Citrus Sinensis ID: 006401

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640------
METDPEAEREASRLKGIAETKFKNSNLKSALKHAKKAQRLAPSLEGLSSMVTAFKILRVASKSKEWYQILQVEPFSHINTIKKQYKKLALILHPDKNPHSGSEEAFKLVGEAFRVLSDKVRRKEYDMRLRIKIQDEKVALDDNDDGFAGKETFWTACSRCRLLHQFERKYLDQILVCPGCKMSFEAVEAKESNAVRVFRSGRLSEKMGSADLKTKMGNVGLKRKTVSGDTKMKGSAGSGVDGESGDSRKEMGGGRGDWGGGRLRRRTSSVGEVLARSKPKLVEDREESMTLAEMQLEAKRRANQAKLKFKLKEKEMEKRGKKEKKREKEIERHRALKNKDLEVEGQQAAERIVDLENENGVLAKKIVDLRTKKRRTVKKTEDLQIVRQETLKKSVDLVIERHKTSKTKDLEIMAVEDSDFYDFDRDRMERSFKKGQVWAIYDDDDGMPRHYGLIDEVSVNPFEVKISWLDLQSNGDEGLICWEKQGFHVSCGRFKVSRKTSIDSLNIFSHIVECERAAREVYRIFPTKGSVWALYNEAALGIEGSNLSARDRRSYDIVVLLTTYSEMHGLSMAYLEKVDGFKAVFKRREIGCHAIRWLEKDDVRLFSHQIPARKLTGDEIPDSLKDCWELDPASLPSDLLTIGWGS
ccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccEEEccccccccccccccccccccccEEEEEcccccccccEEEEEEEEccccEEEEEEEccccccccccccEEccccEEEcEEEEEccEEEEEcccccEEEEEEEEccccEEEEEcccccEEEEEccccccccccccccccccEEEEEEEEccccccccEEEEEEEEEccEEEEEEEEEcccccEEEEccccccccccccccEEEcccccccccccccccccccccHHHHcccccc
ccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHEEEccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccccEEEccHHHHHHHHHHHHHHccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccHHHcccccEEEEEccccccccEEEEEEEEEccccEEEEEEEccccccccccccEcccccccccEEEEEccEEEEccccEEEEEEEEEEccccEEEEEcccccEEEEEEccccccccccccccccEEEEEEEEEccccHcccEEEEEEEEEccEEEEEEEccccccEEEEEcHHHHHEEccccccEEEccccccccccccEEcccccccHHHHEccccc
METDPEAEREASRLKGIAETKFKNSNLKSALKHAKKAQRLAPSLEGLSSMVTAFKILRVASKSKEWYQILQVEPFSHINTIKKQYKKLALILhpdknphsgsEEAFKLVGEAFRVLSDKVRRKEYDMRLRIKIqdekvalddnddgfagkeTFWTACSRCRLLHQFERKYLDqilvcpgckmsFEAVEAKESNAVRVFRSgrlsekmgsadlktkmgnvglkrktvsgdtkmkgsagsgvdgesgdsrkemgggrgdwgggrlrrrtssvgevlarskpklveDREESMTLAEMQLEAKRRANQAKLKFKLKEKEMEKRGKKEKKREKEIERHRALKNKDLEVEGQQAAERIVDLENENGVLAKKIVDLRTkkrrtvkkteDLQIVRQETLKKSVDLVIERhktsktkdleimavedsdfydfdRDRMERSFKKGQvwaiyddddgmprhyglidevsvnpfeVKISWLdlqsngdeglicwekqgfhvscgrfkvsrktsidSLNIFSHIVECERAAREVYRIFPTKGSVWALYNEAALgiegsnlsardrrsYDIVVLLTTYSEMHGLSMAYLEKVDGFKAVFKRREIGCHAIRWLEKddvrlfshqiparkltgdeipdslkdcweldpaslpsdlltigwgs
metdpeaereasrlkgiaetkfknsnLKSALKHAKKAQRlapsleglsSMVTAFKILRVASKSKEWYQILQVEPFSHINTIKKQYKKLALILHPDKNPHSGSEEAFKLVGEAFrvlsdkvrrkeydmrlrikiqdekvalddnddgFAGKETFWTACSRCRLLHQFERKYLDQILVCPGCKMSFEaveakesnavrvfrsgrlsekmgsadlktkmgnvglkrktvsgdtkmkgsagsgvdgesgdsrkemgggrgdwgggrlrrrtssvgevlarskpklvedreeSMTLAEMQLEAKRRANQAklkfklkekemekrgkkekkrekeierhralknkdlevegQQAAERivdlenengvlakkivdlrtkkrrtvkktedlqivrqetlkksvdlvierhktsktkdleimavedsdfydfDRDRMERSFKKGQVWAIYDDDDGMPRHYGLIDEVSVNPFEVKISWLDLQSNGDEGLICWEKQGFHVSCGRFKVsrktsidslNIFSHIVECERAAREVYRIFPTKGSVWALYNEAALGiegsnlsardrrSYDIVVLLTTYSEMHGLSMAYLEKVDGFKAVFKRREIGCHAirwlekddvrLFSHQiparkltgdeiPDSLKDCWeldpaslpsdlltigwgs
METDPEAEREASRLKGIAETKFKNSNLKSALKHAKKAQRLAPSLEGLSSMVTAFKILRVASKSKEWYQILQVEPFSHINTIKKQYKKLALILHPDKNPHSGSEEAFKLVGEAFRVLSDKVRRKEYDMRLRIKIQDEKVALDDNDDGFAGKETFWTACSRCRLLHQFERKYLDQILVCPGCKMSFEAVEAKESNAVRVFRSGRLSEKMGSADLKTKMGNVGLKRKTVSGDTKMKGSAGSGVDGESGDSRKEMgggrgdwgggrlrrrTSSVGEVLARSKPKLVEDREESMTLAEMQLEAKRRANQAklkfklkekemekrgkkekkrekeierhrALKNKDLEVEGQQAAERIVDLENENGVLAKKIVDLrtkkrrtvkktEDLQIVRQETLKKSVDLVIERHKTSKTKDLEIMAVEDSDFYDFDRDRMERSFKKGQVWAIYDDDDGMPRHYGLIDEVSVNPFEVKISWLDLQSNGDEGLICWEKQGFHVSCGRFKVSRKTSIDSLNIFSHIVECERAAREVYRIFPTKGSVWALYNEAALGIEGSNLSARDRRSYDIVVLLTTYSEMHGLSMAYLEKVDGFKAVFKRREIGCHAIRWLEKDDVRLFSHQIPARKLTGDEIPDSLKDCWELDPASLPSDLLTIGWGS
**********************************************LSSMVTAFKILRVASKSKEWYQILQVEPFSHINTIKKQYKKLALILH***********AFKLVGEAFRVLSDKVRRKEYDMRLRIKIQDEKVALDDNDDGFAGKETFWTACSRCRLLHQFERKYLDQILVCPGCKMSFEAVEA*******************************************************************************************************************************************************************VDLENENGVLAKKIVDLRT**********DLQIVRQETLKKSVDLVIERH******DLEIMAVEDSDFYDFDRDRMERSFKKGQVWAIYDDDDGMPRHYGLIDEVSVNPFEVKISWLDLQSNGDEGLICWEKQGFHVSCGRFKVSRKTSIDSLNIFSHIVECERAAREVYRIFPTKGSVWALYNEAALGIEGSNLSARDRRSYDIVVLLTTYSEMHGLSMAYLEKVDGFKAVFKRREIGCHAIRWLEKDDVRLFSHQIPARKLTGDEIPDSLKDCWELDPASLPSDLLTIG***
******AEREASRLKGIAETKFKNSNLKSALKHAKKAQRLAPSLEGLSSMVTAFKILRVASKSKEWYQILQVEPFSHINTIKKQYKKLALILHPDKNPHSGSEEAFKLVGEAFRVLSDKVRRKE**************************ETFWTACSRCRLLHQFERKYLDQILVCPGCKM**************************************************************************************************************************************************************************************************************************************MAVEDSDFYDFDRDRMERSFKKGQVWAIYDDDDGMPRHYGLIDEVSVNPFEVKISWLDLQSNGDEGLICWEKQGFHVSCGRFKVSRKTSIDSLNIFSHIVECERAAREVYRIFPTKGSVWALYNEAALGIEGSNLSARDRRSYDIVVLLTTYSEMHGLSMAYLEKVDGFKAVFKRREIGCHAIRWLEKDDVRLFSHQIPARKLTGDEIPDSLKDCWELDPASLPSDLLTIGW**
************RLKGIAETKFKNSNLK************APSLEGLSSMVTAFKILRVASKSKEWYQILQVEPFSHINTIKKQYKKLALILHPDKNPHSGSEEAFKLVGEAFRVLSDKVRRKEYDMRLRIKIQDEKVALDDNDDGFAGKETFWTACSRCRLLHQFERKYLDQILVCPGCKMSFEAVEAKESNAVRVFRSGRLSEKMGSADLKTKMGNVGLKRKTVS****************************GDWGGGRLRRRTSSVGEVLARSKPKLVEDREESMTLAEMQLEAKRRANQAKLKFKLKEK***************IERHRALKNKDLEVEGQQAAERIVDLENENGVLAKKIVDLRTKKRRTVKKTEDLQIVRQETLKKSVDLVIERHKTSKTKDLEIMAVEDSDFYDFDRDRMERSFKKGQVWAIYDDDDGMPRHYGLIDEVSVNPFEVKISWLDLQSNGDEGLICWEKQGFHVSCGRFKVSRKTSIDSLNIFSHIVECERAAREVYRIFPTKGSVWALYNEAALGIEGSNLSARDRRSYDIVVLLTTYSEMHGLSMAYLEKVDGFKAVFKRREIGCHAIRWLEKDDVRLFSHQIPARKLTGDEIPDSLKDCWELDPASLPSDLLTIGWGS
*ET*PEAEREASRLKGIAETKFKNSNLKSALKHAKKAQRLAPSLEGLSSMVTAFKILRVASKSKEWYQILQVEPFSHINTIKKQYKKLALILHPDKNPHSGSEEAFKLVGEAFRVLSDKVRRKEYDMRLRI******************KETFWTACSRCRLLHQFERKYLDQILVCPGCKMSFEAVEAKES*************************************************************************************************************************************************************************************************************************LEIMAVEDSDFYDFDRDRMERSFKKGQVWAIYDDDDGMPRHYGLIDEVSVNPFEVKISWLDLQSNGDEGLICWEKQGFHVSCGRFKVSRKTSIDSLNIFSHIVECERAAREVYRIFPTKGSVWALYNEAALGIEGSNLSARDRRSYDIVVLLTTYSEMHGLSMAYLEKVDGFKAVFKRREIGCHAIRWLEKDDVRLFSHQIPARKLTGDEIPDSLKDCWELDPASLPSDLLTIGW**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METDPEAEREASRLKGIAETKFKNSNLKSALKHAKKAQRLAPSLEGLSSMVTAFKILRVASKSKEWYQILQVEPFSHINTIKKQYKKLALILHPDKNPHSGSEEAFKLVGEAFRVLSDKVRRKEYDMRLRIKIQDEKVALDDNDDGFAGKETFWTACSRCRLLHQFERKYLDQILVCPGCKMSFEAVEAKESNAVRVFRSGRLSEKMGSADLKTKMGNVGLKRKTVSGDTKMKGSAGSGVDGESGDSRKEMGGGRGDWGGGRLRRRTSSVGEVLARSKPKLVEDREESMTLAEMQLEAKRRANQAKLKFKxxxxxxxxxxxxxxxxxxxxxRHRALKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKRRTVKKTEDLQIVRQETLKKSVDLVIERHKTSKTKDLEIMAVEDSDFYDFDRDRMERSFKKGQVWAIYDDDDGMPRHYGLIDEVSVNPFEVKISWLDLQSNGDEGLICWEKQGFHVSCGRFKVSRKTSIDSLNIFSHIVECERAAREVYRIFPTKGSVWALYNEAALGIEGSNLSARDRRSYDIVVLLTTYSEMHGLSMAYLEKVDGFKAVFKRREIGCHAIRWLEKDDVRLFSHQIPARKLTGDEIPDSLKDCWELDPASLPSDLLTIGWGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query646 2.2.26 [Sep-21-2011]
Q54IP0539 DnaJ homolog subfamily C yes no 0.170 0.204 0.379 4e-11
Q7ZXQ8371 DnaJ homolog subfamily B N/A no 0.102 0.177 0.484 1e-10
Q9FH28354 Chaperone protein dnaJ 49 no no 0.190 0.347 0.309 6e-10
P0CW06389 Chaperone protein DnaJ OS yes no 0.120 0.200 0.423 9e-10
P0CW07389 Chaperone protein DnaJ OS yes no 0.120 0.200 0.423 9e-10
Q28I38375 DnaJ homolog subfamily B no no 0.102 0.176 0.469 1e-09
Q02605388 Chaperone protein DnaJ 1 yes no 0.105 0.175 0.485 1e-09
P48353224 Protein HLJ1 OS=Saccharom yes no 0.108 0.312 0.492 1e-09
O13633403 Uncharacterized J domain- yes no 0.105 0.168 0.485 2e-09
Q9QYI4376 DnaJ homolog subfamily B yes no 0.117 0.202 0.443 2e-09
>sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 66/116 (56%), Gaps = 6/116 (5%)

Query: 18  AETKFKNSNLKSALKHAKKAQRLAPSLEGLSSMVTAFKILRVASKSKEWYQILQVEPFSH 77
           A+ + K  N + A++  +KAQ L P    L   +   KI    S  K++Y+IL V   + 
Sbjct: 314 AQCQMKQENYEDAVRDYEKAQSLDPENGELQRNIKEAKIAHKKSLRKDYYKILGVSKEAG 373

Query: 78  INTIKKQYKKLALILHPDKNPH------SGSEEAFKLVGEAFRVLSDKVRRKEYDM 127
              IKK Y+KLAL  HPDKN        + +E+ FK +GEA+ VLSD+ ++++YDM
Sbjct: 374 ETEIKKAYRKLALQYHPDKNNQLPEEEKAQAEKMFKDIGEAYSVLSDEKKKRQYDM 429

Dictyostelium discoideum (taxid: 44689)
>sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH28|DNJ49_ARATH Chaperone protein dnaJ 49 OS=Arabidopsis thaliana GN=ATJ49 PE=2 SV=2 Back     alignment and function description
>sp|P0CW06|DNAJ_METMZ Chaperone protein DnaJ OS=Methanosarcina mazei GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P0CW07|DNAJ_METMA Chaperone protein DnaJ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q28I38|DJB14_XENTR DnaJ homolog subfamily B member 14 OS=Xenopus tropicalis GN=dnajb14 PE=2 SV=1 Back     alignment and function description
>sp|Q02605|DNAJ1_MYCLE Chaperone protein DnaJ 1 OS=Mycobacterium leprae (strain TN) GN=dnaJ1 PE=3 SV=2 Back     alignment and function description
>sp|P48353|HLJ1_YEAST Protein HLJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HLJ1 PE=1 SV=1 Back     alignment and function description
>sp|O13633|YNF5_SCHPO Uncharacterized J domain-containing protein C17A3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi041 PE=1 SV=1 Back     alignment and function description
>sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query646
224071403594 predicted protein [Populus trichocarpa] 0.908 0.988 0.603 0.0
255587876643 conserved hypothetical protein [Ricinus 0.930 0.934 0.577 0.0
449456907645 PREDICTED: uncharacterized protein LOC10 0.944 0.945 0.535 0.0
449509530697 PREDICTED: uncharacterized LOC101207675 0.924 0.856 0.517 1e-179
356497631561 PREDICTED: uncharacterized protein LOC10 0.848 0.976 0.506 1e-156
334184703590 DNAJ heat shock N-terminal domain-contai 0.885 0.969 0.447 1e-126
3608134575 putative DnaJ protein [Arabidopsis thali 0.862 0.968 0.428 1e-115
225427087542 PREDICTED: uncharacterized protein LOC10 0.382 0.455 0.771 1e-112
297823347578 DNAJ heat shock N-terminal domain-contai 0.863 0.965 0.433 1e-112
297742027404 unnamed protein product [Vitis vinifera] 0.379 0.606 0.773 1e-112
>gi|224071403|ref|XP_002303443.1| predicted protein [Populus trichocarpa] gi|222840875|gb|EEE78422.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/645 (60%), Positives = 459/645 (71%), Gaps = 58/645 (8%)

Query: 3   TDPEAEREASRLKGIAETKFKNSNLKSALKHAKKAQRLAPSLEGLSSMVTAFKILRVASK 62
           T  + E EA RLK IAETKF NSNLKSALKHAKKA RL+P LEGLSSM+TA K LRVASK
Sbjct: 2   TKADQEEEARRLKTIAETKFTNSNLKSALKHAKKAHRLSPKLEGLSSMLTALKTLRVASK 61

Query: 63  SK-----EWYQILQVEPFSHINTIKKQYKKLALILHPDKNPHSGSEEAFKLVGEAFRVLS 117
           ++     +WY+ILQVEPFSH+N+IKKQYKKLAL+LHPDKNP  G EEAFKLV E FRVLS
Sbjct: 62  TQNSDITDWYKILQVEPFSHMNSIKKQYKKLALVLHPDKNPFLGCEEAFKLVAEGFRVLS 121

Query: 118 DKVRRKEYDMRLRIKIQDEKVALDDNDDGFAGKETFWTACSRCRLLHQFERKYLDQILVC 177
           DK+RRKEYD+RLRI++QDE+V+  DN    +  ETFWTACSRCRLLHQFER+YL   LVC
Sbjct: 122 DKIRRKEYDLRLRIRLQDERVS--DN----SAVETFWTACSRCRLLHQFERQYLGHNLVC 175

Query: 178 PGCKMSFEAVEAKESNAVRVFRSGRLSEKMGSADLKTKMGNVGLKRKTVSGDTKMKGSAG 237
           P CK SFEAVE K  +                 D +  + +  L+RK + G      S+G
Sbjct: 176 PSCKKSFEAVEVKGGD---------------KKDAEVGVWSERLRRKDIGGKGIGGLSSG 220

Query: 238 SGVDGESGDSRKEMGGGRGDWGGGRLRRRTSSVGEVLARSKPKLVEDREESMTLAEMQLE 297
            GV   S  SR+E+       GG  L+    S                +E+MTLAEM+LE
Sbjct: 221 EGV---SAGSRRELDAESA--GGVNLKGNEFS----------------DETMTLAEMKLE 259

Query: 298 AKRRANQAKLKFKLKEKEMEKRGKKEKKREKEIERHRALKNKDLEVEGQQAAERIVDLEN 357
           AK++A+Q   K +LKEK+ +   K++KK ++++      K K    E      +  DLE 
Sbjct: 260 AKKKASQ---KVELKEKQKDVGEKEKKKEKQKVMEKGKGKGK----ETCLVLNKSTDLET 312

Query: 358 ENGVLAKKIVDLRTKKRRTVKKTEDLQIVRQETLKKSVDLVIERHKTSKTKDLEIMAVED 417
           E G  +KK  D   K R  VK +  ++I+RQ   KKS  L +ERHK S+  DL+ MAVE 
Sbjct: 313 EKGGASKKSGDTEIKTREGVKTSRKMEIMRQGASKKSASLQMERHKNSRG-DLDSMAVEY 371

Query: 418 SDFYDFDRDRMERSFKKGQVWAIYDDDDGMPRHYGLIDEV-SVNPFEVKISWLDLQSNGD 476
           S+F+DFD DR+ER FKKGQVWAIYDDD GMPRHYGLIDEV SVNPF+V +SWLDLQ  GD
Sbjct: 372 SNFFDFDSDRVERRFKKGQVWAIYDDD-GMPRHYGLIDEVVSVNPFKVNLSWLDLQRYGD 430

Query: 477 EGLICWEKQGFHVSCGRFKVSRKTSIDSLNIFSHIVECERAAREVYRIFPTKGSVWALYN 536
           E LI WEK G HVSCGRFKV+R   IDS+NIFSH VECER AREVYRI+P KGSVWALYN
Sbjct: 431 EVLI-WEKMGLHVSCGRFKVARTMIIDSVNIFSHAVECEREAREVYRIYPKKGSVWALYN 489

Query: 537 EAALGIEGSNLSARDRRSYDIVVLLTTYSEMHGLSMAYLEKVDGFKAVFKRREIGCHAIR 596
           +A LG EG NLSA D R +DIVVLLTTYSEMHGLSMA LEKVDG+K VFKRREIGCHA+R
Sbjct: 490 KATLGAEGRNLSASDERCHDIVVLLTTYSEMHGLSMASLEKVDGYKTVFKRREIGCHAVR 549

Query: 597 WLEKDDVRLFSHQIPARKLTGDEIPDSLKDCWELDPASLPSDLLT 641
            LEKDD+ LFSHQIP+RK +GDE+ D+LKDCWELDPASLPS+LLT
Sbjct: 550 LLEKDDIWLFSHQIPSRKFSGDEVADNLKDCWELDPASLPSNLLT 594

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255587876|ref|XP_002534425.1| conserved hypothetical protein [Ricinus communis] gi|223525316|gb|EEF27959.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449456907|ref|XP_004146190.1| PREDICTED: uncharacterized protein LOC101207675 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449509530|ref|XP_004163615.1| PREDICTED: uncharacterized LOC101207675 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356497631|ref|XP_003517663.1| PREDICTED: uncharacterized protein LOC100813361 [Glycine max] Back     alignment and taxonomy information
>gi|334184703|ref|NP_181097.2| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|330254025|gb|AEC09119.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3608134|gb|AAC36167.1| putative DnaJ protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225427087|ref|XP_002275738.1| PREDICTED: uncharacterized protein LOC100264257 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297823347|ref|XP_002879556.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325395|gb|EFH55815.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297742027|emb|CBI33814.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query646
TAIR|locus:2163786726 AT5G53150 [Arabidopsis thalian 0.366 0.326 0.408 5e-76
TAIR|locus:2051244706 AT2G05230 [Arabidopsis thalian 0.354 0.324 0.399 3e-68
TAIR|locus:2051274706 AT2G05250 [Arabidopsis thalian 0.354 0.324 0.399 3e-68
TAIR|locus:2040110656 AT2G25560 [Arabidopsis thalian 0.337 0.332 0.424 1.1e-65
TAIR|locus:2081046673 AT3G06340 [Arabidopsis thalian 0.447 0.429 0.281 1.6e-52
TAIR|locus:2181261 1104 AT5G27240 [Arabidopsis thalian 0.373 0.218 0.346 2.6e-52
TAIR|locus:2180024 884 AT5G18750 [Arabidopsis thalian 0.360 0.263 0.330 7e-52
TAIR|locus:2114880 1165 AT3G04980 [Arabidopsis thalian 0.249 0.138 0.403 2.3e-50
TAIR|locus:504954888485 AT5G50115 [Arabidopsis thalian 0.134 0.179 0.444 5.2e-34
TAIR|locus:2169170431 AT5G37380 [Arabidopsis thalian 0.224 0.336 0.431 3.3e-30
TAIR|locus:2163786 AT5G53150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 461 (167.3 bits), Expect = 5.0e-76, Sum P(3) = 5.0e-76
 Identities = 102/250 (40%), Positives = 153/250 (61%)

Query:   391 LKKSVDLVIERHKTSKTKDLEIMAVEDSDFYDFDRDRMERSFKKGQVWAIYDDDDGMPRH 450
             +++SV+++   H++ + K++    V DSDF++FD DR E +FK  Q+WA YDD DGMPR 
Sbjct:   431 VERSVEVI--PHESDEVKEI---VVPDSDFHNFDLDRSESAFKDDQIWAAYDDADGMPRF 485

Query:   451 YGLIDEV-SVNPFEVKISWLDLQSNGDEGLICWEKQGFHVSCGRFKVSRKTSIDSLNIFS 509
             Y  I +V SVNPF++KISWL+ ++  + G I W   GF  SCG F+  R  S D+LN FS
Sbjct:   486 YARIQKVISVNPFKLKISWLNSKTTSEFGPIDWMGAGFAKSCGDFRCGRYESTDTLNAFS 545

Query:   510 HIVECERAAREVYRIFPTKGSVWALYNEAALGIEGSNLSARDRRSYDIVVLLTTYSEM-H 568
             H V+  + AR +  I P KG VWALY   +   +  N     +  Y++V +L  Y+E   
Sbjct:   546 HSVDFTKGARGLLHILPKKGQVWALYRNWSPEWD-KNTPDEVKHKYEMVEVLDDYTEDDQ 604

Query:   569 GLSMAYLEKVDGFKAVFKR--REIGCHAIRWLEKDDVRLFSHQIPARKLTGDEIPDSLKD 626
              L++A L K +GF+ VF+R   ++G   +R + K+++  FSHQ+P   LTG E  ++ + 
Sbjct:   605 SLTVALLLKAEGFRVVFRRCTEKLG---VRKIAKEEMLRFSHQVPHYILTGKEADNAPEG 661

Query:   627 CWELDPASLP 636
               ELDPA+ P
Sbjct:   662 FLELDPAATP 671
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
TAIR|locus:2051244 AT2G05230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051274 AT2G05250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040110 AT2G25560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081046 AT3G06340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181261 AT5G27240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180024 AT5G18750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114880 AT3G04980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504954888 AT5G50115 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169170 AT5G37380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.III.1044.1
hypothetical protein (594 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query646
pfam11926218 pfam11926, DUF3444, Domain of unknown function (DU 1e-80
pfam0022663 pfam00226, DnaJ, DnaJ domain 6e-21
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 1e-16
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 3e-15
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 7e-14
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 9e-14
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 3e-12
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 6e-12
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 8e-12
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 4e-11
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 6e-11
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 6e-11
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 6e-11
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 2e-10
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 3e-10
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 3e-10
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 5e-10
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 7e-10
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 9e-10
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 9e-10
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 1e-09
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 1e-09
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 2e-09
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-09
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 4e-09
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 1e-08
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 1e-08
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-08
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 3e-08
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-08
PTZ00037421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 8e-08
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 2e-07
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 4e-07
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 8e-07
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 2e-06
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-06
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 4e-06
COG5407610 COG5407, SEC63, Preprotein translocase subunit Sec 1e-04
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 0.003
>gnl|CDD|221319 pfam11926, DUF3444, Domain of unknown function (DUF3444) Back     alignment and domain information 
 Score =  254 bits (650), Expect = 1e-80
 Identities = 91/217 (41%), Positives = 139/217 (64%), Gaps = 4/217 (1%)

Query: 405 SKTKDLEIMAVEDSDFYDFDRDRMERSFKKGQVWAIYDDDDGMPRHYGLIDEV-SVNPFE 463
           + +     + V D DF+DFD+DR E SF  GQ+WA+YDDDDGMPR+Y  I +V SV PF+
Sbjct: 2   NSSDSPNEIDVPDPDFHDFDKDRSESSFAVGQIWALYDDDDGMPRYYARIKKVLSVPPFK 61

Query: 464 VKISWLDLQSNGDEGLICWEKQGFHVSCGRFKVSRKTSIDSLNIFSH-IVECERAAREVY 522
           ++I+WL+ + + +E  I W  +G  VSCG+FK+ +   I+S+N+FSH +V  ++  R  Y
Sbjct: 62  LRITWLEPKPDSEEE-IDWVDEGLPVSCGKFKLGKTEEIESVNMFSHQVVPEKKGRRGEY 120

Query: 523 RIFPTKGSVWALYNEAALGIEGSNLSARDRRSYDIVVLLTTYSEMHGLSMAYLEKVDGFK 582
            I+P KG +WALY   +          +    Y+IV +L+ Y++  G+S+A L KV+GF 
Sbjct: 121 EIYPRKGEIWALYKNWSPDWNADTPD-KKTYEYEIVEVLSDYTDEAGISVAPLVKVEGFV 179

Query: 583 AVFKRREIGCHAIRWLEKDDVRLFSHQIPARKLTGDE 619
           +VFKR   G  A   + K+++  FSHQ+P+ +LTG+E
Sbjct: 180 SVFKRDLQGGIATITIPKEEMLRFSHQVPSFRLTGEE 216

This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 210 amino acids in length. This domain is found associated with pfam00226. This domain has two conserved sequence motifs: FSH and FSH. Length = 218
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 646
PF11926217 DUF3444: Domain of unknown function (DUF3444); Int 100.0
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.8
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
PRK14288369 chaperone protein DnaJ; Provisional 99.67
PRK14296372 chaperone protein DnaJ; Provisional 99.67
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.66
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.65
PRK14279392 chaperone protein DnaJ; Provisional 99.62
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.61
PRK14286372 chaperone protein DnaJ; Provisional 99.61
PRK14287371 chaperone protein DnaJ; Provisional 99.6
PRK14283378 chaperone protein DnaJ; Provisional 99.6
PRK14276380 chaperone protein DnaJ; Provisional 99.6
PRK14299291 chaperone protein DnaJ; Provisional 99.59
PTZ00037421 DnaJ_C chaperone protein; Provisional 99.59
PRK14298377 chaperone protein DnaJ; Provisional 99.59
PRK14291382 chaperone protein DnaJ; Provisional 99.59
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.58
PRK14280376 chaperone protein DnaJ; Provisional 99.58
PRK14278378 chaperone protein DnaJ; Provisional 99.57
KOG0717508 consensus Molecular chaperone (DnaJ superfamily) [ 99.57
PRK14282369 chaperone protein DnaJ; Provisional 99.57
PRK14285365 chaperone protein DnaJ; Provisional 99.57
PRK14277386 chaperone protein DnaJ; Provisional 99.56
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.56
PRK14295389 chaperone protein DnaJ; Provisional 99.56
PRK14294366 chaperone protein DnaJ; Provisional 99.55
PRK14284391 chaperone protein DnaJ; Provisional 99.55
KOG0718546 consensus Molecular chaperone (DnaJ superfamily) [ 99.55
PRK14301373 chaperone protein DnaJ; Provisional 99.54
PRK14297380 chaperone protein DnaJ; Provisional 99.54
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.54
PRK10767371 chaperone protein DnaJ; Provisional 99.53
PRK14281397 chaperone protein DnaJ; Provisional 99.52
PRK14300372 chaperone protein DnaJ; Provisional 99.52
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.52
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.52
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.52
PRK14292371 chaperone protein DnaJ; Provisional 99.51
PTZ003411136 Ring-infected erythrocyte surface antigen; Provisi 99.51
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.5
PRK14293374 chaperone protein DnaJ; Provisional 99.5
PRK14290365 chaperone protein DnaJ; Provisional 99.49
PRK14289386 chaperone protein DnaJ; Provisional 99.48
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.46
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.43
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.42
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.37
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.35
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.34
PRK05014171 hscB co-chaperone HscB; Provisional 99.28
PHA03102153 Small T antigen; Reviewed 99.27
PRK01356166 hscB co-chaperone HscB; Provisional 99.25
PRK00294173 hscB co-chaperone HscB; Provisional 99.19
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.19
PRK03578176 hscB co-chaperone HscB; Provisional 99.18
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.03
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.01
PTZ00100116 DnaJ chaperone protein; Provisional 98.96
PHA02624647 large T antigen; Provisional 98.86
PRK01773173 hscB co-chaperone HscB; Provisional 98.77
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.77
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.66
COG5407610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.63
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.51
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 97.72
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 97.66
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 96.82
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 96.49
KOG0431453 consensus Auxilin-like protein and related protein 96.3
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.91
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 93.66
PF11926217 DUF3444: Domain of unknown function (DUF3444); Int 93.63
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 91.43
PF0520755 zf-CSL: CSL zinc finger; InterPro: IPR007872 Zinc 90.22
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 89.52
PF1371937 zinc_ribbon_5: zinc-ribbon domain 86.9
KOG292367 consensus Uncharacterized conserved protein [Funct 85.96
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 85.31
PF1342844 TPR_14: Tetratricopeptide repeat 85.02
PF1371736 zinc_ribbon_4: zinc-ribbon domain 83.4
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 82.02
>PF11926 DUF3444: Domain of unknown function (DUF3444); InterPro: IPR024593 This entry represents an uncharacterised domain Back     alignment and domain information 
Probab=100.00  E-value=5.7e-84  Score=645.49  Aligned_cols=212  Identities=48%  Similarity=0.814  Sum_probs=198.8

Q ss_pred             CCCcceeccCCCCCCCcCcccccCCCCCCEEEEecCCCCCccceeEEEEE-ecCCcEEEEEeeccCCCCCccccceecCC
Q 006401          408 KDLEIMAVEDSDFYDFDRDRMERSFKKGQVWAIYDDDDGMPRHYGLIDEV-SVNPFEVKISWLDLQSNGDEGLICWEKQG  486 (646)
Q Consensus       408 ~~~~~~~~pd~dF~dFd~~R~~~~F~~gQIWA~Yd~~DgmPR~Ya~I~kV-~~~~fkl~i~wLe~~~~~~~~~~~W~~~~  486 (646)
                      ..+..|+||||||||||++|++++|++|||||+||+.||||||||||+|| +.+||+|||+|||++++ .+.+++|++++
T Consensus         4 ~~~~~~~~pd~dF~dF~~~R~~~~F~~gQIWAlYd~~D~mPR~Ya~I~kV~~~~~Fkl~i~wLe~~~~-~e~~~~w~~~~   82 (217)
T PF11926_consen    4 SSPSSIDVPDPDFYDFDKDRSEEKFQVGQIWALYDDDDGMPRYYARIKKVDSSNPFKLHITWLEPCPD-SEEEIRWEDEG   82 (217)
T ss_pred             CCCCcccCCCcccccccCCchHHhCCCCCEEEEeeCCCCCeeeEEEEEEEecCCCeEEEEEEccccCC-cccceeeeecC
Confidence            44788999999999999999999999999999999999999999999999 55699999999999988 45599999999


Q ss_pred             ceeeeeeEEeCceeeeccCCceEEEEEE-EEcCCceEEEeCCCCcEeEEecCCCCCCCCCCcCCCCCcceeEEEEecccc
Q 006401          487 FHVSCGRFKVSRKTSIDSLNIFSHIVEC-ERAAREVYRIFPTKGSVWALYNEAALGIEGSNLSARDRRSYDIVVLLTTYS  565 (646)
Q Consensus       487 ~pv~CG~F~~~~~~~~~~~~~FSH~v~~-~~~~~~~~~IyPrkGevWAlyk~W~~~w~~~~~~~~~~~~y~iVEvL~d~~  565 (646)
                      |||+||+|++|+++++.++++|||+|.+ ..+.|+.|+|||||||||||||||+++|+.+ ++++..|+|||||||+||+
T Consensus        83 ~pvsCG~Fk~~~~~~~~~~~~FSH~v~~~~~~~~~~y~IyPrkGEvWAlYknW~~~w~~~-~~~~~~~~YdiVEVl~d~~  161 (217)
T PF11926_consen   83 LPVSCGTFKVGKTEEIDDPNMFSHQVVPWTSGKRNEYEIYPRKGEVWALYKNWSPDWSSS-TDDERKYEYDIVEVLSDYS  161 (217)
T ss_pred             CceEEEEEEeCCEEEeccCCcEEEEEEEeecCCCceEEEeCCcccEeEEecCCCCCCCcC-cCcCcccceEEEEEeecCC
Confidence            9999999999999999999999999965 5577899999999999999999999999966 4789999999999999999


Q ss_pred             cCceeEEEEeeecCCccceeeecccCCcceEEeecCCccccccccCceeecCCCCC
Q 006401          566 EMHGLSMAYLEKVDGFKAVFKRREIGCHAIRWLEKDDVRLFSHQIPARKLTGDEIP  621 (646)
Q Consensus       566 ~~~g~~v~~L~kv~Gf~svF~~~~~~~~~~~~Ip~~e~~rFSHqIPs~~ltg~E~~  621 (646)
                      ++.||.|+||+||+||+|||++...+...++.||++||+|||||||||||||+|++
T Consensus       162 ~~~gi~V~~L~Kv~Gf~svF~~~~~~~~~~~~Ip~~E~~RFSHqIPa~rltgee~e  217 (217)
T PF11926_consen  162 EEAGIKVAPLVKVKGFKSVFKRAEEGGEAVFTIPKSELLRFSHQIPAFRLTGEEGE  217 (217)
T ss_pred             ccCcEEEEEEEEecCcEeeeeecCCCCcceEEEChHHcCeeeccCCCEEccCccCC
Confidence            99999999999999999999998776668999999999999999999999998863

This domain is found in DnaJ, cytosine-specific methyltransferases, and members from the zinc finger, C3HC4 type family.
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11926 DUF3444: Domain of unknown function (DUF3444); InterPro: IPR024593 This entry represents an uncharacterised domain Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF05207 zf-CSL: CSL zinc finger; InterPro: IPR007872 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>KOG2923 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query646
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 2e-10
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 3e-09
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 4e-09
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 5e-09
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 1e-08
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 6e-08
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 6e-08
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 7e-08
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 7e-08
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 8e-08
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 6e-07
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 1e-06
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 2e-06
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 2e-06
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 3e-06
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 3e-06
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 3e-06
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 5e-06
2ys8_A90 Solution Structure Of The Dnaj-Like Domain From Hum 1e-05
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 2e-05
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 2e-05
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 4e-05
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%)
Query: 63  SKEWYQILQVEPFSHINTIKKQYKKLALILHPDKNPHSGSEEAFKLVGEAFRVLSDKVRR 122
           S ++Y+IL V   +    +KK Y++LAL  HPDKN   G+ EAFK +G A+ VLS+  +R
Sbjct: 6   SGDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKR 65
Query: 123 KEYDM 127
           K+YD 
Sbjct: 66  KQYDQ 70
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query646
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 1e-19
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 9e-18
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 1e-16
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 7e-16
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 1e-15
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 1e-15
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 2e-15
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-15
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 3e-15
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 5e-15
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 6e-15
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 2e-14
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 2e-14
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 3e-14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-14
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 4e-14
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 6e-14
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 6e-14
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 9e-14
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 1e-13
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 3e-13
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 5e-13
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 7e-13
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 6e-12
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 8e-12
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 8e-11
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 2e-09
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 3e-08
2guz_A71 Mitochondrial import inner membrane translocase su 2e-07
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 3e-07
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 6e-07
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 6e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-04
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 2e-04
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
 Score = 83.2 bits (206), Expect = 1e-19
 Identities = 24/65 (36%), Positives = 37/65 (56%)

Query: 62  KSKEWYQILQVEPFSHINTIKKQYKKLALILHPDKNPHSGSEEAFKLVGEAFRVLSDKVR 121
            SK+ + +L V+P +  + + K Y+KLA++LHPDK    GSE+AFK V  A   L   ++
Sbjct: 25  NSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK 84

Query: 122 RKEYD 126
                
Sbjct: 85  SGPSS 89
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query646
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.89
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.73
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.72
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.71
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.71
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.7
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.7
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.7
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.69
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.69
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.68
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.67
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.67
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.66
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.65
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.64
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.64
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.63
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.57
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.55
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.54
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.53
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.5
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.5
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.49
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.49
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.48
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.47
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.46
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.46
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.43
2guz_A71 Mitochondrial import inner membrane translocase su 99.38
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.36
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.26
2guz_B65 Mitochondrial import inner membrane translocase su 98.25
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 95.04
2jr7_A89 DPH3 homolog; DESR1, CSL zinc finger, metal bindin 87.0
1yop_A83 KTI11P; zinc finger, metal binding protein; NMR {S 85.62
1wge_A83 Hypothetical protein 2610018L09RIK; diphthamide,CS 84.79
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 84.02
2l6j_A111 TPR repeat-containing protein associated with HSP; 80.96
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
Probab=99.89  E-value=1.1e-23  Score=200.31  Aligned_cols=126  Identities=25%  Similarity=0.560  Sum_probs=102.5

Q ss_pred             CCcChhhhhcCCCCCCHHHHHHHHHHhHHhhCCCCCCCCc-------hHHHHHHHHHHHHHhcCchhhHHHHHHhhhhhc
Q 006401           62 KSKEWYQILQVEPFSHINTIKKQYKKLALILHPDKNPHSG-------SEEAFKLVGEAFRVLSDKVRRKEYDMRLRIKIQ  134 (646)
Q Consensus        62 ~~~d~Y~ILgV~~~As~~eIKkaYrklal~~HPDKn~~~~-------a~~~F~~I~eAy~vLsDp~kR~~YD~~~~~~~~  134 (646)
                      ...|||+||||+++|+.++||++||+|++++||||++...       +.+.|+.|++||++|+||.+|+.||..+.....
T Consensus         8 ~~~~~y~iLgv~~~a~~~eIk~aYr~l~~~~HPDk~~~~~~~~~~~~a~~~f~~i~~Ay~~L~dp~~R~~Yd~~~~~~~~   87 (155)
T 2l6l_A            8 PKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDL   87 (155)
T ss_dssp             CCSHHHHHHTCCTTCCHHHHHHHHHHHHHHHSCCCCCCCCTTHHHHHHHHHHHHHHHHHHHSSSHHHHCHHHHHHHHHHH
T ss_pred             CCCChhHhcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCCCchhHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHcchhhc
Confidence            4679999999999999999999999999999999998764       568999999999999999999999988864322


Q ss_pred             cc------ccccCCCCCCCCCccceeeeccccchhhHHHHhhcc--ceeecCCCCCceeeeec
Q 006401          135 DE------KVALDDNDDGFAGKETFWTACSRCRLLHQFERKYLD--QILVCPGCKMSFEAVEA  189 (646)
Q Consensus       135 ~~------~~~~~~~~~~~~~~~tFwt~C~~C~~~yey~r~y~~--~~l~C~~C~~~f~A~e~  189 (646)
                      ..      .+.++.... .....+||+.| +||+.|+|.+..++  ..+.|++|++.|.++-.
T Consensus        88 ~~~~~~~~~~~~~~m~~-~e~~~~f~~~C-rCG~~f~i~~~~l~~~~~v~C~sCSl~~~v~~~  148 (155)
T 2l6l_A           88 RNVGPVDAQVYLEEMSW-NEGDHSFYLSC-RCGGKYSVSKDEAEEVSLISCDTCSLIIELLHY  148 (155)
T ss_dssp             HTTCSSSEEEETTTSEE-ETTTTEEEEEC-SSSCEEEEETTHHHHCCEEECSSSSCEEEEECC
T ss_pred             cccccccceeeHHHhcc-ccCCcEEEEcC-CCCCeEEecHHHhCCCCEEECCCCceEEEEEEc
Confidence            21      111111111 12346899999 59999999998887  78999999999988643
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2jr7_A DPH3 homolog; DESR1, CSL zinc finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1yop_A KTI11P; zinc finger, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: g.41.17.1 PDB: 1yws_A Back     alignment and structure
>1wge_A Hypothetical protein 2610018L09RIK; diphthamide,CSL zinc finger, ADP-ribosylating toxin, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.17.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 646
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 3e-11
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 6e-11
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 2e-10
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 8e-10
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 2e-09
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 4e-09
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 6e-07
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 5e-06
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 58.1 bits (140), Expect = 3e-11
 Identities = 21/75 (28%), Positives = 44/75 (58%), Gaps = 7/75 (9%)

Query: 61  SKSKEWYQILQVEPFSHINTIKKQYKKLALILHPDKNPHSGSEEA-------FKLVGEAF 113
           +  K+WY IL  +P ++++ +K++Y+KL L+ HPDK                F  + +A+
Sbjct: 13  TLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAW 72

Query: 114 RVLSDKVRRKEYDMR 128
           ++L ++  +K+YD++
Sbjct: 73  KILGNEETKKKYDLQ 87
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query646
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.77
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.71
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.62
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.59
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.51
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.42
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.38
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 86.24
d1wgea170 DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus 84.88
d1ywsa182 Diphthamide biosynthesis protein 3, DPH3 {Baker's 84.55
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 83.31
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.77  E-value=2.2e-19  Score=149.25  Aligned_cols=70  Identities=36%  Similarity=0.606  Sum_probs=64.3

Q ss_pred             CcChhhhhcCCCCCCHHHHHHHHHHhHHhhCCCCCCCC-chHHHHHHHHHHHHHhcCchhhHHHHHHhhhh
Q 006401           63 SKEWYQILQVEPFSHINTIKKQYKKLALILHPDKNPHS-GSEEAFKLVGEAFRVLSDKVRRKEYDMRLRIK  132 (646)
Q Consensus        63 ~~d~Y~ILgV~~~As~~eIKkaYrklal~~HPDKn~~~-~a~~~F~~I~eAy~vLsDp~kR~~YD~~~~~~  132 (646)
                      ..|||+||||+++||.++||+|||+|++++|||+++.. .+++.|..|++||+||+||.+|..||..+..+
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~   72 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAA   72 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSS
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccc
Confidence            47999999999999999999999999999999999864 47788999999999999999999999887543
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ywsa1 g.41.17.1 (A:1-82) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure