK-WA 427

Query:   300 GHEGAK-KDHLPIDKKPSSMLFPSSSRRFPYAEDGSNEHSVFDWKSSSTSKQDDARS-FA 357
               EG   KDHL +D KPSS+LFPSSS+ + + ++GS EH +FDWK SSTSKQDD R+ F+
Sbjct:   428 DSEGYNNKDHLVVDNKPSSLLFPSSSKGYSFGDNGSKEHPIFDWKPSSTSKQDDPRAAFS 487

Query:   358 LLGXXXXXXXXXXXXXXXXX-EAWGGEKLSDKFALLRQP--------LNMPSRXXXXXXX 408
               G                  EAWGG+K S+KF  L           L+ PSR       
Sbjct:   488 SFGSITPTASSKSEDSALTPPEAWGGDKFSEKFNQLANEKFSDKFSHLHAPSRLAVSSTG 547

Query:   409 XXXXXXXXXXXQDVSLSQTSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLSSSFPS 468
                        +D  LS    +    +N S E  R +D +S  ETSS        ++ PS
Sbjct:   548 ASTSGSMFSSSRDFPLSHGQTNF---ANASLEFPRIRDFSSTFETSST----QTDNNLPS 600

Query:   469 LSLGTKGILGSGNLDSSRPSSLTLTHREPRRTYAERIXXXXXXXXXXX-----XPXXXXX 523
               L TKGI   GN+DS R S    T R    TYAERI                 P     
Sbjct:   601 SPLFTKGITAPGNIDSLRLSP-NFTRRFS--TYAERISTTSSFSDGASLSLGGSPKIKKT 657

Query:   524 XXXXXXXLLSNFLSRSDTSAVVEPGIPPAIN-GGMSQSLKSPQPDPPQGSNFTLQLFQRT 582
                    +L++ L+R +T    E G  P +N GG+ QS ++ Q      SNFTLQLFQRT
Sbjct:   658 GSETREEVLNHLLARPETVVATEAGAMPLMNQGGLKQS-QTDQQQVMGSSNFTLQLFQRT 716

Query:   583 LEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENH 642
             LE TLDSFQ SIH+D+RNLHIEILRQFHM E +MS V+SSILENQAE MKE+K LRKEN 
Sbjct:   717 LEGTLDSFQNSIHDDVRNLHIEILRQFHMHEMEMSKVLSSILENQAEQMKELKLLRKENQ 776

Query:   643 QLRQLL 648
             +LRQ L
Sbjct:   777 ELRQRL 782
GO:0000166 "nucleotide binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0000919 "cell plate assembly" evidence=IMP
GO:0005828 "kinetochore microtubule" evidence=IDA
GO:0009553 "embryo sac development" evidence=IMP
GO:0009555 "pollen development" evidence=IMP
GO:0032467 "positive regulation of cytokinesis" evidence=IMP
GO:0060236 "regulation of mitotic spindle organization" evidence=IMP
GO:2000694 "regulation of phragmoplast microtubule organization" evidence=IMP
UNIPROTKB|Q3B7M6 NEDD1 "Protein NEDD1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5C6 NEDD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NHV4 NEDD1 "Protein NEDD1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V3F1 NEDD1 "Neural cell expressed, developmentally down-regulated 1, isoform CRA_c" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1307750 Nedd1 "neural precursor cell expressed, developmentally down-regulated 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:97293 Nedd1 "neural precursor cell expressed, developmentally down-regulated gene 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0W9 NEDD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2906 nedd1 "neural precursor cell expressed, developmentally down-regulated 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQR9 NEDD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_LG_VIII000230
hypothetical protein (785 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query648
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-14
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-13
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-12
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 8e-09
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 9e-09
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 9e-07
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score = 73.9 bits (182), Expect = 2e-14
 Identities = 35/136 (25%), Positives = 66/136 (48%), Gaps = 6/136 (4%)

Query: 41  RVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKIIASVG 100
             + +S + + LL T   DGT+ +WD        + LK H+ P   ++ S+D   +AS  
Sbjct: 13  TCVAFSPDGK-LLATGSGDGTIKVWDLETGELLRT-LKGHTGPVRDVAASADGTYLASGS 70

Query: 101 LDKKLYTYDPGSRRPSSCIT-YEAPFSSLAFIDDDWILTAGTSNGRVVFYDIRGKPQPLT 159
            DK +  +D  +      +T + +  SS+AF  D  IL++ + +  +  +D+    + LT
Sbjct: 71  SDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVE-TGKCLT 129

Query: 160 VLRACSSSEAVSSLCW 175
            LR  +    V+S+ +
Sbjct: 130 TLRGHTDW--VNSVAF 143

Length = 289
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 648
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.95
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.95
KOG0263707 consensus Transcription initiation factor TFIID, s 99.95
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.94
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.94
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.94
KOG0286343 consensus G-protein beta subunit [General function 99.92
KOG0266456 consensus WD40 repeat-containing protein [General 99.92
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.91
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.91
KOG0263707 consensus Transcription initiation factor TFIID, s 99.91
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.91
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.9
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.9
KOG0266456 consensus WD40 repeat-containing protein [General 99.9
KOG0315311 consensus G-protein beta subunit-like protein (con 99.9
KOG0286343 consensus G-protein beta subunit [General function 99.9
KOG0315311 consensus G-protein beta subunit-like protein (con 99.89
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.89
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.89
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.89
PTZ00421493 coronin; Provisional 99.89
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.89
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.89
KOG0295406 consensus WD40 repeat-containing protein [Function 99.89
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.89
KOG0645312 consensus WD40 repeat protein [General function pr 99.89
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.89
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.88
KOG0283712 consensus WD40 repeat-containing protein [Function 99.88
PLN00181793 protein SPA1-RELATED; Provisional 99.87
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.87
PTZ00420568 coronin; Provisional 99.87
KOG0295406 consensus WD40 repeat-containing protein [Function 99.87
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.87
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.87
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.87
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.86
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.86
PTZ00420568 coronin; Provisional 99.86
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.86
PTZ00421493 coronin; Provisional 99.86
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.85
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.85
KOG0772641 consensus Uncharacterized conserved protein, conta 99.85
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.84
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.84
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.84
PLN00181793 protein SPA1-RELATED; Provisional 99.84
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.84
KOG0645312 consensus WD40 repeat protein [General function pr 99.83
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.83
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.83
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.83
KOG0293519 consensus WD40 repeat-containing protein [Function 99.83
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.83
KOG0293519 consensus WD40 repeat-containing protein [Function 99.83
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.82
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.82
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.82
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.82
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.82
KOG0289506 consensus mRNA splicing factor [General function p 99.82
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.82
KOG0772641 consensus Uncharacterized conserved protein, conta 99.82
KOG0296399 consensus Angio-associated migratory cell protein 99.81
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.81
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.81
KOG0294362 consensus WD40 repeat-containing protein [Function 99.81
KOG0646476 consensus WD40 repeat protein [General function pr 99.81
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.81
KOG0643327 consensus Translation initiation factor 3, subunit 99.8
KOG0302440 consensus Ribosome Assembly protein [General funct 99.8
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.8
KOG0300481 consensus WD40 repeat-containing protein [Function 99.8
KOG0269839 consensus WD40 repeat-containing protein [Function 99.79
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.79
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.79
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.78
KOG0296399 consensus Angio-associated migratory cell protein 99.78
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.78
KOG0641350 consensus WD40 repeat protein [General function pr 99.78
KOG0283712 consensus WD40 repeat-containing protein [Function 99.78
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.78
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.77
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.77
KOG0267 825 consensus Microtubule severing protein katanin p80 99.77
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.77
KOG0639705 consensus Transducin-like enhancer of split protei 99.77
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.77
KOG0270463 consensus WD40 repeat-containing protein [Function 99.76
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.75
KOG0289506 consensus mRNA splicing factor [General function p 99.75
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.75
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.75
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.74
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.74
KOG4283397 consensus Transcription-coupled repair protein CSA 99.74
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.74
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.74
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.74
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.73
KOG0302440 consensus Ribosome Assembly protein [General funct 99.73
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.73
KOG0267 825 consensus Microtubule severing protein katanin p80 99.73
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.73
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.71
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.71
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.71
KOG0641350 consensus WD40 repeat protein [General function pr 99.7
KOG1274 933 consensus WD40 repeat protein [General function pr 99.7
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.69
KOG0300481 consensus WD40 repeat-containing protein [Function 99.68
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.68
KOG2096420 consensus WD40 repeat protein [General function pr 99.68
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.67
KOG0643327 consensus Translation initiation factor 3, subunit 99.67
KOG0270463 consensus WD40 repeat-containing protein [Function 99.67
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.66
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.66
KOG0303472 consensus Actin-binding protein Coronin, contains 99.66
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.66
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.65
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.64
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.64
KOG2096420 consensus WD40 repeat protein [General function pr 99.63
KOG0301745 consensus Phospholipase A2-activating protein (con 99.63
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.63
KOG0301745 consensus Phospholipase A2-activating protein (con 99.62
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.62
KOG0303472 consensus Actin-binding protein Coronin, contains 99.62
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.61
KOG1274 933 consensus WD40 repeat protein [General function pr 99.61
KOG1273405 consensus WD40 repeat protein [General function pr 99.61
KOG1539910 consensus WD repeat protein [General function pred 99.6
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.6
KOG2055514 consensus WD40 repeat protein [General function pr 99.6
KOG1188376 consensus WD40 repeat protein [General function pr 99.6
KOG2048691 consensus WD40 repeat protein [General function pr 99.59
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.59
KOG2055514 consensus WD40 repeat protein [General function pr 99.59
KOG0771398 consensus Prolactin regulatory element-binding pro 99.58
KOG0639705 consensus Transducin-like enhancer of split protei 99.58
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.58
KOG4328498 consensus WD40 protein [Function unknown] 99.58
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.57
KOG0294362 consensus WD40 repeat-containing protein [Function 99.57
KOG4283397 consensus Transcription-coupled repair protein CSA 99.56
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.55
KOG0646476 consensus WD40 repeat protein [General function pr 99.54
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.54
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.54
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.52
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.52
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.52
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.51
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.51
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.5
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.49
COG2319466 FOG: WD40 repeat [General function prediction only 99.49
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.49
KOG0649325 consensus WD40 repeat protein [General function pr 99.48
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.48
KOG2048691 consensus WD40 repeat protein [General function pr 99.47
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.47
KOG2106626 consensus Uncharacterized conserved protein, conta 99.46
PRK04922433 tolB translocation protein TolB; Provisional 99.46
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.46
PRK02889427 tolB translocation protein TolB; Provisional 99.45
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.44
PRK03629429 tolB translocation protein TolB; Provisional 99.44
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.44
COG2319466 FOG: WD40 repeat [General function prediction only 99.43
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.43
PRK05137435 tolB translocation protein TolB; Provisional 99.42
KOG4328498 consensus WD40 protein [Function unknown] 99.42
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.41
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.41
KOG2139445 consensus WD40 repeat protein [General function pr 99.41
KOG1310758 consensus WD40 repeat protein [General function pr 99.41
PRK01742429 tolB translocation protein TolB; Provisional 99.41
KOG1539 910 consensus WD repeat protein [General function pred 99.4
PRK11028330 6-phosphogluconolactonase; Provisional 99.38
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.38
KOG1273405 consensus WD40 repeat protein [General function pr 99.38
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.38
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.37
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.36
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.36
KOG2106626 consensus Uncharacterized conserved protein, conta 99.36
KOG1188376 consensus WD40 repeat protein [General function pr 99.36
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.36
PRK11028330 6-phosphogluconolactonase; Provisional 99.35
KOG4227609 consensus WD40 repeat protein [General function pr 99.34
KOG2110391 consensus Uncharacterized conserved protein, conta 99.34
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.32
KOG4227609 consensus WD40 repeat protein [General function pr 99.32
KOG2110391 consensus Uncharacterized conserved protein, conta 99.31
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.31
PRK00178430 tolB translocation protein TolB; Provisional 99.3
PRK04792448 tolB translocation protein TolB; Provisional 99.3
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.29
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.29
KOG0649325 consensus WD40 repeat protein [General function pr 99.29
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.28
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.26
PRK01742429 tolB translocation protein TolB; Provisional 99.24
KOG1310758 consensus WD40 repeat protein [General function pr 99.23
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.22
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.22
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.2
PRK05137435 tolB translocation protein TolB; Provisional 99.2
KOG2111346 consensus Uncharacterized conserved protein, conta 99.19
PRK03629429 tolB translocation protein TolB; Provisional 99.19
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.19
KOG2321703 consensus WD40 repeat protein [General function pr 99.18
KOG4547541 consensus WD40 repeat-containing protein [General 99.15
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.13
PRK02889427 tolB translocation protein TolB; Provisional 99.12
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.12
PRK04922433 tolB translocation protein TolB; Provisional 99.11
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.11
KOG2111346 consensus Uncharacterized conserved protein, conta 99.11
KOG1963792 consensus WD40 repeat protein [General function pr 99.1
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.09
PRK01029428 tolB translocation protein TolB; Provisional 99.08
PRK04043419 tolB translocation protein TolB; Provisional 99.08
KOG0771398 consensus Prolactin regulatory element-binding pro 99.08
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.07
PRK01029428 tolB translocation protein TolB; Provisional 99.06
KOG1963792 consensus WD40 repeat protein [General function pr 99.05
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.04
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.02
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.0
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.0
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.99
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.99
KOG1334559 consensus WD40 repeat protein [General function pr 98.98
KOG2321703 consensus WD40 repeat protein [General function pr 98.97
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.97
KOG2139445 consensus WD40 repeat protein [General function pr 98.95
PRK00178430 tolB translocation protein TolB; Provisional 98.95
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 98.94
PRK04792448 tolB translocation protein TolB; Provisional 98.91
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.9
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.89
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.87
KOG12401431 consensus Protein kinase containing WD40 repeats [ 98.85
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.8
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.79
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.74
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.71
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.71
COG4946668 Uncharacterized protein related to the periplasmic 98.7
KOG2315566 consensus Predicted translation initiation factor 98.69
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.69
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.68
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.68
KOG4547541 consensus WD40 repeat-containing protein [General 98.67
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.66
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.57
KOG2315566 consensus Predicted translation initiation factor 98.53
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.53
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.5
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.48
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.48
COG4946668 Uncharacterized protein related to the periplasmic 98.46
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.45
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.45
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.44
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.44
KOG1409404 consensus Uncharacterized conserved protein, conta 98.43
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.42
PRK04043419 tolB translocation protein TolB; Provisional 98.39
KOG1334559 consensus WD40 repeat protein [General function pr 98.36
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.36
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.35
KOG1409404 consensus Uncharacterized conserved protein, conta 98.33
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.32
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.3
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.3
KOG2695425 consensus WD40 repeat protein [General function pr 98.23
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.22
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.21
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.19
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.18
KOG2695425 consensus WD40 repeat protein [General function pr 98.18
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.17
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.16
KOG2314698 consensus Translation initiation factor 3, subunit 98.16
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.15
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.13
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.11
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.11
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.09
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.08
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.03
KOG1008783 consensus Uncharacterized conserved protein, conta 98.02
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.02
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.99
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.94
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.94
KOG2314698 consensus Translation initiation factor 3, subunit 97.91
KOG1912 1062 consensus WD40 repeat protein [General function pr 97.9
PRK02888635 nitrous-oxide reductase; Validated 97.89
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.89
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.89
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.88
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.85
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.83
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.82
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.8
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.78
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.78
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.77
KOG1912 1062 consensus WD40 repeat protein [General function pr 97.76
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.75
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.73
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.66
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.6
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.57
COG3391381 Uncharacterized conserved protein [Function unknow 97.56
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.55
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.53
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.53
PRK02888635 nitrous-oxide reductase; Validated 97.51
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.45
KOG3621726 consensus WD40 repeat-containing protein [General 97.38
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.34
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.28
KOG3621726 consensus WD40 repeat-containing protein [General 97.25
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.15
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.12
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.1
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 97.09
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.07
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.07
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.07
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 96.99
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.99
COG3391381 Uncharacterized conserved protein [Function unknow 96.97
PRK13616591 lipoprotein LpqB; Provisional 96.97
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.96
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.92
PRK13169110 DNA replication intiation control protein YabA; Re 96.89
KOG1008 783 consensus Uncharacterized conserved protein, conta 96.88
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 96.8
PRK13616591 lipoprotein LpqB; Provisional 96.78
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.71
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.69
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.62
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.62
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.61
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.58
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.48
KOG2395644 consensus Protein involved in vacuole import and d 96.45
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.42
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.36
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.35
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.33
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 96.32
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 96.25
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 96.25
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.24
COG4467114 Regulator of replication initiation timing [Replic 96.22
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.22
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 96.1
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.06
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.05
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 95.99
KOG2395644 consensus Protein involved in vacuole import and d 95.85
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 95.81
PHA02713557 hypothetical protein; Provisional 95.72
KOG2444238 consensus WD40 repeat protein [General function pr 95.71
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.67
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 95.58
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.52
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.48
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.44
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 95.4
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.27
PF05769181 DUF837: Protein of unknown function (DUF837); Inte 95.23
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 95.21
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 95.2
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.2
KOG2444238 consensus WD40 repeat protein [General function pr 95.2
PF15390671 DUF4613: Domain of unknown function (DUF4613) 95.19
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.17
PRK10115686 protease 2; Provisional 95.05
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.04
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.0
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.97
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 94.96
smart0034044 HALZ homeobox associated leucin zipper. 94.83
PRK13922 276 rod shape-determining protein MreC; Provisional 94.72
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 94.67
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 94.6
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 94.54
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 94.51
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 94.45
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.45
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 94.44
KOG18971096 consensus Damage-specific DNA binding complex, sub 94.39
PF14727418 PHTB1_N: PTHB1 N-terminus 94.35
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 94.3
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 94.23
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 94.07
PF1477560 NYD-SP28_assoc: Sperm tail C-terminal domain 93.99
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.85
PHA03098534 kelch-like protein; Provisional 93.66
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 93.51
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 93.5
PF1270987 Kinetocho_Slk19: Central kinetochore-associated; I 93.37
COG5276370 Uncharacterized conserved protein [Function unknow 93.35
PF15390671 DUF4613: Domain of unknown function (DUF4613) 93.34
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.18
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 93.1
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 93.07
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 93.04
COG3204316 Uncharacterized protein conserved in bacteria [Fun 92.79
KOG2247615 consensus WD40 repeat-containing protein [General 92.77
PF10214765 Rrn6: RNA polymerase I-specific transcription-init 92.68
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 92.45
PF10146 230 zf-C4H2: Zinc finger-containing protein ; InterPro 92.43
PF13449326 Phytase-like: Esterase-like activity of phytase 92.15
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 92.02
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 92.01
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 91.95
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 91.95
PHA02713557 hypothetical protein; Provisional 91.77
PF10226 195 DUF2216: Uncharacterized conserved proteins (DUF22 91.75
PF10392132 COG5: Golgi transport complex subunit 5; InterPro: 91.74
KOG2377657 consensus Uncharacterized conserved protein [Funct 91.49
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 91.39
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 91.38
PRK10115686 protease 2; Provisional 91.32
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 91.31
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 91.29
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 91.24
KOG2377657 consensus Uncharacterized conserved protein [Funct 91.22
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 90.94
PRK13684334 Ycf48-like protein; Provisional 90.83
COG1792 284 MreC Cell shape-determining protein [Cell envelope 90.8
PF15294 278 Leu_zip: Leucine zipper 90.76
PHA02790480 Kelch-like protein; Provisional 90.45
PLN02153341 epithiospecifier protein 90.34
COG4026 290 Uncharacterized protein containing TOPRIM domain, 90.33
KOG18961366 consensus mRNA cleavage and polyadenylation factor 90.06
COG3823262 Glutamine cyclotransferase [Posttranslational modi 90.04
PLN00033398 photosystem II stability/assembly factor; Provisio 90.01
PF15397258 DUF4618: Domain of unknown function (DUF4618) 89.97
PRK14127109 cell division protein GpsB; Provisional 89.8
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 89.7
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 89.52
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 89.31
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 89.04
COG4026 290 Uncharacterized protein containing TOPRIM domain, 88.87
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 88.72
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 88.69
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 88.68
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 88.58
PHA03098534 kelch-like protein; Provisional 88.53
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 88.38
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 88.34
KOG4451 286 consensus Uncharacterized conserved protein (tumor 88.03
PF10214765 Rrn6: RNA polymerase I-specific transcription-init 87.99
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 87.91
PF0733476 IFP_35_N: Interferon-induced 35 kDa protein (IFP 3 87.74
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 87.59
PF15254 861 CCDC14: Coiled-coil domain-containing protein 14 87.58
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 87.37
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 87.12
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 86.69
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 86.58
COG307479 Uncharacterized protein conserved in bacteria [Fun 86.57
smart0033865 BRLZ basic region leucin zipper. 86.15
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 85.86
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 85.79
KOG18971096 consensus Damage-specific DNA binding complex, sub 85.76
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 85.73
PF13942179 Lipoprotein_20: YfhG lipoprotein 85.52
TIGR01834320 PHA_synth_III_E poly(R)-hydroxyalkanoic acid synth 85.51
PRK13684334 Ycf48-like protein; Provisional 85.47
PF08961243 DUF1875: Domain of unknown function (DUF1875); Int 85.14
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 85.08
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 85.04
PRK1542279 septal ring assembly protein ZapB; Provisional 85.01
PRK10884206 SH3 domain-containing protein; Provisional 84.4
PF15290 305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 84.12
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 84.02
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 83.93
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 83.83
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 83.73
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 83.53
PF14988206 DUF4515: Domain of unknown function (DUF4515) 83.47
PLN02193470 nitrile-specifier protein 83.42
KOG4460741 consensus Nuclear pore complex, Nup88/rNup84 compo 83.08
KOG2129 552 consensus Uncharacterized conserved protein H4 [Fu 82.92
PLN02153341 epithiospecifier protein 82.63
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=5.6e-58  Score=479.38  Aligned_cols=542  Identities=28%  Similarity=0.366  Sum_probs=422.6

Q ss_pred             CccCCCCEEEEEECCCcEEEEECCCCceeEEEeCCCCCcEEEEEEccCCCeEEEEEeCCCeEEEEECCCCCceeEEeccC
Q 006360            1 MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQH   80 (648)
Q Consensus         1 AFSpdG~~Lasgs~DG~V~IwDl~sg~~i~~l~~~~~~~V~~Vafspdg~~lLaSgs~Dg~V~IWDl~t~~~~v~~l~~H   80 (648)
                      .|++.+.|||+++..|.|.|+.+.++....+|....+..|+-+.|++..+++|.+++++|.|.+||+.+..+..++...|
T Consensus       128 ~YN~~DeyiAsvs~gGdiiih~~~t~~~tt~f~~~sgqsvRll~ys~skr~lL~~asd~G~VtlwDv~g~sp~~~~~~~H  207 (673)
T KOG4378|consen  128 DYNNTDEYIASVSDGGDIIIHGTKTKQKTTTFTIDSGQSVRLLRYSPSKRFLLSIASDKGAVTLWDVQGMSPIFHASEAH  207 (673)
T ss_pred             EecCCcceeEEeccCCcEEEEecccCccccceecCCCCeEEEeecccccceeeEeeccCCeEEEEeccCCCcccchhhhc
Confidence            37889999999999999999999999988888876788999999999999999999999999999999998888899999


Q ss_pred             CCCeEEEEEcc-CCCEEEEEeCCCeEEEEeCCCCceeeEeeCCCCeEEEEEeCCCCEEEEEEcCCeEEEEECCCCCCceE
Q 006360           81 SAPTAGISFSS-DDKIIASVGLDKKLYTYDPGSRRPSSCITYEAPFSSLAFIDDDWILTAGTSNGRVVFYDIRGKPQPLT  159 (648)
Q Consensus        81 ~~~V~slafsP-dg~~LaSgs~Dg~I~IWDl~tgk~v~~~~h~~~I~slafsPdG~~Lasgs~DG~V~IWDl~s~~~~~~  159 (648)
                      ..+...|||+| +..+|++.+.|+.|.+||++..+....+....+...++|.++|.+|++|...|.|+.||++..+.|+.
T Consensus       208 sAP~~gicfspsne~l~vsVG~Dkki~~yD~~s~~s~~~l~y~~Plstvaf~~~G~~L~aG~s~G~~i~YD~R~~k~Pv~  287 (673)
T KOG4378|consen  208 SAPCRGICFSPSNEALLVSVGYDKKINIYDIRSQASTDRLTYSHPLSTVAFSECGTYLCAGNSKGELIAYDMRSTKAPVA  287 (673)
T ss_pred             cCCcCcceecCCccceEEEecccceEEEeecccccccceeeecCCcceeeecCCceEEEeecCCceEEEEecccCCCCce
Confidence            99999999999 88899999999999999999988888888999999999999999999999999999999999999999


Q ss_pred             EEeecCCCCCeeEEEEccCCCeEEEeccCCCCeEEEEeeCCCeEEcCCCCCCCCccccccCcccCCCCCCCCCCCCCCCC
Q 006360          160 VLRACSSSEAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPSVTTSSVSLSTAVSGSRPNSRSGPSAEAS  239 (648)
Q Consensus       160 ~l~~~~h~~~VtsLafspdg~~Las~~~~~~~~~lvs~s~D~~IkvWDlr~~~~~ss~ss~~~~sss~ss~ta~s~g~~~  239 (648)
                      ++.  .|...|++|+|.+.- .+++-..     +-.++..             ...++..     .     .........
T Consensus       288 v~s--ah~~sVt~vafq~s~-tvltkss-----ln~G~~~-------------~~~~vn~-----~-----s~~~~aat~  336 (673)
T KOG4378|consen  288 VRS--AHDASVTRVAFQPSP-TVLTKSS-----LNSGDNQ-------------QNGSVNS-----S-----SNATGAATE  336 (673)
T ss_pred             Eee--ecccceeEEEeeecc-eeeeccc-----cccCccC-------------CCceecc-----c-----cccccccCC
Confidence            998  788889999999853 3322211     0000000             0000000     0     000001111


Q ss_pred             CCccCCCCCCCCCcccCCCCCCcceeccCCCCCCCCCCccccccccccCcCCCCCccccCCCCCCc-CCCCCCCCCCCcc
Q 006360          240 SLTVGGTGEETPQRSYLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEGAK-KDHLPIDKKPSSM  318 (648)
Q Consensus       240 si~~~s~~~~tP~~~~l~~g~~~~~l~~~r~~~~~~~d~~vfsPl~dv~~~~~s~~~~~~~~~g~~-~~~~~~~~~~~~~  318 (648)
                      ...+....+++| +.++|+..|...+++-+..-+..++|.+|.|.+++..++.     |.+..|.. .|.+..+.+++  
T Consensus       337 g~rNsgiVe~aP-~~~l~~s~p~~~lsa~~~~ts~~~~~~g~p~iI~~ds~~k-----~~Ds~G~n~~d~~~~d~g~S--  408 (673)
T KOG4378|consen  337 GPRNSGIVERAP-SDELRKSIPANLLSAQNQLTSLGYGVSGTPTIIRRDSFCK-----FLDSQGPNAVDRMSTDLGAS--  408 (673)
T ss_pred             CCccccchhcCc-hhhhhhccCchhhhhhccccccccCccCCCceeehhhhhh-----hhhccCCccccceeeccCcc--
Confidence            223455668888 6899999999999998888888899999999999888777     76666754 57777777774  


Q ss_pred             cCCCCCCCCCCCCCCCCcccccc-cCCCCCCcccccccccccCCCCCCCCCCCCCCCCCCccccccccchhhhhccCCCC
Q 006360          319 LFPSSSRRFPYAEDGSNEHSVFD-WKSSSTSKQDDARSFALLGSTPSPSSKSEDSSITPPEAWGGEKLSDKFALLRQPLN  397 (648)
Q Consensus       319 ~~~s~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  397 (648)
                          +     |.+..+   ||+| |.+-.-                    |.++.+++  +   |+++  +|.++-...-
T Consensus       409 ----S-----~gD~fs---PIrDD~~~~n~--------------------K~~d~~~~--k---Gd~f--~f~p~~ns~f  449 (673)
T KOG4378|consen  409 ----S-----YGDSFS---PIRDDWETLNR--------------------KPQDYETA--K---GDRF--SFCPPVNSGF  449 (673)
T ss_pred             ----c-----ccccCC---ccccchhhcCC--------------------CCCchhcc--c---cCcc--ccccccccCC
Confidence                1     111111   6664 442221                    22333333  1   3333  1221111111


Q ss_pred             CCCccccccCCccCccCcccccccccccccccccccCCCcccccccccccccccccCCCCCCCCCCCCCCCCCCCCcccc
Q 006360          398 MPSRYGMSTSSGLTSSSMYSGLQDVSLSQTSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLSSSFPSLSLGTKGIL  477 (648)
Q Consensus       398 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  477 (648)
                      .|.|-.. .++..+++.|+|.+.| ....++..-..+-.+.++..+  +.++.++++|    |.+..   +-++.++++.
T Consensus       450 sp~~n~V-~Ss~ttS~~~~spl~d-f~~s~G~~~~~n~~lt~e~~~--~~s~~~e~~s----d~~~~---s~kl~t~gv~  518 (673)
T KOG4378|consen  450 SPVDNSV-NSSTTTSLQRNSPLKD-FSNSSGDGKLMNIALTDELCE--EQSANIEVAS----DTGGG---SDKLNTPGVD  518 (673)
T ss_pred             CcccCcc-cccccchhhccCcccc-ccCCCCcchhhcccccchHHH--Hhhcceeeec----cCCCC---cccccCCCCC
Confidence            2444443 4558899999999999 777778877777777666554  7788888883    33322   2357788888


Q ss_pred             cCCCCCCCCCCcCCCCCCCCCcccccccccccCCccccCCCcccCCchhhHHHHhhcccccCCcccccCCCCCCCCCCCC
Q 006360          478 GSGNLDSSRPSSLTLTHREPRRTYAERISTTSGTSLSVGSPKTKKTGAETKEELLSNFLSRSDTSAVVEPGIPPAINGGM  557 (648)
Q Consensus       478 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  557 (648)
                      ..+++.+- +.+ ++.|+  +.+|+++|.+++--.+--++|++||++.|-          +.....+++.|..+.+||++
T Consensus       519 a~gn~~~~-~lS-N~TRn--s~~~~~~i~~~s~~~~L~~~p~i~ksss~n----------~p~~~~a~~ag~~s~l~~~v  584 (673)
T KOG4378|consen  519 AEGNRRLR-LLS-NATRN--STPHHANITPQSSNPLLKPQPLIAKSSSGN----------LPAQMDADWAGEFSELRDFV  584 (673)
T ss_pred             Cccccccc-ccc-ccccc--CCcccccCCCcccCccccCCcccccCCCCC----------CchhhhhhhhhhhHHHHHHH
Confidence            87877776 333 89999  999999999999554445999999999982          55566788999999999999


Q ss_pred             CCCCCCCCCCCCCCchhHHHHHHHHHHHHHHHHHHHHHHHhHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 006360          558 SQSLKSPQPDPPQGSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSL  637 (648)
Q Consensus       558 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lh~~~~r~~~~~~~e~~~~~~~~~~~~~~l~~e~~~l  637 (648)
                      .|.+.- +++-.+-+.|++|+||++++++||+||.++|+|||||||||||||||+.+||+.|++.|.||+. |++|+|.|
T Consensus       585 ~qs~~~-~~q~~~~~~fs~q~~q~~~~~tlddfq~~~hrdirNl~~ell~Qfhm~~~Ems~llery~eNe~-l~aelk~l  662 (673)
T KOG4378|consen  585 DQSCEK-VEQELEYVTFSNQRLQANKMTTLDDFQVENHRDIRNLALELLLQFHMFMREMSRLLERYNENEM-LKAELKFL  662 (673)
T ss_pred             Hhhhhh-HHhhcccchhHHHHHHHHhhhhHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHH-HHHHHHHH
Confidence            988665 5556667999999999999999999999999999999999999999999999999999999988 99999999


Q ss_pred             HHHHHHHHhh
Q 006360          638 RKENHQLRQL  647 (648)
Q Consensus       638 r~e~~~lr~~  647 (648)
                      |||||+||+-
T Consensus       663 reenq~lr~~  672 (673)
T KOG4378|consen  663 REENQTLRCG  672 (673)
T ss_pred             HHhhhhhhcc
Confidence            9999999974

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF05769 DUF837: Protein of unknown function (DUF837); InterPro: IPR008555 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF14775 NYD-SP28_assoc: Sperm tail C-terminal domain Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain Back     alignment and domain information
>PF10392 COG5: Golgi transport complex subunit 5; InterPro: IPR019465 The conserved oligomeric Golgi (COG) complex is a peripheral membrane complex involved in intra-Golgi protein trafficking Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>COG1792 MreC Cell shape-determining protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG1896 consensus mRNA cleavage and polyadenylation factor II complex, subunit CFT1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>PRK14127 cell division protein GpsB; Provisional Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>KOG4451 consensus Uncharacterized conserved protein (tumor-associated antigen HCA127 in humans) [Function unknown] Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF07334 IFP_35_N: Interferon-induced 35 kDa protein (IFP 35) N-terminus; InterPro: IPR009938 This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [] Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF13942 Lipoprotein_20: YfhG lipoprotein Back     alignment and domain information
>TIGR01834 PHA_synth_III_E poly(R)-hydroxyalkanoic acid synthase, class III, PhaE subunit Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF08961 DUF1875: Domain of unknown function (DUF1875); InterPro: IPR015056 MIT can be found in the Nuclear receptor-binding factor 2, it has no known function Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF14988 DUF4515: Domain of unknown function (DUF4515) Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query648
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 2e-04
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure 
Iteration: 1

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 72/153 (47%), Gaps = 13/153 (8%)
Query: 24  ASGAKAAELKDPNEQVLRVL-DYSRNSRHL--------LVTAGDDGTLHLWDTTGRSPKV 74
           AS  K  +L + N Q+L+ L  +S + R +        + +A DD T+ LW+  G+  + 
Sbjct: 362 ASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQT 421
Query: 75  SWLKQHSAPTAGISFSSDDKIIASVGLDKKLYTYDPGSRRPSSCITYEAPFSSLAFIDDD 134
             L  HS+   G++FS DD+ IAS   DK +  ++   +   +   + +    +AF  D 
Sbjct: 422 --LTGHSSSVWGVAFSPDDQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDG 479
Query: 135 WILTAGTSNGRVVFYDIRGKPQPLTVLRACSSS 167
             + + + +  V  ++  G  Q L  L   SSS
Sbjct: 480 QTIASASDDKTVKLWNRNG--QLLQTLTGHSSS 510

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query648
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.96
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.96
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.96
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.96
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.96
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.95
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.95
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.95
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.95
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.95
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.95
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.95
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.95
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.95
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.95
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.95
2pm7_B297 Protein transport protein SEC13, protein transport 99.95
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.94
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.94
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.94
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.94
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.94
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.94
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.94
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.94
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.94
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.94
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.94
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.93
2pm7_B297 Protein transport protein SEC13, protein transport 99.93
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.93
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.93
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.93
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.93
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.93
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.93
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.93
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.93
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.93
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.93
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.93
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.93
3jrp_A379 Fusion protein of protein transport protein SEC13 99.93
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.92
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.92
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.92
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.92
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.92
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.92
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.92
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.92
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.92
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.92
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.91
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.91
3jrp_A379 Fusion protein of protein transport protein SEC13 99.91
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.91
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.91
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.91
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.91
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.91
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.91
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.91
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.91
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.91
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.91
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.91
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.91
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.9
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.9
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.9
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.9
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.9
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.9
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.9
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.9
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.9
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.9
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.9
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.9
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.9
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.9
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.9
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.89
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.89
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.89
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.89
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.89
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.89
3jro_A753 Fusion protein of protein transport protein SEC13 99.89
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.89
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.89
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.89
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.89
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.89
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.88
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.88
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.88
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.87
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.87
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.87
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.87
3jro_A753 Fusion protein of protein transport protein SEC13 99.87
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.87
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.87
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.87
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.87
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.87
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.87
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.86
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.86
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.86
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.86
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.86
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.86
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.86
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.85
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.84
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.84
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.84
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.84
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.84
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.84
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.83
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.82
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.81
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.8
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.78
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.75
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.75
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.73
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.71
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.71
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.7
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.7
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.69
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.69
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.69
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.68
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.68
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.66
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.66
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.65
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.65
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.65
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.64
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.64
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.6
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.59
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.59
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.58
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.57
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.56
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.56
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.56
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.54
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.54
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.54
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.53
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.53
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.53
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.52
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.5
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.5
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.5
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.49
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.42
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.39
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.38
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.38
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.36
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.35
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.33
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.33
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.32
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.31
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.28
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.28
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.28
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.26
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.25
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.24
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.23
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.22
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.21
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.2
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.19
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.16
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.16
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.16
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.13
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.12
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.11
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.11
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.09
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.09
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.04
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.04
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.01
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.0
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.0
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.97
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.9
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.9
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.89
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.89
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.87
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.86
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.83
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.82
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.82
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.81
2qe8_A343 Uncharacterized protein; structural genomics, join 98.79
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.78
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.74
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.69
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.68
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.66
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.62
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.62
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.59
2qe8_A343 Uncharacterized protein; structural genomics, join 98.59
2ece_A462 462AA long hypothetical selenium-binding protein; 98.54
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.49
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.48
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.48
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.47
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.47
2ece_A462 462AA long hypothetical selenium-binding protein; 98.44
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.42
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.4
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.37
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.34
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.33
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.31
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.28
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.27
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.24
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.2
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.12
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.06
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.05
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.05
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.03
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.0
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.0
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.97
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.96
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.95
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.94
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.91
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.9
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.9
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.89
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.89
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.83
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.82
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.82
3v65_B386 Low-density lipoprotein receptor-related protein; 97.78
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.68
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.68
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.67
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.67
3v65_B386 Low-density lipoprotein receptor-related protein; 97.66
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.65
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.64
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.63
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.59
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.59
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.54
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.52
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.5
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.48
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.47
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.46
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.41
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.38
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.32
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.29
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.23
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.21
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.19
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.18
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.17
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.15
3kya_A496 Putative phosphatase; structural genomics, joint c 97.12
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.11
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.07
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.06
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.98
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.97
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 96.93
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 96.91
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.9
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.81
3kya_A496 Putative phosphatase; structural genomics, joint c 96.78
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.77
3m48_A33 General control protein GCN4; leucine zipper, synt 96.77
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.73
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.54
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 96.53
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.49
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.32
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 96.3
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 96.3
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.25
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 96.24
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.24
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.21
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 96.17
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.16
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.91
2bni_A34 General control protein GCN4; four helix bundle, a 95.84
1uo4_A34 General control protein GCN4; four helix bundle, c 95.81
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.79
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 95.7
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.63
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 95.43
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 95.22
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 95.09
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 95.06
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 95.03
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 94.95
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 94.85
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 94.73
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 94.7
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 94.63
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 94.62
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 94.59
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 94.54
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 94.54
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 94.5
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 94.49
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 94.45
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 94.43
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 94.42
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 94.4
2hy6_A34 General control protein GCN4; protein design, para 94.18
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 94.12
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 94.07
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 94.05
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 94.02
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 94.02
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 93.53
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 93.36
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 93.35
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 93.33
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 93.25
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 93.09
3ott_A758 Two-component system sensor histidine kinase; beta 93.08
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 92.97
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 92.93
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 92.84
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 92.67
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 92.65
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 92.56
2wuj_A57 Septum site-determining protein diviva; bacterial 92.15
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 91.85
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 91.79
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 91.61
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 91.5
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 91.49
3q4f_C186 DNA repair protein XRCC4; DSB repair, nuclear, rec 91.49
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 91.45
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 91.43
3ott_A758 Two-component system sensor histidine kinase; beta 91.17
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 91.13
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 90.97
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 90.33
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 90.15
3w03_C184 DNA repair protein XRCC4; coiled-coil, NHEJ, DSBS 90.02
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 89.33
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 89.3
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 89.21
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 89.2
2l5g_A38 GPS2 protein, G protein pathway suppressor 2; GPS2 88.5
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 88.42
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 88.41
1uii_A83 Geminin; human, DNA replication, cell cycle; 2.00A 87.93
2p22_A174 Suppressor protein STP22 of temperature- sensitive 87.47
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 87.03
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 86.28
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 86.25
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 86.09
1nfn_A191 Apolipoprotein E3; lipid transport, heparin-bindin 85.75
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 85.52
1p9i_A31 Cortexillin I/GCN4 hybrid peptide; coiled-coil, un 85.41
1ez3_A127 Syntaxin-1A; three helix bundle, endocytosis/exocy 84.99
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 84.88
1dip_A78 Delta-sleep-inducing peptide immunoreactive peptid 84.53
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 82.96
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 82.88
1wlq_A83 Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z 82.65
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 82.6
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 82.55
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 82.31
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 82.16
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 82.04
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 81.81
3lay_A175 Zinc resistance-associated protein; salmonella typ 81.6
3no0_A276 DNA gyrase subunit A; DNA topology, topoisomerase, 81.28
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 80.99
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 80.94
1uo4_A34 General control protein GCN4; four helix bundle, c 80.61
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 80.59
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 80.59
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
Probab=99.96  E-value=4.9e-28  Score=257.47  Aligned_cols=193  Identities=11%  Similarity=0.111  Sum_probs=164.6

Q ss_pred             CccCCCCEEEEEECCCcEEEEECCCCceeEEEeCCCCCcEEEEEEccCCCeEEEEEeCCCeEEEEECCCCCceeEEe--c
Q 006360            1 MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWL--K   78 (648)
Q Consensus         1 AFSpdG~~Lasgs~DG~V~IwDl~sg~~i~~l~~~~~~~V~~Vafspdg~~lLaSgs~Dg~V~IWDl~t~~~~v~~l--~   78 (648)
                      +|+|+|++|++|+.||.|+|||+.+++++..+.+ |...|.+++|++++..+|++++.|++|+|||+++++. ...+  .
T Consensus       134 ~~spdg~~l~sgs~d~~i~iwd~~~~~~~~~~~~-h~~~V~~~~~~~~~~~~l~s~s~D~~v~iwd~~~~~~-~~~~~~~  211 (344)
T 4gqb_B          134 SVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRA-HAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKP-ASQIGCS  211 (344)
T ss_dssp             EECTTSSEEEEEETTSCEEEEETTTTEEEEEECC-CSSCEEEEEECSSCTTEEEEEETTSCEEEEETTSSSC-EEECC--
T ss_pred             EECCCCCEEEEEeCCCeEEEEECCCCcEEEEEcC-cCCceEEEEecCCCCCceeeeccccccccccccccce-eeeeecc
Confidence            5899999999999999999999999999999987 7788999999999977899999999999999988875 3333  3


Q ss_pred             cCCCCeEEEEEcc-CCCEEEEEeCCCeEEEEeCCCCceeeEe-eCCCCeEEEEEeCCC-CEEEEEEcCCeEEEEECCCCC
Q 006360           79 QHSAPTAGISFSS-DDKIIASVGLDKKLYTYDPGSRRPSSCI-TYEAPFSSLAFIDDD-WILTAGTSNGRVVFYDIRGKP  155 (648)
Q Consensus        79 ~H~~~V~slafsP-dg~~LaSgs~Dg~I~IWDl~tgk~v~~~-~h~~~I~slafsPdG-~~Lasgs~DG~V~IWDl~s~~  155 (648)
                      .|...+.+++|+| ++++|++|+.|+.|++||+++++++..+ .|...|.+++|+|++ ++|++|+.|+.|+|||++++ 
T Consensus       212 ~~~~~~~~~~~~p~~~~~l~sg~~dg~v~~wd~~~~~~~~~~~~h~~~v~~v~fsp~g~~~lasgs~D~~i~vwd~~~~-  290 (344)
T 4gqb_B          212 APGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLS-  290 (344)
T ss_dssp             --CCCEEEEEECSSCTTEEEEEETTSEEEEEESCC--CCEEEECCSSCEEEEEECSSSSCCEEEEETTSCEEEECTTCC-
T ss_pred             eeeccceeeeecCCCCcceEEeccCCcEEEEECCCCcEEEEEcCCCCCEEEEEEccCCCeEEEEEeCCCeEEEEECCCC-
Confidence            4566799999999 6788999999999999999999988776 589999999999997 57999999999999999887 


Q ss_pred             CceEEEeecCCCCCeeEEEEccCCCeEEEeccCCCCeEEEEeeCCCeEEcCCCCC
Q 006360          156 QPLTVLRACSSSEAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLP  210 (648)
Q Consensus       156 ~~~~~l~~~~h~~~VtsLafspdg~~Las~~~~~~~~~lvs~s~D~~IkvWDlr~  210 (648)
                         +.+...+|.+.|++|+|+|+++.           ++++++.|+.|++|++..
T Consensus       291 ---~~~~~~~H~~~V~~v~~sp~~~~-----------llas~s~D~~v~~w~v~~  331 (344)
T 4gqb_B          291 ---ELFRSQAHRDFVRDATWSPLNHS-----------LLTTVGWDHQVVHHVVPT  331 (344)
T ss_dssp             ---EEEEECCCSSCEEEEEECSSSTT-----------EEEEEETTSCEEEEECCC
T ss_pred             ---cEEEEcCCCCCEEEEEEeCCCCe-----------EEEEEcCCCeEEEEECCC
Confidence               23445589999999999997543           345567799999999864
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2wuj_A Septum site-determining protein diviva; bacterial cell division, septation, cell cycle, sporulation; 1.40A {Bacillus subtilis} PDB: 2wuk_A Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3q4f_C DNA repair protein XRCC4; DSB repair, nuclear, recombination-recombination complex, DN protein-protein binding complex; HET: DNA; 5.50A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3w03_C DNA repair protein XRCC4; coiled-coil, NHEJ, DSBS repair, KU70/80, DNA-PKCS, DNA ligas binding protein; HET: DNA; 8.49A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>2l5g_A GPS2 protein, G protein pathway suppressor 2; GPS2, SMRT, TBL1, CO-repressor, transcription regulator; NMR {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 Back     alignment and structure
>2p22_A Suppressor protein STP22 of temperature- sensitive alpha-factor receptor and arginine...; endosome, trafficking complex, VPS23, VPS28, VPS37, MVB12; 2.70A {Saccharomyces cerevisiae} PDB: 2caz_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 Back     alignment and structure
>1ez3_A Syntaxin-1A; three helix bundle, endocytosis/exocytosis complex; 1.90A {Rattus norvegicus} SCOP: a.47.2.1 PDB: 1br0_A 3lg7_A* Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>1dip_A Delta-sleep-inducing peptide immunoreactive peptide; structure, leucine zipper, PIG, acetylation; NMR {Sus scrofa} SCOP: h.1.12.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} Back     alignment and structure
>3no0_A DNA gyrase subunit A; DNA topology, topoisomerase, C-terminal DO gyrase, DNA binding protein, isomerase; HET: DNA GOL; 1.30A {Aquifex aeolicus} Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 648
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-10
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 8e-10
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-09
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.002
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.002
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.004
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.004
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-07
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-06
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 9e-07
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 7e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 9e-07
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 8e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.002
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.003
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 3e-06
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-06
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.002
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 5e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 7e-05
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 7e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 9e-06
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 6e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.001
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-04
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.001
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 3e-04
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 4e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-04
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-04
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.001
d1sumb_ 225 a.7.12.1 (B:) PhoU homolog TM1734 {Thermotoga mari 0.001
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 59.0 bits (141), Expect = 4e-10
 Identities = 34/169 (20%), Positives = 60/169 (35%), Gaps = 20/169 (11%)

Query: 1   MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRV------------------ 42
             N     +AS S    + +  +A+    AEL++    V  +                  
Sbjct: 150 RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVVECISWAPESSYSSISEATGSE 209

Query: 43  LDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKIIASVGLD 102
              S      L++   D T+ +WD +     +  L  H     G+ F S  K I S   D
Sbjct: 210 TKKSGKPGPFLLSGSRDKTIKMWDVSTGMC-LMTLVGHDNWVRGVLFHSGGKFILSCADD 268

Query: 103 KKLYTYDPGSRRPSSCIT-YEAPFSSLAFIDDDWILTAGTSNGRVVFYD 150
           K L  +D  ++R    +  +E   +SL F      +  G+ +  V  ++
Sbjct: 269 KTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWE 317
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query648
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.95
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.94
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.93
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.93
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.93
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.93
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.92
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.92
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.92
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.91
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.91
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.89
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.89
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.88
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.86
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.86
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.85
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.85
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.85
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.84
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.83
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.83
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.83
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.83
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.81
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.8
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.78
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.77
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.71
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.7
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.68
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.66
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.66
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.64
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.6
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.59
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.57
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.46
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.4
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.39
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.39
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.33
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.32
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.18
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.17
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.09
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.02
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.92
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.91
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.84
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.83
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.78
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.71
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.64
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.5
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.49
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.43
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.42
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.41
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.38
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.38
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.28
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.27
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.23
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.12
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.1
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.04
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.99
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.96
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.85
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.62
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.36
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 97.19
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.04
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.91
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.84
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.66
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.48
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.29
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.09
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.02
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 95.98
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 95.82
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.18
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 94.92
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.92
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 94.73
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.68
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 94.37
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 94.34
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 94.32
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 93.15
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 92.99
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 92.65
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 92.29
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 92.19
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 90.63
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 90.35
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 86.13
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 85.25
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 84.35
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.95  E-value=8.4e-26  Score=228.59  Aligned_cols=189  Identities=14%  Similarity=0.137  Sum_probs=161.1

Q ss_pred             CccCCCCEEEEEECCCcEEEEECCCCceeEEEeCCCCCcEEEEEEccCCCeEEEEEeCCCeEEEEECCC-----------
Q 006360            1 MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTG-----------   69 (648)
Q Consensus         1 AFSpdG~~Lasgs~DG~V~IwDl~sg~~i~~l~~~~~~~V~~Vafspdg~~lLaSgs~Dg~V~IWDl~t-----------   69 (648)
                      +|+|++++||+|+.||.|+|||+.+++.+..+.. |...|.+++|+|++. ++++|+.|+.|++|+...           
T Consensus        62 ~~s~~~~~l~sgs~Dg~v~iWd~~~~~~~~~~~~-~~~~v~~v~~~~~~~-~l~~~~~d~~i~~~~~~~~~~~~~~~~~~  139 (340)
T d1tbga_          62 HWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPL-RSSWVMTCAYAPSGN-YVACGGLDNICSIYNLKTREGNVRVSREL  139 (340)
T ss_dssp             EECTTSSEEEEEETTTEEEEEETTTTEEEEEEEC-SCSCEEEEEECTTSS-EEEEEETTCCEEEEESSSSCSCCCEEEEE
T ss_pred             EECCCCCEEEEEECCCceeeeecccceeEEEEec-ccccEEeeEeeccce-eeeeecccceeecccccccccccccceec
Confidence            5899999999999999999999999999999986 677899999999987 788888888887776522           


Q ss_pred             ----------------------------------------------------------------------------CCce
Q 006360           70 ----------------------------------------------------------------------------RSPK   73 (648)
Q Consensus        70 ----------------------------------------------------------------------------~~~~   73 (648)
                                                                                                  ... 
T Consensus       140 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~v~i~d~~~~~~-  218 (340)
T d1tbga_         140 AGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMC-  218 (340)
T ss_dssp             CCCSSCEEEEEEEETTEEEEEETTTEEEEEETTTTEEEEEEECCSSCEEEEEECTTSSEEEEEETTTEEEEEETTTTEE-
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccceeEeeeccccccceeEEeecCceEEEEECCCCcE-
Confidence                                                                                        111 


Q ss_pred             eEEeccCCCCeEEEEEccCCCEEEEEeCCCeEEEEeCCCCceeeEe---eCCCCeEEEEEeCCCCEEEEEEcCCeEEEEE
Q 006360           74 VSWLKQHSAPTAGISFSSDDKIIASVGLDKKLYTYDPGSRRPSSCI---TYEAPFSSLAFIDDDWILTAGTSNGRVVFYD  150 (648)
Q Consensus        74 v~~l~~H~~~V~slafsPdg~~LaSgs~Dg~I~IWDl~tgk~v~~~---~h~~~I~slafsPdG~~Lasgs~DG~V~IWD  150 (648)
                      +..+.+|...|++++|+|++++|++++.|+.|++||++....+..+   .+...|.+++|+|++++|++|+.||.|+|||
T Consensus       219 ~~~~~~h~~~i~~v~~~p~~~~l~s~s~d~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~s~~~~~l~~g~~dg~i~iwd  298 (340)
T d1tbga_         219 RQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWD  298 (340)
T ss_dssp             EEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCTTCCSCEEEEEECSSSCEEEEEETTSCEEEEE
T ss_pred             EEEEeCCCCCeEEEEECCCCCEEEEEeCCCeEEEEeecccccccccccccccCceEEEEECCCCCEEEEEECCCEEEEEE
Confidence            2245678999999999999999999999999999999998877665   3667799999999999999999999999999


Q ss_pred             CCCCCCceEEEeecCCCCCeeEEEEccCCCeEEEeccCCCCeEEEEeeCCCeEEcCC
Q 006360          151 IRGKPQPLTVLRACSSSEAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPD  207 (648)
Q Consensus       151 l~s~~~~~~~l~~~~h~~~VtsLafspdg~~Las~~~~~~~~~lvs~s~D~~IkvWD  207 (648)
                      +.+. +++..+.  +|.+.|++|+|+|++++|+++            +.|+.|++||
T Consensus       299 ~~~~-~~~~~~~--~H~~~V~~l~~s~d~~~l~s~------------s~Dg~v~iWd  340 (340)
T d1tbga_         299 ALKA-DRAGVLA--GHDNRVSCLGVTDDGMAVATG------------SWDSFLKIWN  340 (340)
T ss_dssp             TTTC-CEEEEEC--CCSSCEEEEEECTTSSCEEEE------------ETTSCEEEEC
T ss_pred             CCCC-cEEEEEc--CCCCCEEEEEEeCCCCEEEEE------------ccCCEEEEeC
Confidence            9987 4455555  799999999999977666554            6699999997
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure