Citrus Sinensis ID: 006427

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-----
MMSRKSTSFSISVPYDIQNNSPCNVKVMSHESPVIPIGVEPAEIAYEGEDEHEETSSIKRDFSDLDLQAHDANVGKEEFDLRNTKSDYFTTASPEVNAQSVNGAEKDAKKGIDMIQSGHLSDPGVGRTEFWASPKLKRSCSNLESRLVLNKLTDRLPPSKSQSFEELQELSEKVRENYHSGSPMSVTSHFSADRVMLKKHSSSQILPSRSRRLWWKLFLWSHRNLHKPWILKPQPHRAVVLNQQGGYTSDTLEPNQATKLSKTESPGSCTGESLNKGCNGSYNEDRQSWDGFQNEVSAVWPQRQWVAFPAESSSFKRVDEWVKDLGMETPFEDDEVAEGVIFPPSPETGKSPARSTAHLTRRSEINLSEEILHANSVIRSLNSSSAVAHIAGIGLKAIPTISHFSSLRSVNLSNNFIVHIPTGSMPKGLHTLNLSRNKINTIEGLREMTRLRVLDLSYNRIFRIGHGLSNCTLIKELYLAGNKISDIEGLHRLLKLTVLDMSFNKITTTKALGQLVANYQSLLALNLLGNPIQSNISDDQLRKAVCSLLPKLVYLNKQPIKPQRARELLTDSIAKAVLGNSSQSSQRKAVKRTGRSGSLPSSNQRSSTSIGQRSRSKSKTRNHSHLASKTVVSKMVSSAQASSSR
cccccccEEEEEEcccccccccccEEEEEccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccHHHHccccccccccccccccccEEEHHcccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccHHHHHHccccccEEEcccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHcccccHHHcccc
ccccccEEEEEEccccccccccccEEEEEEccccccccccEEEEEccccccccccccHcHcccccEEEEccccccccccccccccccccccccccccHHHccccccHHHcccccccccccccccccccccccccHHccccccccccccccccccccccccccccHHHHcccccccccccccccccEEccccccHHHEcccccccccccHHHHHHHHHHHHHHHHccccccccccccccccHccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHccccccccccHHHHHHHccccccccccccHcccccccHHHHccccHHHHHHHHcHcccccHHHHHHHHHccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccccHHHcccccccEEEccccccccccccHHHcccccEEEcccccccccHHHcccccccEEEcccccccccHHHcccHHHcccccEEEcccccHHccccHHHHHHEEEEEccccEEccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccccccccccccccccccccccc
mmsrkstsfsisvpydiqnnspcnvkvmshespvipigvepaeiayegedeheetssikrdfsdldlqahdanvgkeefdlrntksdyfttaspevnaqsvngaekdakkgidmiqsghlsdpgvgrtefwaspklkrscsnlESRLVLNKltdrlppsksqsFEELQELSEKVRenyhsgspmsvtshfsADRVMLkkhsssqilpsrsRRLWWKLFLWSHrnlhkpwilkpqphravvlnqqggytsdtlepnqatklsktespgsctgeslnkgcngsynedrqswdgfqnevsavwpqrqwvafpaesssfkrVDEWVKDlgmetpfeddevaegvifppspetgksparstahltrrseinlseeILHANSVIRSLNSSSAVAHIAGIGlkaiptishfsslrsvnlsnnfivhiptgsmpkglhtlnlsRNKINTIEGLREMTRLRVLdlsynrifrighglsncTLIKELYLagnkisdiEGLHRLLKLTVLDMSFNKITTTKALGQLVANYQSLLALNLlgnpiqsnisdDQLRKAVCSLLPklvylnkqpikpqRARELLTDSIAKAvlgnssqssQRKAVKrtgrsgslpssnqrsstsigqrsrsksktrnhshlASKTVVSKMVSsaqasssr
mmsrkstsfsisvpyDIQNNSPCNVKVMSHESPVIPIGVEPAEIAYEGEDEHEETSSIKRDFSDLDLQAHDAnvgkeefdlrnTKSDYFttaspevnaqsvnGAEKDAKKGIDMIQsghlsdpgvgRTEFWaspklkrscsnleSRLVLNkltdrlppsksqsFEELQELSEKVRENYHSGSPMSVTSHFSADRVMLKKhsssqilpsrsrRLWWKLFLWSHRNLHKPWILKPQPHRAVVLNQQGGYTSDTLEPNQatklsktespgsctgeslnKGCNGSYNEDRQSWDGFQNEVSAVWPQRQWVafpaesssfkrVDEWVKDLGMetpfeddevAEGVifppspetgksparstaHLTRRSEINLSEEILHANSVIRSLNSSSAVAHIAGIGLKAIPTISHFSSLRSVNLSNNFIVHIPTgsmpkglhtlnLSRNKINTIEGLREMTRLRVLDLSYNRIFRIGHGLSNCTLIKELYLAGNKISDIEGLHRLLKLTVLDMSFNKITTTKALGQLVANYQSLLALNLLGNPIQSNISDDQLRKAVCSLLPKlvylnkqpikpqRARELLTDSIAKavlgnssqssqrkavkrtgrsgslpssnqrsstsigqrsrsksktrnhshlasktvvskmvssaqasssr
MMSRKSTSFSISVPYDIQNNSPCNVKVMSHESPVIPIGVEPAEIAYEGEDEHEETSSIKRDFSDLDLQAHDANVGKEEFDLRNTKSDYFTTASPEVNAQSVNGAEKDAKKGIDMIQSGHLSDPGVGRTEFWASPKLKRSCSNLESRLVLNKLTDRLPPsksqsfeelqelsekVRENYHSGSPMSVTSHFSADRVMLKKHSSSQILPSRSRRLWWKLFLWSHRNLHKPWILKPQPHRAVVLNQQGGYTSDTLEPNQATKLSKTESPGSCTGESLNKGCNGSYNEDRQSWDGFQNEVSAVWPQRQWVAFPAESSSFKRVDEWVKDLGMETPFEDDEVAEGVIFPPSPETGKSPARSTAHLTRRSEINLSEEILHANSVIRSLNSSSAVAHIAGIGLKAIPTISHFSSLRSVNLSNNFIVHIPTGSMPKGLHTLNLSRNKINTIEGLREMTRLRVLDLSYNRIFRIGHGLSNCTLIKELYLAGNKISDIEGLHRLLKLTVLDMSFNKITTTKALGQLVANYQSLLALNLLGNPIQSNISDDQLRKAVCSLLPKLVYLNKQPIKPQRARELLTDSIAKAVLGNSSQSSQRKAVKRTGRSGSLPSSNQRSSTSIGQRSRSKSKTRNHSHLASKTvvskmvssaqasssR
*********************************************************************************************************************************FW*******************************************************************************RRLWWKLFLWSHRNLHKPWILKPQPHRAVVLN**********************************************WDGFQNEVSAVWPQRQWVAFPAESSSFKRVDEWVKDLGME******************************************ILHANSVIRSLNSSSAVAHIAGIGLKAIPTISHFSSLRSVNLSNNFIVHIPTGSMPKGLHTLNLSRNKINTIEGLREMTRLRVLDLSYNRIFRIGHGLSNCTLIKELYLAGNKISDIEGLHRLLKLTVLDMSFNKITTTKALGQLVANYQSLLALNLLGNPIQSNISDDQLRKAVCSLLPKLVYLNKQPI*************************************************************************************
***********SVPYDIQNNSPCNVKVMSHESPVIPIGVE**********************SDLDLQAHD********************************************************************************************************************************************RLWWKLFLWSHRNLHKPW**********************L*********************************************AVWPQRQWVAFPAESSSFKRVDEWVKDLGMETPFEDDEVAEGVI*******************RRSEINLSEEILHANSVIRSLNSSSAVAHIAGIGLKAIPTISHFSSLRSVNLSNNFIVHIPTGSMPKGLHTLNLSRNKINTIEGLREMTRLRVLDLSYNRIFRIGHGLSNCTLIKELYLAGNKISDIEGLHRLLKLTVLDMSFNKITTTKALGQLVANYQSLLALNLLGNPIQSNISDDQLRKAVCSLLPKLVYLNKQPIKPQRARELLTD**************************************************************************
**********ISVPYDIQNNSPCNVKVMSHESPVIPIGVEPAEIAYE**********IKRDFSDLDLQAHDANVGKEEFDLRNTKSDYFTTASPEVNAQSVNGAEKDAKKGIDMIQSGHLSDPGVGRTEFWASPKLKRSCSNLESRLVLNKLTDRLPPSKSQSFEELQELSEKVRENYHSGSPMSVTSHFSADRVM**********PSRSRRLWWKLFLWSHRNLHKPWILKPQPHRAVVLNQQGGYTSDTLEPN*****************SLNKGCNGSYNEDRQSWDGFQNEVSAVWPQRQWVAFPAESSSFKRVDEWVKDLGMETPFEDDEVAEGVIFPPSP*************TRRSEINLSEEILHANSVIRSLNSSSAVAHIAGIGLKAIPTISHFSSLRSVNLSNNFIVHIPTGSMPKGLHTLNLSRNKINTIEGLREMTRLRVLDLSYNRIFRIGHGLSNCTLIKELYLAGNKISDIEGLHRLLKLTVLDMSFNKITTTKALGQLVANYQSLLALNLLGNPIQSNISDDQLRKAVCSLLPKLVYLNKQPIKPQRARELLTDSIAKAVL*************************************************SKTV**************
*****STSFSISVPYDIQNNSPCNVKVMSHESPVIPIGVEPAEIAYEGE*******S*K*DFSDLDLQAHD*****************************************************VGRTEFW**********************************************************************SSQILPSRSRRLWWKLFLWSHRNLHK*************************************************************WDGFQNEVSAVWPQRQWVAFPAESSSFKRVDEWVKDLGMETPFEDDEVAEGVIFPPSPETGKSPARSTAHLTRRSEINLSEEILHANSVIRSLNSSSAVAHIAGIGLKAIPTISHFSSLRSVNLSNNFIVHIPTGSMPKGLHTLNLSRNKINTIEGLREMTRLRVLDLSYNRIFRIGHGLSNCTLIKELYLAGNKISDIEGLHRLLKLTVLDMSFNKITTTKALGQLVANYQSLLALNLLGNPIQSNISDDQLRKAVCSLLPKLVYLNKQPIKPQRARELLTDSIAKAVLGNSSQSSQRKAVKRTG****LPSSNQRSST*************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMSRKSTSFSISVPYDIQNNSPCNVKVMSHESPVIPIGVEPAEIAYEGEDEHEETSSIKRDFSDLDLQAHDANVGKEEFDLRNTKSDYFTTASPEVNAQSVNGAEKDAKKGIDMIQSGHLSDPGVGRTEFWASPKLKRSCSNLESRLVLNKLTDRLPPSKSQSFEELQELSEKVRENYHSGSPMSVTSHFSADRVMLKKHSSSQILPSRSRRLWWKLFLWSHRNLHKPWILKPQPHRAVVLNQQGGYTSDTLEPNQATKLSKTESPGSCTGESLNKGCNGSYNEDRQSWDGFQNEVSAVWPQRQWVAFPAESSSFKRVDEWVKDLGMETPFEDDEVAEGVIFPPSPETGKSPARSTAHLTRRSEINLSEEILHANSVIRSLNSSSAVAHIAGIGLKAIPTISHFSSLRSVNLSNNFIVHIPTGSMPKGLHTLNLSRNKINTIEGLREMTRLRVLDLSYNRIFRIGHGLSNCTLIKELYLAGNKISDIEGLHRLLKLTVLDMSFNKITTTKALGQLVANYQSLLALNLLGNPIQSNISDDQLRKAVCSLLPKLVYLNKQPIKPQRARELLTDSIAKAVLGNSSQSSQRKAVKRTGRSGSLPSSNQRSSTSIGQRSRSKSKTRNHSHLASKTVVSKMVSSAQASSSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query645 2.2.26 [Sep-21-2011]
P45969326 Uncharacterized protein T yes no 0.182 0.361 0.383 9e-12
Q9D2H9 634 Dynein assembly factor 1, yes no 0.227 0.231 0.3 1e-11
Q6AYH9 633 Dynein assembly factor 1, yes no 0.227 0.232 0.3 2e-11
B6D5P3 622 Dynein assembly factor 1, N/A no 0.227 0.236 0.294 3e-11
B6D5P1 622 Dynein assembly factor 1, N/A no 0.227 0.236 0.294 3e-11
Q54Q39336 Protein phosphatase 1 reg yes no 0.196 0.377 0.351 4e-11
B6D5P6 622 Dynein assembly factor 1, N/A no 0.227 0.236 0.294 4e-11
Q8NEP3 725 Dynein assembly factor 1, yes no 0.288 0.256 0.259 5e-11
Q4R6X9 523 Leucine-rich repeat-conta N/A no 0.235 0.290 0.350 6e-11
Q3SYS4 643 Dynein assembly factor 1, no no 0.285 0.286 0.253 2e-10
>sp|P45969|YNZ9_CAEEL Uncharacterized protein T09A5.9 OS=Caenorhabditis elegans GN=T09A5.9 PE=4 SV=1 Back     alignment and function desciption
 Score = 72.4 bits (176), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 68/120 (56%), Gaps = 2/120 (1%)

Query: 398 IPTISHFSSLRSVNLSNNFIVHI-PTGSMPKGLHTLNLSRNKINTIEGLREMTRLRVLDL 456
           IP ++ F  +  + + NN +V I PT S    L +L+L  N++  I  L  +  L  LDL
Sbjct: 51  IPDLTGFPKIEELRMRNNLLVSISPTISSLVTLTSLDLYENQLTEISHLESLVNLVSLDL 110

Query: 457 SYNRIFRIGHGLSNCTLIKELYLAGNKISDIEGLHRLLKLTVLDMSFNKITTTKALGQLV 516
           SYNRI +I +GL   T ++ LYL  NKI  IE L  L +L +L++  N+I   + +G LV
Sbjct: 111 SYNRIRQI-NGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIKKIENIGHLV 169

Caenorhabditis elegans (taxid: 6239)
>sp|Q9D2H9|DAAF1_MOUSE Dynein assembly factor 1, axonemal OS=Mus musculus GN=Dnaaf1 PE=2 SV=1 Back     alignment and function description
>sp|Q6AYH9|DAAF1_RAT Dynein assembly factor 1, axonemal OS=Rattus norvegicus GN=Dnaaf1 PE=2 SV=1 Back     alignment and function description
>sp|B6D5P3|DAAF1_PERLE Dynein assembly factor 1, axonemal OS=Peromyscus leucopus GN=Dnaaf1 PE=2 SV=1 Back     alignment and function description
>sp|B6D5P1|DAAF1_PERPL Dynein assembly factor 1, axonemal OS=Peromyscus polionotus GN=Dnaaf1 PE=2 SV=1 Back     alignment and function description
>sp|Q54Q39|PP1R7_DICDI Protein phosphatase 1 regulatory subunit pprA OS=Dictyostelium discoideum GN=pprA PE=3 SV=1 Back     alignment and function description
>sp|B6D5P6|DAAF1_PERCA Dynein assembly factor 1, axonemal OS=Peromyscus californicus GN=Dnaaf1 PE=2 SV=1 Back     alignment and function description
>sp|Q8NEP3|DAAF1_HUMAN Dynein assembly factor 1, axonemal OS=Homo sapiens GN=DNAAF1 PE=1 SV=5 Back     alignment and function description
>sp|Q4R6X9|LRC48_MACFA Leucine-rich repeat-containing protein 48 OS=Macaca fascicularis GN=LRRC48 PE=2 SV=1 Back     alignment and function description
>sp|Q3SYS4|DAAF1_BOVIN Dynein assembly factor 1, axonemal OS=Bos taurus GN=DNAAF1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query645
225459284685 PREDICTED: uncharacterized protein LOC10 0.951 0.896 0.707 0.0
147789010 774 hypothetical protein VITISV_009732 [Viti 0.933 0.777 0.686 0.0
255545744686 protein binding protein, putative [Ricin 0.945 0.889 0.652 0.0
302141965612 unnamed protein product [Vitis vinifera] 0.832 0.877 0.647 0.0
224084652602 predicted protein [Populus trichocarpa] 0.916 0.981 0.653 0.0
449437014674 PREDICTED: uncharacterized protein LOC10 0.947 0.906 0.616 0.0
449527887676 PREDICTED: uncharacterized LOC101212929 0.950 0.906 0.610 0.0
356508089670 PREDICTED: uncharacterized protein LOC10 0.947 0.911 0.605 0.0
224063241541 predicted protein [Populus trichocarpa] 0.820 0.977 0.679 0.0
356518469667 PREDICTED: uncharacterized protein LOC10 0.951 0.920 0.606 0.0
>gi|225459284|ref|XP_002285786.1| PREDICTED: uncharacterized protein LOC100252301 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/632 (70%), Positives = 505/632 (79%), Gaps = 18/632 (2%)

Query: 6   STSFSISVPYDIQNNSPCNVKVMSHESPVIPIGVEPAEIAYEGEDEHEETSSIKRDFSDL 65
           +TSFS+SVP+DI+ +S C VKVMSHESP   I  E  E+AYEGEDEHE+ SSIKR+ SD 
Sbjct: 55  TTSFSVSVPFDIKGSSTCKVKVMSHESP---IEGEAVEVAYEGEDEHEDNSSIKRELSDF 111

Query: 66  DLQAHDANVGKEEFDLRNTKSDYFTTASPEVNAQSVNGAEKDAKKGIDMIQSGHLSDPGV 125
           DLQ H AN G+EEF LR+   +Y  +   EVN Q  + AEKDA+KG+DMIQ+GH+SDPG+
Sbjct: 112 DLQTHVANAGEEEFQLRHRNMNYSDSFDIEVNGQFEDRAEKDAEKGVDMIQNGHVSDPGI 171

Query: 126 GRTEFWASPKLKRSCSNLESRLVLNKLTDRLPPSKSQSFEELQELSEKVRENY---HSGS 182
            + +FWASPKLKRSCSNLESR VL K+  +LPPSKS SFEELQ L++  RE+    + GS
Sbjct: 172 PKADFWASPKLKRSCSNLESRDVLKKIAGQLPPSKSHSFEELQGLADGAREDVFPRNPGS 231

Query: 183 PMSVTSHFSADRVMLKKHSSSQILPSRSRRLWWKLFLWSHRNLHKPWILKPQPHR-AVVL 241
           P SV S  SADRVMLKK SSSQ+LPSRSRRLWWKLFLWSHRNLHKPW  KP+P   A   
Sbjct: 232 PGSVLSRRSADRVMLKKRSSSQVLPSRSRRLWWKLFLWSHRNLHKPWTTKPRPLPIAAAF 291

Query: 242 NQQGGYTSDTLEPNQATKLSKTESPGSCTGESLNKGCNGSYNEDRQSWDGFQNEVSAVWP 301
           NQQGGY SDTLEPN+A +LS+ ESPGS TG         ++  D QSWDGF    S +WP
Sbjct: 292 NQQGGYCSDTLEPNRALQLSELESPGSFTG--------NNHPNDNQSWDGFHGRTSGLWP 343

Query: 302 QRQWVAFPAESSSFKRVDEWVKDLGMETPF---EDDEVAEGVIFPPSPETGKSPARSTAH 358
           Q  WVAF AESS F RVDEWVKDL  + P     DD   E +IFPPSPETG+SPARSTAH
Sbjct: 344 QNHWVAFSAESSPFARVDEWVKDLETQPPLPVDNDDNNVEDIIFPPSPETGRSPARSTAH 403

Query: 359 LTRRSEINLSEEILHANSVIRSLNSSSAVAHIAGIGLKAIPTISHFSSLRSVNLSNNFIV 418
           LTR    NLSEEILHANSVI+SLNSSS VAHI+GIGLK IPTISHFSSLRSVNLS+N+IV
Sbjct: 404 LTRHPNTNLSEEILHANSVIQSLNSSSTVAHISGIGLKVIPTISHFSSLRSVNLSSNYIV 463

Query: 419 HIPTGSMPKGLHTLNLSRNKINTIEGLREMTRLRVLDLSYNRIFRIGHGLSNCTLIKELY 478
           HI  GS+PKGLH LNLSRNKI+TIEGLRE+TRLRVLDLSYNRI RIGHGLSNCTLIKELY
Sbjct: 464 HITPGSLPKGLHILNLSRNKISTIEGLRELTRLRVLDLSYNRISRIGHGLSNCTLIKELY 523

Query: 479 LAGNKISDIEGLHRLLKLTVLDMSFNKITTTKALGQLVANYQSLLALNLLGNPIQSNISD 538
           LAGNKISD+E LHRLLKLTVLD+SFNKITTTK+LGQLVANY SLLALNLLGNPIQSNISD
Sbjct: 524 LAGNKISDVEALHRLLKLTVLDLSFNKITTTKSLGQLVANYNSLLALNLLGNPIQSNISD 583

Query: 539 DQLRKAVCSLLPKLVYLNKQPIKPQRARELLTDSIAKAVLGNSSQSSQRKAVKRTGRSGS 598
           DQ+RKAV SLLPKL YLNKQPIKPQRARE+ TDS+AKA LG S QSS+R+AVKR  + GS
Sbjct: 584 DQIRKAVGSLLPKLAYLNKQPIKPQRAREVATDSVAKAALGYSGQSSRRRAVKRVSQGGS 643

Query: 599 LPSSNQRSSTSIGQRSRSKSKTRNHSHLASKT 630
           L SS  RSS S+G +SR++SK+R H     KT
Sbjct: 644 LVSSGHRSSASVGHKSRTRSKSRTHHQSPLKT 675

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147789010|emb|CAN62584.1| hypothetical protein VITISV_009732 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255545744|ref|XP_002513932.1| protein binding protein, putative [Ricinus communis] gi|223547018|gb|EEF48515.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|302141965|emb|CBI19168.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224084652|ref|XP_002307375.1| predicted protein [Populus trichocarpa] gi|222856824|gb|EEE94371.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449437014|ref|XP_004136287.1| PREDICTED: uncharacterized protein LOC101212929 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449527887|ref|XP_004170940.1| PREDICTED: uncharacterized LOC101212929 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356508089|ref|XP_003522793.1| PREDICTED: uncharacterized protein LOC100813969 [Glycine max] Back     alignment and taxonomy information
>gi|224063241|ref|XP_002301057.1| predicted protein [Populus trichocarpa] gi|222842783|gb|EEE80330.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356518469|ref|XP_003527901.1| PREDICTED: uncharacterized protein LOC100810094 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query645
TAIR|locus:2032040681 AT1G78230 [Arabidopsis thalian 0.528 0.500 0.601 1.8e-112
TAIR|locus:2125507677 AT4G03260 [Arabidopsis thalian 0.479 0.456 0.474 9.4e-66
TAIR|locus:2176397 452 AT5G22320 [Arabidopsis thalian 0.398 0.568 0.304 1.9e-14
RGD|1308169360 Ppp1r7 "protein phosphatase 1, 0.258 0.463 0.327 3.7e-13
UNIPROTKB|Q15435360 PPP1R7 "Protein phosphatase 1 0.258 0.463 0.327 1.3e-12
DICTYBASE|DDB_G0284039336 pprA "Protein phosphatase 1 re 0.254 0.488 0.312 2e-12
ZFIN|ZDB-GENE-061103-349 513 lrrc48 "leucine rich repeat co 0.206 0.259 0.395 2.5e-12
MGI|MGI:1913635361 Ppp1r7 "protein phosphatase 1, 0.258 0.462 0.327 3.8e-12
UNIPROTKB|F1N0Q0 522 LRRC48 "Uncharacterized protei 0.229 0.283 0.359 4.3e-12
WB|WBGene00011637326 T09A5.9 [Caenorhabditis elegan 0.243 0.481 0.320 5.1e-12
TAIR|locus:2032040 AT1G78230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1001 (357.4 bits), Expect = 1.8e-112, Sum P(2) = 1.8e-112
 Identities = 216/359 (60%), Positives = 266/359 (74%)

Query:   281 SYNEDRQSWDG-FQNEVSAVWPQR-QWVAFPAESSSFKRVDEWVKDLGMET--PF-EDDE 335
             S+ E+  ++   F N+ S +WP   QWVAF AESSS KRVDEWV+ L +ET  P  ED +
Sbjct:   329 SHEEESTNYCADFTNQSSNLWPHHNQWVAFSAESSSMKRVDEWVRGLDVETVVPVNEDKD 388

Query:   336 VAEGVIFPPSPETGKSPARSTAHLTRRSEINLSEEILHANSVIRSLNSSSAVAHIAGIGL 395
             V    IFP SP T +SP  +          N+SE I+HANS+I+SL+ SS+VAHI+ IGL
Sbjct:   389 VL--AIFPTSPNTERSPLGNVVQSG-----NVSEAIVHANSLIQSLSKSSSVAHISSIGL 441

Query:   396 KAIPTISHFSSLRSVNLSNNFIVHIPTGSMPKGLHTLNLSRNKINTIEGLREMTRLRVLD 455
             KAIP+ISHF+SL+S++LSNNFIV I   S+PKGLH LNLS+NKI+ IEGLR++TRLRVLD
Sbjct:   442 KAIPSISHFTSLKSIDLSNNFIVQITPASLPKGLHALNLSKNKISVIEGLRDLTRLRVLD 501

Query:   456 LSYNRIFRIGHGLSNCTLIKELYLAGNKISDIEGLHRLLKLTVLDMSFNKITTTKALGQL 515
             LSYNRI RIG GLSNCTLIKELYLAGNKIS++EGLHRLLKL VLD+SFNKI TTKA+GQL
Sbjct:   502 LSYNRISRIGQGLSNCTLIKELYLAGNKISNVEGLHRLLKLIVLDLSFNKIATTKAIGQL 561

Query:   516 VANYQSLLALNLLGNPIQSNISDDQLRKAVCSLLPKLVYLNKQPIKPQRARELLTDSIAK 575
             VANY SL+ALN+LGNPIQ+N+ +DQLRK V SLLPKLVY NKQ IKPQRARE+L DS+A+
Sbjct:   562 VANYNSLVALNILGNPIQNNVGEDQLRKTVSSLLPKLVYHNKQLIKPQRAREVLKDSVAR 621

Query:   576 AVLGNSSQSSQRKAVKRTGRS---GSL-PSSNQRSSTSIGQRSRSKSKTRNHSHLASKT 630
             A  G       R+  KRT      GS  PS + R   + G+ S+++S+ +     A+ T
Sbjct:   622 AAFGGGDSLHHRR--KRTSTKSVVGSASPSVHHRGHIAKGRGSKNRSQRQLRKTSAAGT 678
GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005773 "vacuole" evidence=IDA
TAIR|locus:2125507 AT4G03260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176397 AT5G22320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1308169 Ppp1r7 "protein phosphatase 1, regulatory subunit 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q15435 PPP1R7 "Protein phosphatase 1 regulatory subunit 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284039 pprA "Protein phosphatase 1 regulatory subunit 7" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-349 lrrc48 "leucine rich repeat containing 48" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1913635 Ppp1r7 "protein phosphatase 1, regulatory (inhibitor) subunit 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N0Q0 LRRC48 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00011637 T09A5.9 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00015224001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (580 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query645
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-07
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 1e-06
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 2e-06
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 3e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 8e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information 
 Score = 62.7 bits (152), Expect = 2e-10
 Identities = 48/144 (33%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 398 IPTISHFSSLRSVNLSNNFIVHIPT--GSMPKGLHTLNLSRNKINTI-EGLREMTRLRVL 454
           I  +   ++L S++L NN I  IP   G +   L  L+LS NKI ++   LR +  L+ L
Sbjct: 109 ISELLELTNLTSLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNL 168

Query: 455 DLSYNRIFRIGHGLSNCTLIKELYLAGNKISDIEGLH-RLLKLTVLDMSFNKITTTKALG 513
           DLS+N +  +   LSN + +  L L+GNKISD+      L  L  LD+S N I       
Sbjct: 169 DLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDLSNNSIIELL--- 225

Query: 514 QLVANYQSLLALNLLGNPIQSNIS 537
             ++N ++L  L L  N ++    
Sbjct: 226 SSLSNLKNLSGLELSNNKLEDLPE 249

Length = 394
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 645
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.82
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.81
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.75
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.74
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.73
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.72
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.58
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.56
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.51
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.51
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.51
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.51
KOG0617264 consensus Ras suppressor protein (contains leucine 99.46
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.41
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.38
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.36
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.36
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.35
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.33
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.32
KOG4237498 consensus Extracellular matrix protein slit, conta 99.3
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.29
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.27
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.27
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.26
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.25
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.09
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.05
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.05
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.97
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.96
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.83
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.79
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.73
PLN03150623 hypothetical protein; Provisional 98.66
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.62
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.57
PLN03150623 hypothetical protein; Provisional 98.54
KOG2123 388 consensus Uncharacterized conserved protein [Funct 98.47
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.41
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.41
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.39
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.31
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.2
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.05
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.95
PRK15386426 type III secretion protein GogB; Provisional 97.92
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.91
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.9
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.87
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.7
PRK15386426 type III secretion protein GogB; Provisional 97.69
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.64
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.48
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.41
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.32
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.12
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.11
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.97
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.92
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.75
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.25
KOG4308478 consensus LRR-containing protein [Function unknown 93.97
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.86
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 93.64
KOG4308478 consensus LRR-containing protein [Function unknown 93.5
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.75
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.47
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.09
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 87.16
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.78
smart0037026 LRR Leucine-rich repeats, outliers. 85.78
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 85.37
KOG1947482 consensus Leucine rich repeat proteins, some prote 84.48
KOG1947482 consensus Leucine rich repeat proteins, some prote 83.67
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 81.16
smart0037026 LRR Leucine-rich repeats, outliers. 81.16
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=99.82  E-value=6.2e-20  Score=220.12  Aligned_cols=240  Identities=20%  Similarity=0.221  Sum_probs=188.1

Q ss_pred             CCCCCChhhhh-cccCCCEEecCCccccccchhhccCCCccEEEecCCCCC-cCC-CCCCCCCCCEEEccCCcCCCCCCC
Q 006427          347 ETGKSPARSTA-HLTRRSEINLSEEILHANSVIRSLNSSSAVAHIAGIGLK-AIP-TISHFSSLRSVNLSNNFIVHIPTG  423 (645)
Q Consensus       347 ~l~~~~~~sl~-~L~~L~~LdLS~n~l~~~~~l~~L~~~L~~L~Ls~N~Lt-~IP-sL~~L~~L~~LdLs~N~Lt~ip~~  423 (645)
                      .+.+.+|..+. .+.+|+.|+|++|.+.+..+. ...++|++|+|++|.++ .+| .++.+++|++|+|++|.+.+..+.
T Consensus       104 ~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~-~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~  182 (968)
T PLN00113        104 QLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR-GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPN  182 (968)
T ss_pred             ccCCcCChHHhccCCCCCEEECcCCccccccCc-cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCCh
Confidence            34434444444 888888888888887654333 23478889999999887 566 588889999999999988765444


Q ss_pred             CCC--CCCCEEecCCCCCCCC-c-CCCCCCCCcEEEccCCccc-cccCcCcCCCCCcEEEccCCCCCCc--ccccCCCCC
Q 006427          424 SMP--KGLHTLNLSRNKINTI-E-GLREMTRLRVLDLSYNRIF-RIGHGLSNCTLIKELYLAGNKISDI--EGLHRLLKL  496 (645)
Q Consensus       424 ~~~--~sL~~LdLs~N~Ls~l-p-~L~~L~sL~~LdLS~N~Ls-~LP~~l~~L~sL~~L~Ls~N~Ls~l--~~l~~L~~L  496 (645)
                      .+.  ++|++|+|++|.+.+. | .++.+++|++|+|++|.++ .+|..++++++|++|+|++|.+++.  ..+..+++|
T Consensus       183 ~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L  262 (968)
T PLN00113        183 SLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNL  262 (968)
T ss_pred             hhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCC
Confidence            443  7899999999988753 3 4888899999999999888 6777788999999999999988764  568888999


Q ss_pred             CEEECcCCCCCCccchhHhhhcCCCCcEEEccCCCCCcCCChhHHHHHHhcCCCCCceecccCCChhhhhhhhhHHHHHH
Q 006427          497 TVLDMSFNKITTTKALGQLVANYQSLLALNLLGNPIQSNISDDQLRKAVCSLLPKLVYLNKQPIKPQRARELLTDSIAKA  576 (645)
Q Consensus       497 ~~LdLS~N~Ls~~~~LP~~l~~L~sL~~LdLs~N~L~g~iP~~~l~~~vl~~L~~L~~Ld~~~Is~n~~~g~i~~~i~~~  576 (645)
                      +.|+|++|.+++.  +|..+..+++|+.|+|++|.+.+.+|..      +..+++|++|+.   ..|.+.+.+|..+.. 
T Consensus       263 ~~L~L~~n~l~~~--~p~~l~~l~~L~~L~Ls~n~l~~~~p~~------~~~l~~L~~L~l---~~n~~~~~~~~~~~~-  330 (968)
T PLN00113        263 QYLFLYQNKLSGP--IPPSIFSLQKLISLDLSDNSLSGEIPEL------VIQLQNLEILHL---FSNNFTGKIPVALTS-  330 (968)
T ss_pred             CEEECcCCeeecc--CchhHhhccCcCEEECcCCeeccCCChh------HcCCCCCcEEEC---CCCccCCcCChhHhc-
Confidence            9999999998875  7788889999999999999998888875      677888888875   567777777776654 


Q ss_pred             HhcCCCCccccccccccCCccCccCCCC
Q 006427          577 VLGNSSQSSQRKAVKRTGRSGSLPSSNQ  604 (645)
Q Consensus       577 ~l~~~~~sl~~~~l~~n~lSG~iPss~~  604 (645)
                           ...+..+.+..|.+.|.+|...+
T Consensus       331 -----l~~L~~L~L~~n~l~~~~p~~l~  353 (968)
T PLN00113        331 -----LPRLQVLQLWSNKFSGEIPKNLG  353 (968)
T ss_pred             -----CCCCCEEECcCCCCcCcCChHHh
Confidence                 25677889999999999887553

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query645
1ds9_A198 Solution Structure Of Chlamydomonas Outer Arm Dynei 9e-10
1m9l_A199 Relaxation-Based Refined Structure Of Chlamydomonas 6e-09
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-08
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 5e-08
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 6e-08
2omz_A 466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-07
1o6s_A 466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-07
2omv_A 461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-07
2omy_A 461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-07
2z81_A 549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 2e-05
4aw4_A311 Engineered Variant Of Listeria Monocytogenes Inlb I 2e-05
3a79_A 580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 3e-05
3oja_A 487 Crystal Structure Of Lrim1APL1C COMPLEX Length = 48 1e-04
1xeu_A263 Crystal Structure Of Internalin C From Listeria Mon 4e-04
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 4e-04
1dce_A567 Crystal Structure Of Rab Geranylgeranyltransferase 4e-04
1ltx_A567 Structure Of Rab Escort Protein-1 In Complex With R 4e-04
1m9s_A 605 Crystal Structure Of Internalin B (Inlb), A Listeri 5e-04
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 6e-04
3o53_A317 Crystal Structure Of Lrim1 Leucine-Rich Repeat Doma 6e-04
1otm_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 6e-04
1otn_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 6e-04
>pdb|1DS9|A Chain A, Solution Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 198 Back     alignment and structure 
Iteration: 1

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 72/143 (50%), Gaps = 5/143 (3%)
Query: 422 TGSMPKGLHTLNLSRNKINTIEGLREMTRLRVLDLSYNRIFRIGHGLSNCTLIKELYLAG 481
           T S  K    L LS N I  I  L  M  LR+L L  N I +I +  +    ++EL+++ 
Sbjct: 43  TLSTLKACKHLALSTNNIEKISSLSGMENLRILSLGRNLIKKIENLDAVADTLEELWISY 102
Query: 482 NKISDIEGLHRLLKLTVLDMSFNKITTTKALGQLVANYQSLLALNLLGNPI----QSNIS 537
           N+I+ + G+ +L+ L VL MS NKIT    + +L A    L  L L GNP+    + N +
Sbjct: 103 NQIASLSGIEKLVNLRVLYMSNNKITNWGEIDKLAA-LDKLEDLLLAGNPLYNDYKENNA 161
Query: 538 DDQLRKAVCSLLPKLVYLNKQPI 560
             + R  V   LP L  L+  P+
Sbjct: 162 TSEYRIEVVKRLPNLKKLDGMPV 184
>pdb|1M9L|A Chain A, Relaxation-Based Refined Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 199 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|4AW4|A Chain A, Engineered Variant Of Listeria Monocytogenes Inlb Internalin Domain With An Additional Leucine Rich Repeat Inserted Length = 311 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|3OJA|A Chain A, Crystal Structure Of Lrim1APL1C COMPLEX Length = 487 Back     alignment and structure
>pdb|1XEU|A Chain A, Crystal Structure Of Internalin C From Listeria Monocytogenes Length = 263 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|1DCE|A Chain A, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain Length = 567 Back     alignment and structure
>pdb|1LTX|A Chain A, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 567 Back     alignment and structure
>pdb|1M9S|A Chain A, Crystal Structure Of Internalin B (Inlb), A Listeria Monocytogenes Virulence Protein Containing Sh3-Like Domains Length = 605 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|3O53|A Chain A, Crystal Structure Of Lrim1 Leucine-Rich Repeat Domain Length = 317 Back     alignment and structure
>pdb|1OTM|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1OTN|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query645
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-41
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-31
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-31
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-27
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-27
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-18
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 4e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-30
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-29
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-27
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-21
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-14
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-30
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-24
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-22
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-28
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-28
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-26
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-22
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-28
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-27
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-26
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-26
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-24
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-26
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-26
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-25
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-24
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-24
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-24
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-15
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-17
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-23
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-14
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-22
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-16
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-17
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-16
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-19
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-19
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-18
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-19
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-18
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-15
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-16
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-14
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-15
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-12
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-05
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-14
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-14
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-10
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 1e-14
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-13
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-13
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-10
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-10
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-09
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-07
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-08
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 6e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 6e-04
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
 Score =  147 bits (373), Expect = 4e-41
 Identities = 50/166 (30%), Positives = 76/166 (45%), Gaps = 8/166 (4%)

Query: 405 SSLRSVNLSNNF--IVHIPTG-SMPKGLHTLNLSRNKINTIEGLREMTRLRVLDLSYNRI 461
           +    V L      I  +    S  K    L LS N I  I  L  M  LR+L L  N I
Sbjct: 23  TEAEKVELHGMIPPIEKMDATLSTLKACKHLALSTNNIEKISSLSGMENLRILSLGRNLI 82

Query: 462 FRIGHGLSNCTLIKELYLAGNKISDIEGLHRLLKLTVLDMSFNKITTTKALGQLVANYQS 521
            +I +  +    ++EL+++ N+I+ + G+ +L+ L VL MS NKIT    + +L A    
Sbjct: 83  KKIENLDAVADTLEELWISYNQIASLSGIEKLVNLRVLYMSNNKITNWGEIDKL-AALDK 141

Query: 522 LLALNLLGNPIQSNISDDQL----RKAVCSLLPKLVYLNKQPIKPQ 563
           L  L L GNP+ ++  ++      R  V   LP L  L+  P+   
Sbjct: 142 LEDLLLAGNPLYNDYKENNATSEYRIEVVKRLPNLKKLDGMPVDVD 187
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query645
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.85
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.85
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.85
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.85
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.85
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.83
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.83
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.83
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.82
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.82
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.82
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.82
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.82
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.82
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.81
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.81
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.81
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.81
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.8
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.8
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.8
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.79
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.78
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.78
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.77
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.77
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.76
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.76
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.76
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.76
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.73
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.72
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.7
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.7
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.68
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.66
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.65
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.65
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.59
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.59
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.59
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.58
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.57
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.47
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.37
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.34
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.31
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.2
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.2
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.17
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.15
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.15
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.09
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.08
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.02
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.94
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.73
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.47
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.43
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.42
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.2
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.02
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.72
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.67
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.62
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.48
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.42
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.37
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.32
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.18
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.02
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.99
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.89
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.44
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.88  E-value=7.5e-23  Score=237.74  Aligned_cols=240  Identities=19%  Similarity=0.195  Sum_probs=204.0

Q ss_pred             CCCCCChhhhhcccCCCEEecCCccccccchh-hccCCCccEEEecCCCCC-cCC-CCCCCCCCCEEEccCCcCCCCCCC
Q 006427          347 ETGKSPARSTAHLTRRSEINLSEEILHANSVI-RSLNSSSAVAHIAGIGLK-AIP-TISHFSSLRSVNLSNNFIVHIPTG  423 (645)
Q Consensus       347 ~l~~~~~~sl~~L~~L~~LdLS~n~l~~~~~l-~~L~~~L~~L~Ls~N~Lt-~IP-sL~~L~~L~~LdLs~N~Lt~ip~~  423 (645)
                      .+.+.+|..+.++++|+.|+|++|.+.+..+. ..-.++|+.|+|++|.++ .+| .+..+++|+.|+|++|.+++..+.
T Consensus       405 ~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~  484 (768)
T 3rgz_A          405 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPS  484 (768)
T ss_dssp             EEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCG
T ss_pred             ccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCH
Confidence            33446778899999999999999988754332 222378999999999998 566 688999999999999999976665


Q ss_pred             CCC--CCCCEEecCCCCCCC-Cc-CCCCCCCCcEEEccCCccc-cccCcCcCCCCCcEEEccCCCCCCc-c---------
Q 006427          424 SMP--KGLHTLNLSRNKINT-IE-GLREMTRLRVLDLSYNRIF-RIGHGLSNCTLIKELYLAGNKISDI-E---------  488 (645)
Q Consensus       424 ~~~--~sL~~LdLs~N~Ls~-lp-~L~~L~sL~~LdLS~N~Ls-~LP~~l~~L~sL~~L~Ls~N~Ls~l-~---------  488 (645)
                      .+.  ++|++|+|++|++++ +| .++.+++|++|+|++|.++ .+|..++.+++|+.|+|++|.+++. +         
T Consensus       485 ~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~  564 (768)
T 3rgz_A          485 GLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGK  564 (768)
T ss_dssp             GGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTC
T ss_pred             HHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccch
Confidence            554  899999999999995 44 4889999999999999999 7888899999999999999988642 1         


Q ss_pred             --------------------------------------------------------------cccCCCCCCEEECcCCCC
Q 006427          489 --------------------------------------------------------------GLHRLLKLTVLDMSFNKI  506 (645)
Q Consensus       489 --------------------------------------------------------------~l~~L~~L~~LdLS~N~L  506 (645)
                                                                                    .+..+.+|+.|+|++|+|
T Consensus       565 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l  644 (768)
T 3rgz_A          565 IAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNML  644 (768)
T ss_dssp             BCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCC
T ss_pred             hhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcc
Confidence                                                                          133457899999999999


Q ss_pred             CCccchhHhhhcCCCCcEEEccCCCCCcCCChhHHHHHHhcCCCCCceecccCCChhhhhhhhhHHHHHHHhcCCCCccc
Q 006427          507 TTTKALGQLVANYQSLLALNLLGNPIQSNISDDQLRKAVCSLLPKLVYLNKQPIKPQRARELLTDSIAKAVLGNSSQSSQ  586 (645)
Q Consensus       507 s~~~~LP~~l~~L~sL~~LdLs~N~L~g~iP~~~l~~~vl~~L~~L~~Ld~~~Is~n~~~g~i~~~i~~~~l~~~~~sl~  586 (645)
                      ++.  +|..++.++.|+.|+|++|.++|.+|..      ++.+++|+.||.   +.|++.|.+|..+..      ...++
T Consensus       645 ~g~--ip~~l~~l~~L~~L~Ls~N~l~g~ip~~------l~~L~~L~~LdL---s~N~l~g~ip~~l~~------l~~L~  707 (768)
T 3rgz_A          645 SGY--IPKEIGSMPYLFILNLGHNDISGSIPDE------VGDLRGLNILDL---SSNKLDGRIPQAMSA------LTMLT  707 (768)
T ss_dssp             BSC--CCGGGGGCTTCCEEECCSSCCCSCCCGG------GGGCTTCCEEEC---CSSCCEECCCGGGGG------CCCCS
T ss_pred             ccc--CCHHHhccccCCEEeCcCCccCCCCChH------HhCCCCCCEEEC---CCCcccCcCChHHhC------CCCCC
Confidence            987  8999999999999999999999999998      889999999986   789999999988765      36788


Q ss_pred             cccccccCCccCccCCC
Q 006427          587 RKAVKRTGRSGSLPSSN  603 (645)
Q Consensus       587 ~~~l~~n~lSG~iPss~  603 (645)
                      .++++.|+++|.||...
T Consensus       708 ~L~ls~N~l~g~iP~~~  724 (768)
T 3rgz_A          708 EIDLSNNNLSGPIPEMG  724 (768)
T ss_dssp             EEECCSSEEEEECCSSS
T ss_pred             EEECcCCcccccCCCch
Confidence            99999999999999764
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 645
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-16
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-09
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-08
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-16
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-16
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-09
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-12
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 1e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 81.6 bits (200), Expect = 3e-17
 Identities = 42/164 (25%), Positives = 67/164 (40%), Gaps = 27/164 (16%)

Query: 389 HIAGIGLKAIPTISHFSSLRSVNLSNNFIVHIPTGSMPKGLHTLNLSRNKINTIEGLREM 448
            + G  LK I T++  ++L  ++L+NN I ++   S    L  L L  N+I+ I  L  +
Sbjct: 225 SLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGL 284

Query: 449 TR----------------------LRVLDLSYNRIFRIGHGLSNCTLIKELYLAGNKISD 486
           T                       L  L L +N I  I   +S+ T ++ L+ A NK+SD
Sbjct: 285 TALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDI-SPVSSLTKLQRLFFANNKVSD 343

Query: 487 IEGLHRLLKLTVLDMSFNKITTTKALGQLVANYQSLLALNLLGN 530
           +  L  L  +  L    N+I+    L  L      +  L L   
Sbjct: 344 VSSLANLTNINWLSAGHNQISDLTPLANL----TRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query645
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.79
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.74
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.73
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.72
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.61
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.6
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.18
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.14
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.08
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.05
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.03
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.97
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.73
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.99
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.8
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.56
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.21
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.97
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.82  E-value=1.3e-19  Score=181.72  Aligned_cols=184  Identities=22%  Similarity=0.244  Sum_probs=145.3

Q ss_pred             cCCCEEecCCccccccchhh-ccCCCccEEEecCCCCCcCCCCCCCCCCCEEEccCCcCCCCCCCCCC-CCCCEEecCCC
Q 006427          360 TRRSEINLSEEILHANSVIR-SLNSSSAVAHIAGIGLKAIPTISHFSSLRSVNLSNNFIVHIPTGSMP-KGLHTLNLSRN  437 (645)
Q Consensus       360 ~~L~~LdLS~n~l~~~~~l~-~L~~~L~~L~Ls~N~Lt~IPsL~~L~~L~~LdLs~N~Lt~ip~~~~~-~sL~~LdLs~N  437 (645)
                      .+++.|+|++|.+..+..-. .-.++|+.|+|++|+|+.+|.++.+++|+.|+|++|+|+.++..... ++|+.|+|++|
T Consensus        31 ~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~~~~l~~L~~L~Ls~N~l~~~~~~~~~l~~L~~L~l~~~  110 (266)
T d1p9ag_          31 KDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFN  110 (266)
T ss_dssp             TTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCCCEEECCSCCTTCCEEECCSSCCSSCCCCTTTCTTCCEEECCSS
T ss_pred             cCCCEEECcCCcCCCcCHHHhhcccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            36788899999888765422 22378889999999998888888888999999999988877654332 78899999999


Q ss_pred             CCCCCc--CCCCCCCCcEEEccCCccccccCc-CcCCCCCcEEEccCCCCCCc--ccccCCCCCCEEECcCCCCCCccch
Q 006427          438 KINTIE--GLREMTRLRVLDLSYNRIFRIGHG-LSNCTLIKELYLAGNKISDI--EGLHRLLKLTVLDMSFNKITTTKAL  512 (645)
Q Consensus       438 ~Ls~lp--~L~~L~sL~~LdLS~N~Ls~LP~~-l~~L~sL~~L~Ls~N~Ls~l--~~l~~L~~L~~LdLS~N~Ls~~~~L  512 (645)
                      .+..++  .+..+.+|+.|++++|.++.+|.. +..++.|+.|++++|+|+.+  ..|..+++|++|+|++|+|+.   +
T Consensus       111 ~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~~~~l~~L~~L~Ls~N~L~~---l  187 (266)
T d1p9ag_         111 RLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYT---I  187 (266)
T ss_dssp             CCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSCCCTTTTTTCTTCCEEECCSSCCCC---C
T ss_pred             ccceeeccccccccccccccccccccceeccccccccccchhcccccccccccCccccccccccceeecccCCCcc---c
Confidence            888764  367788899999999998888766 66788899999999998887  347888899999999998886   6


Q ss_pred             hHhhhcCCCCcEEEccCCCCCcCCChhHHHHHHh
Q 006427          513 GQLVANYQSLLALNLLGNPIQSNISDDQLRKAVC  546 (645)
Q Consensus       513 P~~l~~L~sL~~LdLs~N~L~g~iP~~~l~~~vl  546 (645)
                      |..+..+++|+.|+|++|++.|.+....++.++-
T Consensus       188 p~~~~~~~~L~~L~L~~Np~~CdC~~~~l~~wl~  221 (266)
T d1p9ag_         188 PKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQ  221 (266)
T ss_dssp             CTTTTTTCCCSEEECCSCCBCCSGGGHHHHHHHH
T ss_pred             ChhHCCCCCCCEEEecCCCCCCCcchHHHHHHHH
Confidence            6667788889999999999988765555555543
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure