Citrus Sinensis ID: 006500


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640---
MDSGFIFEPPSDEEIEELQSEYEEDQGEEVDVEKPSKRAKQSPWDFAAYSESVSDEHFRRRTTSVDFKITKSLQQRSVPIVDNDHSDSEFDQHEDYKPEDEDDFSNAGDTKSFFAPADGASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTEEVVRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQEEREERILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADKASIEKGKGSGNEVTSAQQAEDLKIKEKRKREREKNLPRKERRKLEAAREMLEDEDQVDKLQVCNCIVYCV
ccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccHHHcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEcccccHHHHHcHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHccccccccccccEEEEEccccccccccHHHHHHHHHHcccccccccEEccccHHHHHHHHHHcccccEEEEccccccccccEEEEEEEcccccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccEEEEcccccccccccccccccccccccccEEEEccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHccEEEEEc
ccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccHccccHHHHHHHHHccccEEcccccccccccHHHccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHcccccccccEEEEEccHHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHccccEEEEccHHHHHHHHccccEcHcHEEEEEEcHHHHHHHcccHHHHHHHHHHccHcccEEEEEccccHHHHHHHHHHHcccEEEEEcccccccccEEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEcccHcHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHcccccEEEEEEHHHcccccccccEEEEEcccccHHHEEEEEccccccccccEEEEEEcccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccccEccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHEEcc
mdsgfifeppsdEEIEELQSEYeedqgeevdvekpskrakqspwdfaaysesvsdehfrrrttsvdfkitkslqqrsvpivdndhsdsefdqhedykpededdfsnagdtksffapadgasfhaNSFMELNLSRPLLRACealgyskptpiqaaciplaltgrdicgsaitgsgktaafALPTLErllyrpkripaiRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALrsmpdivvatpgrmidhlrnsmsvdldDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSltkplrlsadpsakrpstltEEVVRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVInyacprdltsYVHRVGrtaragregyavTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQEEREERILRKAEMEATKAENMIAHKEEifarpkrtwfvteKEKKLAVKADKAsiekgkgsgnevtsAQQAEDLKIKEKRKREREKNLPRKERRKLEAAREMLEDEDQVDKLQVCNCIVYCV
mdsgfifeppsdeEIEELQSEYEEdqgeevdvekpskrakqspwdfaaysesvsdehfrrrttsvdfkitkslqqrsvpivdndhsdsefdQHEDYKPEDEDDFSNAGDTKSFFAPADGASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSltkplrlsadpsakrpstlteevvrIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRtaragregyavtfvtdndrsLLKAIAKragsklksrivaEQSITKWSKIIEQMEDQVAAILQEEREERILRKAEMEATkaenmiahkeeifarpkrtwfvtekekklavkadkasiekgkgsgnevtsaqqaedlkikekrkrereknlprkerrkLEAAremlededqvdklqvCNCIVYCV
MDSGFIFEPPSDeeieelqseyeedqgeevdveKPSKRAKQSPWDFAAYSESVSDEHFRRRTTSVDFKITKSLQQRSVPIVDNDHSDSEFDQHEDYKPEDEDDFSNAGDTKSFFAPADGASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSvdlddlavlildeadRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTeevvrirrmrevNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQeereerILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADKASIEKGKGSGNEVTSAQQAedlkikekrkrereknlprkerrkleaaremleDEDQVDKLQVCNCIVYCV
***********************************************************************************************************************ASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLT********************VVRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAIL************************HKEEIFARPKRTWFVT*********************************************************************DKLQVCNCIVYC*
**SGFIFEPPS*******************************************************************************************************************FMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTEEVVRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSIT************************************************************************************************************************************NCIVYCV
MDSGFIFEPPSDE*****************************PWDFAAYSESVSDEHFRRRTTSVDFKITKSLQQRSVPIVDNDH*******************SNAGDTKSFFAPADGASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLS***********TEEVVRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQEEREERILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEK**************************AEDLKIKEK**********RKERRKLEAAREMLEDEDQVDKLQVCNCIVYCV
*******************************************************************************************QHEDYKPEDEDDFSNAGDTKSFFAPADGASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTEEVVRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQEEREERILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKAD*A********************************************AAREMLEDEDQVDKLQVCNCIVYCV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSGFIFEPPSDEEIEELQSEYEEDQGEEVDVEKPSKRAKQSPWDFAAYSESVSDEHFRRRTTSVDFKITKSLQQRSVPIVDNDHSDSEFDQHEDYKPEDEDDFSNAGDTKSFFAPADGASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTEEVVRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFARPKRTWFVTEKEKKLAVKADKASIEKGKGSGNEVTSxxxxxxxxxxxxxxxxxxxxxPRKERRKLEAAREMLEDEDQVDKLQVCNCIVYCV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query643 2.2.26 [Sep-21-2011]
Q9ZRZ8 789 DEAD-box ATP-dependent RN yes no 0.962 0.784 0.705 0.0
Q0INC5802 DEAD-box ATP-dependent RN yes no 0.811 0.650 0.799 0.0
A4QYM6790 ATP-dependent RNA helicas N/A no 0.780 0.635 0.497 1e-146
Q2UQI6820 ATP-dependent RNA helicas yes no 0.751 0.589 0.496 1e-142
Q54TJ4783 Probable ATP-dependent RN yes no 0.758 0.623 0.514 1e-140
Q1E2B2840 ATP-dependent RNA helicas N/A no 0.769 0.589 0.487 1e-139
A1D1R8819 ATP-dependent RNA helicas N/A no 0.715 0.561 0.508 1e-138
Q4WRV2830 ATP-dependent RNA helicas yes no 0.715 0.554 0.506 1e-138
P0C2N8829 ATP-dependent RNA helicas N/A no 0.768 0.595 0.495 1e-138
Q0CZN5821 ATP-dependent RNA helicas N/A no 0.794 0.622 0.476 1e-137
>sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 Back     alignment and function desciption
 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/669 (70%), Positives = 541/669 (80%), Gaps = 50/669 (7%)

Query: 1   MDSGFIFEPPSDEEIEELQSEYEEDQGEEVDVEKPS------------------------ 36
           M S F FE  SD+E+E ++++  ED  EE DV++                          
Sbjct: 1   MPSSFFFEDASDDELELIRNQ--EDSSEE-DVKEGEAEEHEAGEDEDGEEEYEEEDDDEE 57

Query: 37  ----KRAK----QSPWDFAAYSESVSDEHFRRRTTSVDFKITKSLQQRSVPIVDN----- 83
               KR +    QSPWDFA+YS SV +EH RR TTS+D KI+K++Q R VPI  N     
Sbjct: 58  EEDEKRKRDADAQSPWDFASYSSSVGEEHARRHTTSIDEKISKAIQHRPVPISINEEEEE 117

Query: 84  -----DHSDSEFDQHEDYKPEDED--DFSNAGDT-KSFFAPADGASFHANSFMELNLSRP 135
                D SD+E D+ E+Y  ED++  ++     T K FF+  DG SFHA++FMELNLSRP
Sbjct: 118 EEEEEDASDAETDKQEEYLSEDDEAAEYKPEDATPKPFFSTVDGVSFHADTFMELNLSRP 177

Query: 136 LLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIP 195
           LLRACE LGY KPTPIQAACIPLALTGRD+C SAITGSGKTAAFALPTLERLL+RPKR+ 
Sbjct: 178 LLRACETLGYKKPTPIQAACIPLALTGRDLCASAITGSGKTAAFALPTLERLLFRPKRVF 237

Query: 196 AIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPG 255
           A RVLILTPTRELAVQ+HSMI+ +AQFTDI+C L+VGGLS + QE  LRSMPDIVVATPG
Sbjct: 238 ATRVLILTPTRELAVQIHSMIQNLAQFTDIKCGLIVGGLSVREQEVVLRSMPDIVVATPG 297

Query: 256 RMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTED 315
           RMIDHLRNSMSVDLDDLAVLILDEADRLL+ GF+ EI ELVRLCPKRRQTMLFSAT+TE+
Sbjct: 298 RMIDHLRNSMSVDLDDLAVLILDEADRLLQTGFATEITELVRLCPKRRQTMLFSATMTEE 357

Query: 316 VDELIKLSLTKPLRLSADPSAKRPSTLTEEVVRIRRMREVNQEAVLLSLCSKTFTSKVII 375
           V EL+KLSL KPLRLSADPSA+RP  LTEEVVRIRR RE NQEAVLLSLC++TF SKVII
Sbjct: 358 VKELVKLSLNKPLRLSADPSARRPPGLTEEVVRIRRTREANQEAVLLSLCTRTFKSKVII 417

Query: 376 FSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLD 435
           FSGTKQAAHRLKILFGLA LKAAELHGNLTQAQRL++LELFRKQ VDFLIATDVAARGLD
Sbjct: 418 FSGTKQAAHRLKILFGLAGLKAAELHGNLTQAQRLDSLELFRKQEVDFLIATDVAARGLD 477

Query: 436 IIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKS 495
           IIGVQTVINYACPR++ SYVHRVGRTARAGREGYAVTFVTD+DRSLLK IAK+ GSKLKS
Sbjct: 478 IIGVQTVINYACPREIDSYVHRVGRTARAGREGYAVTFVTDSDRSLLKVIAKKVGSKLKS 537

Query: 496 RIVAEQSITKWSKIIEQMEDQVAAILQEEREERILRKAEMEATKAENMIAHKEEIFARPK 555
           R++ EQSI KWS+II++MEDQ +A++  ER+ER LRKAEME  KAENM+ H++EI+ARPK
Sbjct: 538 RVIPEQSIVKWSQIIDEMEDQYSAVISAERDERALRKAEMEFAKAENMLEHRDEIYARPK 597

Query: 556 RTWFVTEKEKKLAVKADKASIEKGKGSGNEVTSAQQAEDLKIKEKRKREREKNLPRKERR 615
           RTWF+TEKEKKL  +A+K S   G  +G E+ SA +AEDLK+KEKRKREREKNLPRK+RR
Sbjct: 598 RTWFMTEKEKKLVAQAEKDSA--GNPAGGELVSADRAEDLKMKEKRKREREKNLPRKKRR 655

Query: 616 KLEAAREML 624
           KLEAAREML
Sbjct: 656 KLEAAREML 664





Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 Back     alignment and function description
>sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 Back     alignment and function description
>sp|Q2UQI6|DRS1_ASPOR ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=drs1 PE=3 SV=2 Back     alignment and function description
>sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 Back     alignment and function description
>sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 Back     alignment and function description
>sp|A1D1R8|DRS1_NEOFI ATP-dependent RNA helicase drs1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=drs1 PE=3 SV=1 Back     alignment and function description
>sp|Q4WRV2|DRS1_ASPFU ATP-dependent RNA helicase drs1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=drs1 PE=3 SV=1 Back     alignment and function description
>sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drs-1 PE=3 SV=1 Back     alignment and function description
>sp|Q0CZN5|DRS1_ASPTN ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query643
225457931732 PREDICTED: DEAD-box ATP-dependent RNA he 0.982 0.863 0.825 0.0
255538978 783 dead box ATP-dependent RNA helicase, put 0.987 0.810 0.806 0.0
224083077 744 predicted protein [Populus trichocarpa] 0.982 0.849 0.827 0.0
449460106733 PREDICTED: DEAD-box ATP-dependent RNA he 0.982 0.862 0.823 0.0
449516409733 PREDICTED: LOW QUALITY PROTEIN: DEAD-box 0.982 0.862 0.819 0.0
30683736 789 DEAD-box ATP-dependent RNA helicase 28 [ 0.962 0.784 0.705 0.0
222423183686 AT4G16630 [Arabidopsis thaliana] 0.962 0.902 0.705 0.0
297800452 790 hypothetical protein ARALYDRAFT_493213 [ 0.961 0.782 0.696 0.0
357459393 828 ATP-dependent RNA helicase [Medicago tru 0.978 0.759 0.673 0.0
414886235 770 TPA: putative DEAD-box ATP-dependent RNA 0.945 0.789 0.659 0.0
>gi|225457931|ref|XP_002273443.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 28-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1039 bits (2687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/636 (82%), Positives = 582/636 (91%), Gaps = 4/636 (0%)

Query: 1   MDSGFIFEPPSDEEIEELQSEYEEDQGEEVDVEKPSKRAKQSPWDFAAYSESVSDEHFRR 60
           MDS F+FE PSDEE E    E EE++  E + E  ++ A QSPWDFA+YSE+V++EH RR
Sbjct: 1   MDSSFVFEVPSDEEPEYEPDEDEEEE--EGEGEGAAQTASQSPWDFASYSETVAEEHARR 58

Query: 61  RTTSVDFKITKSLQQRSVPIVD-NDHSDSEFDQHEDYKPEDEDDFSN-AGDTKSFFAPAD 118
            TTSVDFKI+K+L+QR +PI + +D S+SE D  EDY PED D+ ++  GD KSFFAPAD
Sbjct: 59  STTSVDFKISKALEQRRLPIPNQDDSSESESDHQEDYTPEDADEAASVGGDRKSFFAPAD 118

Query: 119 GASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAA 178
           GASFHANSF+ELNLSRPLLRACEALGY+KPTPIQAACIP+ALTGRDICGSAITGSGKTAA
Sbjct: 119 GASFHANSFLELNLSRPLLRACEALGYTKPTPIQAACIPIALTGRDICGSAITGSGKTAA 178

Query: 179 FALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKM 238
           F+LPTLERLL+RPKR+ AIRVL+LTPTRELAVQVHSM+EK+AQFTDIRCCL+VGGLS+KM
Sbjct: 179 FSLPTLERLLFRPKRVQAIRVLVLTPTRELAVQVHSMMEKLAQFTDIRCCLIVGGLSSKM 238

Query: 239 QETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRL 298
           QETALRSMPD+VVATPGRMIDHLRNSMSVDL+DLAVLILDEADRLLELGF+AEI ELVRL
Sbjct: 239 QETALRSMPDVVVATPGRMIDHLRNSMSVDLEDLAVLILDEADRLLELGFNAEIRELVRL 298

Query: 299 CPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTEEVVRIRRMREVNQE 358
           CPKRRQTMLFSAT+TE+VDEL+KLS+TKP+RL+ADPS KRP+TLTEEVVRIRRMREVNQE
Sbjct: 299 CPKRRQTMLFSATMTEEVDELVKLSMTKPMRLAADPSTKRPATLTEEVVRIRRMREVNQE 358

Query: 359 AVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRK 418
           AVLL+LCSKTFT+K IIFSGTKQAAHRLKILFGLA  KAAELHGNLTQ QRL+ALELFRK
Sbjct: 359 AVLLALCSKTFTAKAIIFSGTKQAAHRLKILFGLAGFKAAELHGNLTQVQRLDALELFRK 418

Query: 419 QHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDND 478
           Q VDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDND
Sbjct: 419 QQVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDND 478

Query: 479 RSLLKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQEEREERILRKAEMEAT 538
           RSLLK+I KRAGSKL+SRIVAEQSI KWS +IEQMEDQVAAILQEEREERILRKAEMEAT
Sbjct: 479 RSLLKSIVKRAGSKLRSRIVAEQSIIKWSHMIEQMEDQVAAILQEEREERILRKAEMEAT 538

Query: 539 KAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADKASIEKGKGSGNEVTSAQQAEDLKIK 598
           KAENMIAHK++I++RPKRTWF TEKEKK   KA K S+EK  GSGN V SAQQAEDLK+K
Sbjct: 539 KAENMIAHKDDIYSRPKRTWFATEKEKKSVAKAAKDSLEKENGSGNNVISAQQAEDLKMK 598

Query: 599 EKRKREREKNLPRKERRKLEAAREMLEDEDQVDKLQ 634
           EKRKREREKNLPRK+RRKLEAARE LEDE+Q+ KL+
Sbjct: 599 EKRKREREKNLPRKKRRKLEAARERLEDENQIHKLK 634




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255538978|ref|XP_002510554.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223551255|gb|EEF52741.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224083077|ref|XP_002306942.1| predicted protein [Populus trichocarpa] gi|222856391|gb|EEE93938.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449460106|ref|XP_004147787.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 28-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449516409|ref|XP_004165239.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 28-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|30683736|ref|NP_193396.3| DEAD-box ATP-dependent RNA helicase 28 [Arabidopsis thaliana] gi|75338927|sp|Q9ZRZ8.1|RH28_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 28 gi|3776027|emb|CAA09214.1| RNA helicase [Arabidopsis thaliana] gi|110736657|dbj|BAF00292.1| RNA helicase like protein [Arabidopsis thaliana] gi|332658378|gb|AEE83778.1| DEAD-box ATP-dependent RNA helicase 28 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|222423183|dbj|BAH19569.1| AT4G16630 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297800452|ref|XP_002868110.1| hypothetical protein ARALYDRAFT_493213 [Arabidopsis lyrata subsp. lyrata] gi|297313946|gb|EFH44369.1| hypothetical protein ARALYDRAFT_493213 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357459393|ref|XP_003599977.1| ATP-dependent RNA helicase [Medicago truncatula] gi|355489025|gb|AES70228.1| ATP-dependent RNA helicase [Medicago truncatula] Back     alignment and taxonomy information
>gi|414886235|tpg|DAA62249.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query643
TAIR|locus:2130918 789 AT4G16630 [Arabidopsis thalian 0.855 0.697 0.700 7.1e-203
UNIPROTKB|A4QYM6790 DRS1 "ATP-dependent RNA helica 0.752 0.612 0.482 2.2e-122
ASPGD|ASPL0000062195814 AN10125 [Emericella nidulans ( 0.763 0.603 0.469 3.1e-122
DICTYBASE|DDB_G0281711783 ddx27 "DEAD/DEAH box helicase" 0.682 0.560 0.505 4.2e-115
UNIPROTKB|A1A4H6765 DDX27 "Probable ATP-dependent 0.768 0.645 0.433 1.8e-112
UNIPROTKB|J9P9C6788 DDX27 "Uncharacterized protein 0.751 0.612 0.443 1.3e-111
UNIPROTKB|F1Q073767 DDX27 "Uncharacterized protein 0.709 0.594 0.465 1.6e-111
UNIPROTKB|Q96GQ7796 DDX27 "Probable ATP-dependent 0.751 0.606 0.445 2.1e-109
POMBASE|SPAC30D11.03754 ddx27 "ATP-dependent RNA helic 0.743 0.633 0.463 2.6e-109
UNIPROTKB|F1NQV5758 DDX27 "Uncharacterized protein 0.709 0.601 0.464 2.7e-109
TAIR|locus:2130918 AT4G16630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1963 (696.1 bits), Expect = 7.1e-203, P = 7.1e-203
 Identities = 396/565 (70%), Positives = 453/565 (80%)

Query:    41 QSPWDFAAYSESVSDEHFRRRTTSVDFKITKSLQQRSVPIVDN----------DHSDSEF 90
             QSPWDFA+YS SV +EH RR TTS+D KI+K++Q R VPI  N          D SD+E 
Sbjct:    70 QSPWDFASYSSSVGEEHARRHTTSIDEKISKAIQHRPVPISINEEEEEEEEEEDASDAET 129

Query:    91 DQHEDYKPEDED--DFSNAGDT-KSFFAPADGASFHANSFMELNLSRPLLRACEALGYSK 147
             D+ E+Y  ED++  ++     T K FF+  DG SFHA++FMELNLSRPLLRACE LGY K
Sbjct:   130 DKQEEYLSEDDEAAEYKPEDATPKPFFSTVDGVSFHADTFMELNLSRPLLRACETLGYKK 189

Query:   148 PTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRE 207
             PTPIQAACIPLALTGRD+C SAITGSGKTAAFALPTLERLL+RPKR+ A RVLILTPTRE
Sbjct:   190 PTPIQAACIPLALTGRDLCASAITGSGKTAAFALPTLERLLFRPKRVFATRVLILTPTRE 249

Query:   208 LAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSX 267
             LAVQ+HSMI+ +AQFTDI+C L+VGGLS + QE  LRSMPDIVVATPGRMIDHLRNSMS 
Sbjct:   250 LAVQIHSMIQNLAQFTDIKCGLIVGGLSVREQEVVLRSMPDIVVATPGRMIDHLRNSMSV 309

Query:   268 XXXXXXXXXXXXXXRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKP 327
                           RLL+ GF+ EI ELVRLCPKRRQTMLFSAT+TE+V EL+KLSL KP
Sbjct:   310 DLDDLAVLILDEADRLLQTGFATEITELVRLCPKRRQTMLFSATMTEEVKELVKLSLNKP 369

Query:   328 LRLSADPSAKRPSTLTXXXXXXXXXXXXNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLK 387
             LRLSADPSA+RP  LT            NQEAVLLSLC++TF SKVIIFSGTKQAAHRLK
Sbjct:   370 LRLSADPSARRPPGLTEEVVRIRRTREANQEAVLLSLCTRTFKSKVIIFSGTKQAAHRLK 429

Query:   388 ILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYAC 447
             ILFGLA LKAAELHGNLTQAQRL++LELFRKQ VDFLIATDVAARGLDIIGVQTVINYAC
Sbjct:   430 ILFGLAGLKAAELHGNLTQAQRLDSLELFRKQEVDFLIATDVAARGLDIIGVQTVINYAC 489

Query:   448 PRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSITKWS 507
             PR++ SYVHRVGRTARAGREGYAVTFVTD+DRSLLK IAK+ GSKLKSR++ EQSI KWS
Sbjct:   490 PREIDSYVHRVGRTARAGREGYAVTFVTDSDRSLLKVIAKKVGSKLKSRVIPEQSIVKWS 549

Query:   508 KIIEQMEDQVAAILQXXXXXXILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKL 567
             +II++MEDQ +A++        LRKAEME  KAENM+ H++EI+ARPKRTWF+TEKEKKL
Sbjct:   550 QIIDEMEDQYSAVISAERDERALRKAEMEFAKAENMLEHRDEIYARPKRTWFMTEKEKKL 609

Query:   568 AVKADKASIEKGKGSGNEVTSAQQA 592
               +A+K S   G  +G E+ SA +A
Sbjct:   610 VAQAEKDSA--GNPAGGELVSADRA 632




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
UNIPROTKB|A4QYM6 DRS1 "ATP-dependent RNA helicase DRS1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000062195 AN10125 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281711 ddx27 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|A1A4H6 DDX27 "Probable ATP-dependent RNA helicase DDX27" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9C6 DDX27 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q073 DDX27 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96GQ7 DDX27 "Probable ATP-dependent RNA helicase DDX27" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPAC30D11.03 ddx27 "ATP-dependent RNA helicase Ddx27/Drs1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQV5 DDX27 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0INC5RH28_ORYSJ3, ., 6, ., 4, ., 1, 30.79920.81180.6508yesno
Q54TJ4DDX27_DICDI3, ., 6, ., 4, ., 1, 30.51410.75890.6232yesno
Q9ZRZ8RH28_ARATH3, ., 6, ., 4, ., 1, 30.70550.96260.7845yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.946
3rd Layer3.6.40.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query643
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-129
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-95
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 8e-91
cd00268203 cd00268, DEADc, DEAD-box helicases 4e-90
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 1e-82
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 7e-79
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 7e-76
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 3e-72
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 9e-70
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 1e-64
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 4e-63
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 5e-58
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 4e-57
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 3e-49
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 3e-35
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 7e-32
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 4e-25
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-23
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 7e-22
COG1205 851 COG1205, COG1205, Distinct helicase family with a 9e-16
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 5e-13
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 3e-08
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 4e-08
TIGR01389591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 5e-08
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 3e-07
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 4e-07
TIGR03817 742 TIGR03817, DECH_helic, helicase/secretion neighbor 4e-06
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 7e-06
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 2e-05
PRK09751 1490 PRK09751, PRK09751, putative ATP-dependent helicas 3e-04
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 4e-04
COG1110 1187 COG1110, COG1110, Reverse gyrase [DNA replication, 0.002
COG1203733 COG1203, COG1203, CRISPR-associated helicase Cas3 0.002
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
 Score =  389 bits (1002), Expect = e-129
 Identities = 167/497 (33%), Positives = 255/497 (51%), Gaps = 20/497 (4%)

Query: 126 SFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLE 185
            F  L LS  LL+A + LG+ +PTPIQ A IPL L GRD+ G A TG+GKTAAF LP L+
Sbjct: 30  EFASLGLSPELLQALKDLGFEEPTPIQLAAIPLILAGRDVLGQAQTGTGKTAAFLLPLLQ 89

Query: 186 RLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFT-DIRCCLVVGGLSTKMQETALR 244
           ++L   +R   +  LIL PTRELAVQ+   + K+ +    +R  +V GG+S + Q  AL+
Sbjct: 90  KILKSVER-KYVSALILAPTRELAVQIAEELRKLGKNLGGLRVAVVYGGVSIRKQIEALK 148

Query: 245 SMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQ 304
              DIVVATPGR++D ++    +DL  +  L+LDEADR+L++GF  +I ++++  P  RQ
Sbjct: 149 RGVDIVVATPGRLLDLIKRG-KLDLSGVETLVLDEADRMLDMGFIDDIEKILKALPPDRQ 207

Query: 305 TMLFSATLTEDVDELIKLSLTKPLRLSADPSAKR--PSTLTEEVVRIRRMREVNQEAVLL 362
           T+LFSAT+ +D+ EL +  L  P+ +             + +  + +    E  +  +LL
Sbjct: 208 TLLFSATMPDDIRELARRYLNDPVEIEVSVEKLERTLKKIKQFYLEVESEEE--KLELLL 265

Query: 363 SLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVD 422
            L       +VI+F  TK+    L         K A LHG+L Q +R  ALE F+   + 
Sbjct: 266 KLLKDEDEGRVIVFVRTKRLVEELAESLRKRGFKVAALHGDLPQEERDRALEKFKDGELR 325

Query: 423 FLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDN-DRSL 481
            L+ATDVAARGLDI  V  VINY  P D   YVHR+GRT RAGR+G A++FVT+  +   
Sbjct: 326 VLVATDVAARGLDIPDVSHVINYDLPLDPEDYVHRIGRTGRAGRKGVAISFVTEEEEVKK 385

Query: 482 LKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQEEREERILRKAEMEATKAE 541
           LK I KR   KL S ++      + +K+++     +        E + L+ ++    +  
Sbjct: 386 LKRIEKRLERKLPSAVLLPLDEPEDAKLLKTTRPGLEEESDISDEIKKLKSSKKALLRGL 445

Query: 542 NMIAHKEEIFARPKRTWFVTEKEKKLAVKADKASIEKGKGSGNEVTSAQQAEDLKIKEKR 601
            +     ++ A   +          +  + ++ S                     I +  
Sbjct: 446 GVRFTLSKLLANLGKEIPGAGDAVTIDPELERRSPNSADD------------IEYILKGL 493

Query: 602 KREREKNLPRKERRKLE 618
               E+   + E   ++
Sbjct: 494 SYRAEERTAKNEAANIK 510


Length = 513

>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|224035 COG1110, COG1110, Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224124 COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 643
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
KOG0334 997 consensus RNA helicase [RNA processing and modific 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
PRK106891147 transcription-repair coupling factor; Provisional 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
PRK09200790 preprotein translocase subunit SecA; Reviewed 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 100.0
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
KOG0354746 consensus DEAD-box like helicase [General function 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
COG0556663 UvrB Helicase subunit of the DNA excision repair c 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
KOG0353695 consensus ATP-dependent DNA helicase [General func 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
PRK04914 956 ATP-dependent helicase HepA; Validated 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
PRK05580679 primosome assembly protein PriA; Validated 99.97
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.97
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.97
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.97
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.97
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.97
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.97
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.97
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.97
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.97
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.97
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.97
PRK09694878 helicase Cas3; Provisional 99.96
KOG0387923 consensus Transcription-coupled repair protein CSB 99.96
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.96
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.96
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.96
KOG1123776 consensus RNA polymerase II transcription initiati 99.95
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 99.95
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.95
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.95
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.95
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.95
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.95
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.95
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.94
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.94
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.94
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 99.94
PRK05298652 excinuclease ABC subunit B; Provisional 99.94
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.93
KOG2340698 consensus Uncharacterized conserved protein [Funct 99.93
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.93
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.92
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.92
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.92
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.91
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.91
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 99.9
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.9
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 99.9
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 99.89
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.89
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.88
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.87
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 99.86
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.86
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 99.85
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.84
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.84
smart00487201 DEXDc DEAD-like helicases superfamily. 99.83
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.83
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.82
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.8
COG4096 875 HsdR Type I site-specific restriction-modification 99.8
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.79
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.78
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.77
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.73
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.73
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.73
KOG1002791 consensus Nucleotide excision repair protein RAD16 99.71
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.7
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.69
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.69
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.69
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.68
COG4889 1518 Predicted helicase [General function prediction on 99.66
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 99.64
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.64
KOG4439901 consensus RNA polymerase II transcription terminat 99.64
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.62
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.59
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.58
smart0049082 HELICc helicase superfamily c-terminal domain. 99.57
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.55
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 99.52
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.52
PRK14873665 primosome assembly protein PriA; Provisional 99.44
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.39
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.38
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.36
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 99.26
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 99.21
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.19
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.19
smart00488289 DEXDc2 DEAD-like helicases superfamily. 99.12
smart00489289 DEXDc3 DEAD-like helicases superfamily. 99.12
COG0610 962 Type I site-specific restriction-modification syst 99.11
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.85
KOG1001674 consensus Helicase-like transcription factor HLTF/ 98.75
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.46
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.42
COG3587 985 Restriction endonuclease [Defense mechanisms] 98.42
KOG1132945 consensus Helicase of the DEAD superfamily [Replic 98.42
KOG0383696 consensus Predicted helicase [General function pre 98.4
PRK15483 986 type III restriction-modification system StyLTI en 98.39
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.33
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.3
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.18
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 98.16
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.13
KOG1131755 consensus RNA polymerase II transcription initiati 97.97
KOG1803649 consensus DNA helicase [Replication, recombination 97.93
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.92
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.9
PF1324576 AAA_19: Part of AAA domain 97.9
PRK10536262 hypothetical protein; Provisional 97.84
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.83
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.82
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.79
TIGR00376637 DNA helicase, putative. The gene product may repre 97.77
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.75
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.4
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 97.37
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.33
PRK08181269 transposase; Validated 97.28
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.27
smart00492141 HELICc3 helicase superfamily c-terminal domain. 97.27
PF13871278 Helicase_C_4: Helicase_C-like 97.23
PRK06526254 transposase; Provisional 97.12
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.1
PRK04296190 thymidine kinase; Provisional 97.1
smart00491142 HELICc2 helicase superfamily c-terminal domain. 97.05
PRK14974336 cell division protein FtsY; Provisional 97.03
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.01
KOG18051100 consensus DNA replication helicase [Replication, r 96.97
KOG0298 1394 consensus DEAD box-containing helicase-like transc 96.95
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.9
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.9
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.83
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.74
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.74
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.69
smart00382148 AAA ATPases associated with a variety of cellular 96.68
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 96.67
PRK06921266 hypothetical protein; Provisional 96.67
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.67
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.63
PRK08116268 hypothetical protein; Validated 96.47
PRK07952244 DNA replication protein DnaC; Validated 96.42
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 96.37
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.36
PRK12377248 putative replication protein; Provisional 96.3
PHA02533534 17 large terminase protein; Provisional 96.29
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 96.28
PRK08727233 hypothetical protein; Validated 96.22
PRK06835329 DNA replication protein DnaC; Validated 96.18
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.11
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 96.1
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.08
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 96.03
PRK11054684 helD DNA helicase IV; Provisional 96.02
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 95.98
PRK05642234 DNA replication initiation factor; Validated 95.95
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.94
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 95.9
PRK09112351 DNA polymerase III subunit delta'; Validated 95.81
PTZ00293211 thymidine kinase; Provisional 95.73
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 95.64
PRK06893229 DNA replication initiation factor; Validated 95.64
PRK00149450 dnaA chromosomal replication initiation protein; R 95.63
PRK00771437 signal recognition particle protein Srp54; Provisi 95.57
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 95.49
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.48
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 95.48
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.45
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 95.45
PRK08084235 DNA replication initiation factor; Provisional 95.39
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.38
COG3973747 Superfamily I DNA and RNA helicases [General funct 95.36
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 95.32
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 95.24
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 95.22
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.22
PRK14087450 dnaA chromosomal replication initiation protein; P 95.2
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 95.16
PRK08769319 DNA polymerase III subunit delta'; Validated 95.1
PRK12422445 chromosomal replication initiation protein; Provis 95.07
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 95.06
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.04
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.04
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.03
PHA03333752 putative ATPase subunit of terminase; Provisional 95.02
PRK07471365 DNA polymerase III subunit delta'; Validated 95.0
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.0
TIGR00064272 ftsY signal recognition particle-docking protein F 94.98
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.97
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.96
PRK13833323 conjugal transfer protein TrbB; Provisional 94.94
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 94.9
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 94.86
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 94.85
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 94.85
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 94.84
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.82
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 94.77
PF00004132 AAA: ATPase family associated with various cellula 94.75
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.75
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 94.75
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 94.7
PTZ001121164 origin recognition complex 1 protein; Provisional 94.68
PRK08939306 primosomal protein DnaI; Reviewed 94.67
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 94.66
PRK08903227 DnaA regulatory inactivator Hda; Validated 94.65
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 94.64
PHA02544316 44 clamp loader, small subunit; Provisional 94.64
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 94.59
PRK09183259 transposase/IS protein; Provisional 94.58
PRK05707328 DNA polymerase III subunit delta'; Validated 94.55
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 94.54
COG3972660 Superfamily I DNA and RNA helicases [General funct 94.54
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.53
PRK14088440 dnaA chromosomal replication initiation protein; P 94.52
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 94.45
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 94.43
PRK12402337 replication factor C small subunit 2; Reviewed 94.43
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 94.41
PRK14086617 dnaA chromosomal replication initiation protein; P 94.39
PLN03025319 replication factor C subunit; Provisional 94.37
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.32
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 94.31
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.28
COG0552340 FtsY Signal recognition particle GTPase [Intracell 94.25
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 94.22
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 94.19
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.15
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 94.14
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 94.14
CHL00181287 cbbX CbbX; Provisional 94.13
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 94.11
PHA03368738 DNA packaging terminase subunit 1; Provisional 94.09
PF05729166 NACHT: NACHT domain 94.05
PRK04195482 replication factor C large subunit; Provisional 94.02
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 94.02
PRK10867433 signal recognition particle protein; Provisional 94.01
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.94
COG0470325 HolB ATPase involved in DNA replication [DNA repli 93.89
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 93.86
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 93.85
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 93.83
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 93.8
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 93.79
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 93.78
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 93.73
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 93.73
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.71
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 93.68
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 93.62
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 93.49
PRK05580 679 primosome assembly protein PriA; Validated 93.41
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 93.3
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 93.3
TIGR00959428 ffh signal recognition particle protein. This mode 93.26
PRK10436462 hypothetical protein; Provisional 93.23
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 93.21
COG2256436 MGS1 ATPase related to the helicase subunit of the 93.17
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 93.14
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 93.13
PRK07940394 DNA polymerase III subunit delta'; Validated 93.1
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 93.08
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 93.08
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 93.05
TIGR02533486 type_II_gspE general secretory pathway protein E. 93.01
cd03115173 SRP The signal recognition particle (SRP) mediates 92.94
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 92.91
PF13173128 AAA_14: AAA domain 92.82
TIGR00595 505 priA primosomal protein N'. All proteins in this f 92.8
KOG2036 1011 consensus Predicted P-loop ATPase fused to an acet 92.79
PRK06871325 DNA polymerase III subunit delta'; Validated 92.77
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 92.73
TIGR02928365 orc1/cdc6 family replication initiation protein. M 92.71
PRK13342413 recombination factor protein RarA; Reviewed 92.59
PRK08533230 flagellar accessory protein FlaH; Reviewed 92.56
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 92.51
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 92.49
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 92.48
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 92.47
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.43
KOG0745564 consensus Putative ATP-dependent Clp-type protease 92.37
PRK13341 725 recombination factor protein RarA/unknown domain f 92.34
PRK13851344 type IV secretion system protein VirB11; Provision 92.22
PRK10416318 signal recognition particle-docking protein FtsY; 92.18
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 92.18
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 92.16
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 92.08
TIGR00643630 recG ATP-dependent DNA helicase RecG. 92.07
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 92.02
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 91.95
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 91.95
PRK07993334 DNA polymerase III subunit delta'; Validated 91.86
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 91.83
PRK14873 665 primosome assembly protein PriA; Provisional 91.83
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 91.78
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 91.76
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 91.76
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 91.67
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 91.6
KOG2028554 consensus ATPase related to the helicase subunit o 91.6
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 91.5
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 91.46
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 91.4
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 91.34
PRK06964342 DNA polymerase III subunit delta'; Validated 91.31
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 91.17
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 91.08
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 91.06
PRK00440319 rfc replication factor C small subunit; Reviewed 90.99
PRK06090319 DNA polymerase III subunit delta'; Validated 90.98
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 90.92
PRK08699325 DNA polymerase III subunit delta'; Validated 90.83
KOG02981394 consensus DEAD box-containing helicase-like transc 90.74
PRK04841 903 transcriptional regulator MalT; Provisional 90.58
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 90.49
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 90.46
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 90.42
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 90.35
PRK03992389 proteasome-activating nucleotidase; Provisional 90.26
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 90.26
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 90.24
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 90.16
PRK10689 1147 transcription-repair coupling factor; Provisional 90.14
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 90.12
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 90.12
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 90.08
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 90.06
PRK07399314 DNA polymerase III subunit delta'; Validated 90.06
PRK13897606 type IV secretion system component VirD4; Provisio 89.98
TIGR00767415 rho transcription termination factor Rho. Members 89.96
PRK13764602 ATPase; Provisional 89.94
PRK09087226 hypothetical protein; Validated 89.86
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 89.79
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 89.77
PRK11823446 DNA repair protein RadA; Provisional 89.73
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 89.71
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 89.67
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 89.6
COG0593408 DnaA ATPase involved in DNA replication initiation 89.56
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 89.54
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 89.49
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 89.34
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 89.34
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 89.32
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 89.28
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 89.24
PF12846304 AAA_10: AAA-like domain 89.19
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 89.09
PRK06067234 flagellar accessory protein FlaH; Validated 89.01
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 88.96
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 88.88
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 88.87
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 88.71
PHA00729226 NTP-binding motif containing protein 88.59
PF1355562 AAA_29: P-loop containing region of AAA domain 88.32
COG4626546 Phage terminase-like protein, large subunit [Gener 88.21
KOG2543438 consensus Origin recognition complex, subunit 5 [R 88.16
TIGR00763775 lon ATP-dependent protease La. This protein is ind 88.09
PRK14701 1638 reverse gyrase; Provisional 88.08
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 88.06
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 87.95
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 87.9
PRK05564313 DNA polymerase III subunit delta'; Validated 87.84
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 87.77
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 87.55
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 87.55
COG1200677 RecG RecG-like helicase [DNA replication, recombin 87.53
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 87.5
PRK04328249 hypothetical protein; Provisional 87.49
COG2255332 RuvB Holliday junction resolvasome, helicase subun 87.43
PRK13850670 type IV secretion system protein VirD4; Provisiona 87.42
COG1618179 Predicted nucleotide kinase [Nucleotide transport 87.4
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 87.38
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 87.24
cd03239178 ABC_SMC_head The structural maintenance of chromos 86.94
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 86.89
cd01128249 rho_factor Transcription termination factor rho is 86.88
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 86.85
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 86.78
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 86.78
PF10412386 TrwB_AAD_bind: Type IV secretion-system coupling p 86.63
PRK05973237 replicative DNA helicase; Provisional 86.59
COG1198 730 PriA Primosomal protein N' (replication factor Y) 86.46
cd01393226 recA_like RecA is a bacterial enzyme which has rol 86.44
COG11971139 Mfd Transcription-repair coupling factor (superfam 86.42
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 86.32
CHL00176638 ftsH cell division protein; Validated 86.27
CHL00095 821 clpC Clp protease ATP binding subunit 86.21
KOG0347 731 consensus RNA helicase [RNA processing and modific 86.14
PRK08058329 DNA polymerase III subunit delta'; Validated 86.12
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 86.1
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP bindi 86.07
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 86.05
PRK06904472 replicative DNA helicase; Validated 86.05
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 85.87
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 85.86
PHA00012361 I assembly protein 85.79
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 85.69
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 85.55
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 85.48
PHA03372668 DNA packaging terminase subunit 1; Provisional 85.45
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 85.26
PF04931784 DNA_pol_phi: DNA polymerase phi; InterPro: IPR0070 85.07
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 84.85
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 84.79
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 84.74
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 84.67
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 84.4
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 84.35
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 84.34
KOG1807 1025 consensus Helicases [Replication, recombination an 84.33
PRK13695174 putative NTPase; Provisional 84.33
PRK10865 857 protein disaggregation chaperone; Provisional 84.32
KOG0780483 consensus Signal recognition particle, subunit Srp 84.01
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 83.99
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 83.92
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 83.89
PRK13822641 conjugal transfer coupling protein TraG; Provision 83.85
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 83.73
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 83.67
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=6.2e-102  Score=778.52  Aligned_cols=460  Identities=62%  Similarity=0.962  Sum_probs=447.4

Q ss_pred             CCCcCCCCCCCCcccC---CcccCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHhcCCCeEEEcCCCchhHHHhHHhHHHH
Q 006500          110 TKSFFAPADGASFHAN---SFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLER  186 (643)
Q Consensus       110 ~~~~~~~~~~~~~~~~---~f~~l~l~~~l~~~l~~~g~~~~~~~Q~~~i~~~l~g~d~l~~a~TGsGKT~~~~l~~l~~  186 (643)
                      ...||++.+..+....   +|.+++||++|+++|..+||..|||||..+||.++.|+|+|.||.||||||.+|++|+|++
T Consensus       163 ~~~Ffa~~dg~s~~~~~~~sF~~mNLSRPlLka~~~lGy~~PTpIQ~a~IPvallgkDIca~A~TGsGKTAAF~lPiLER  242 (691)
T KOG0338|consen  163 KKFFFATEDGVSADTQMNESFQSMNLSRPLLKACSTLGYKKPTPIQVATIPVALLGKDICACAATGSGKTAAFALPILER  242 (691)
T ss_pred             ccccccccchhhhhhHHhhhHHhcccchHHHHHHHhcCCCCCCchhhhcccHHhhcchhhheecccCCchhhhHHHHHHH
Confidence            4557777777666554   8999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCCCCCCeEEEEEcCcHHHHHHHHHHHHHHhhcCCceEEEEecCCChHHHHHHhcCCCcEEEECchhHHHHHhccCc
Q 006500          187 LLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMS  266 (643)
Q Consensus       187 l~~~~~~~~~~~vLil~Ptr~La~Q~~~~~~~l~~~~~~~v~~~~g~~~~~~~~~~l~~~~~Ivv~Tp~~L~~~l~~~~~  266 (643)
                      +++++.+...++||||+|||+|+.|++.+.+++++|+.+.+++++||.+...|+..|+..|||||+|||||++||.+.++
T Consensus       243 LlYrPk~~~~TRVLVL~PTRELaiQv~sV~~qlaqFt~I~~~L~vGGL~lk~QE~~LRs~PDIVIATPGRlIDHlrNs~s  322 (691)
T KOG0338|consen  243 LLYRPKKVAATRVLVLVPTRELAIQVHSVTKQLAQFTDITVGLAVGGLDLKAQEAVLRSRPDIVIATPGRLIDHLRNSPS  322 (691)
T ss_pred             HhcCcccCcceeEEEEeccHHHHHHHHHHHHHHHhhccceeeeeecCccHHHHHHHHhhCCCEEEecchhHHHHhccCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCeeEEEEeCCchhccCChHHHHHHHHHHCCCCceeEEEeeccchhHHHHHHHhcCCCeEEecCCCCCCCCCceEEE
Q 006500          267 VDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTEEV  346 (643)
Q Consensus       267 ~~l~~i~~lVvDEah~l~~~g~~~~~~~i~~~~~~~~q~i~~SAT~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~  346 (643)
                      ++++++.++|+||||+|++.||...+.+|++.||+++|+++|||||+..+.+++.+.+++|+.+.+++....+..++|.|
T Consensus       323 f~ldsiEVLvlDEADRMLeegFademnEii~lcpk~RQTmLFSATMteeVkdL~slSL~kPvrifvd~~~~~a~~LtQEF  402 (691)
T KOG0338|consen  323 FNLDSIEVLVLDEADRMLEEGFADEMNEIIRLCPKNRQTMLFSATMTEEVKDLASLSLNKPVRIFVDPNKDTAPKLTQEF  402 (691)
T ss_pred             ccccceeEEEechHHHHHHHHHHHHHHHHHHhccccccceeehhhhHHHHHHHHHhhcCCCeEEEeCCccccchhhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEechhhhhHHHHHHHHhhccCCceEEEEeCCHHHHHHHHHHHhhcCCceEEccCCCCHHHHHHHHHHhhcCCceEEEe
Q 006500          347 VRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIA  426 (643)
Q Consensus       347 ~~~~~~~~~~~~~~l~~~~~~~~~~~~LIF~~s~~~~~~l~~~L~~~~~~~~~lh~~~~~~~R~~~l~~F~~g~~~vLva  426 (643)
                      +++++.....+..++..++.+.+..++|||+.|++.|++|..+|..+|++++.|||+++|.+|.+.++.|++++++||||
T Consensus       403 iRIR~~re~dRea~l~~l~~rtf~~~~ivFv~tKk~AHRl~IllGLlgl~agElHGsLtQ~QRlesL~kFk~~eidvLia  482 (691)
T KOG0338|consen  403 IRIRPKREGDREAMLASLITRTFQDRTIVFVRTKKQAHRLRILLGLLGLKAGELHGSLTQEQRLESLEKFKKEEIDVLIA  482 (691)
T ss_pred             heeccccccccHHHHHHHHHHhcccceEEEEehHHHHHHHHHHHHHhhchhhhhcccccHHHHHHHHHHHHhccCCEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCCCCCccEEEecCCCCChhHHHHHHhhcccCCCccEEEEEeccCcHHHHHHHHHH---hcCcccccchhhhhH
Q 006500          427 TDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKR---AGSKLKSRIVAEQSI  503 (643)
Q Consensus       427 T~~~~~GlDi~~v~~VI~~d~p~s~~~y~Qr~GRagR~g~~g~~~~l~~~~d~~~l~~i~~~---~~~~~~~~~~~~~~~  503 (643)
                      ||+|+|||||++|.+||||.+|.+...|+||+|||+|+|+.|.+++|+...++++++.|.+.   .+.+++.+.+++..+
T Consensus       483 TDvAsRGLDI~gV~tVINy~mP~t~e~Y~HRVGRTARAGRaGrsVtlvgE~dRkllK~iik~~~~a~~klk~R~i~~~~I  562 (691)
T KOG0338|consen  483 TDVASRGLDIEGVQTVINYAMPKTIEHYLHRVGRTARAGRAGRSVTLVGESDRKLLKEIIKSSTKAGSKLKNRNIPPEVI  562 (691)
T ss_pred             echhhccCCccceeEEEeccCchhHHHHHHHhhhhhhcccCcceEEEeccccHHHHHHHHhhhhhcccchhhcCCCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999888   789999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHhcCccccccccHHHHHHHh
Q 006500          504 TKWSKIIEQMEDQVAAILQEEREERILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAV  569 (643)
Q Consensus       504 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  569 (643)
                      .+|...+++|++.+..++.++++++.++++++.+.+++||+++.+++.++|.|+|||+++++++.+
T Consensus       563 ek~~~~ieemE~~iq~vl~eE~~ekel~~ae~ql~k~en~Le~g~ei~arprRtWFqte~~kk~~K  628 (691)
T KOG0338|consen  563 EKFRKKIEEMEDTIQAVLDEEREEKELSKAEAQLEKGENMLEHGDEIYARPRRTWFQTEKDKKASK  628 (691)
T ss_pred             HHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHhhccccccCccchhhhhhHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999988664



>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PF04931 DNA_pol_phi: DNA polymerase phi; InterPro: IPR007015 Proteins of this family are predominantly nucleolar Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG1807 consensus Helicases [Replication, recombination and repair] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query643
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 5e-49
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 2e-45
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 2e-45
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 4e-45
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 5e-45
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 5e-45
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 5e-45
2hyi_C413 Structure Of The Human Exon Junction Complex With A 6e-45
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 1e-44
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 2e-44
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 5e-44
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 6e-44
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 2e-43
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 2e-43
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 3e-42
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 1e-37
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 3e-37
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 1e-35
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 1e-35
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 3e-34
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 7e-34
2vso_A395 Crystal Structure Of A Translation Initiation Compl 1e-33
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 2e-33
1fuu_A394 Yeast Initiation Factor 4a Length = 394 2e-31
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 2e-31
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 6e-31
3ly5_A262 Ddx18 Dead-Domain Length = 262 1e-30
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 2e-30
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 6e-28
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 2e-27
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 3e-27
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 3e-27
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 3e-27
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 4e-25
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 5e-24
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 6e-24
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 1e-23
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 8e-22
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 3e-21
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 3e-21
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 2e-20
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 2e-20
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 4e-20
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 7e-19
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 9e-19
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 4e-18
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 5e-18
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 7e-18
2jgn_A185 Ddx3 Helicase Domain Length = 185 2e-17
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 2e-16
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 3e-16
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 7e-16
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 7e-16
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 7e-16
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 9e-16
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 9e-16
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 1e-15
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 1e-13
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 8e-13
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 4e-12
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 7e-12
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 4e-11
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 3e-09
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 4e-09
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 4e-08
4gl2_A699 Structural Basis For Dsrna Duplex Backbone Recognit 3e-05
1oyy_A523 Structure Of The Recq Catalytic Core Bound To Atp-G 1e-04
1oyw_A523 Structure Of The Recq Catalytic Core Length = 523 1e-04
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure

Iteration: 1

Score = 192 bits (488), Expect = 5e-49, Method: Compositional matrix adjust. Identities = 126/365 (34%), Positives = 194/365 (53%), Gaps = 19/365 (5%) Query: 126 SFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGR-DICGSAITGSGKTAAFALPTL 184 +F ELNLS +L A G+ KPT IQ IPL L +I A TGSGKTA+FA+P + Sbjct: 7 NFNELNLSDNILNAIRNKGFEKPTDIQXKVIPLFLNDEYNIVAQARTGSGKTASFAIPLI 66 Query: 185 ERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALR 244 E L+ I AI ILTPTRELA+QV IE + +++ + GG + Q AL+ Sbjct: 67 E-LVNENNGIEAI---ILTPTRELAIQVADEIESLKGNKNLKIAKIYGGKAIYPQIKALK 122 Query: 245 SMPDIVVATPGRMIDHLRNSMSXXXXXXXXXXXXXXXRLLELGFSAEIHELVRLCPKRRQ 304 + +IVV TPGR++DH+ N + L GF ++ +++ C K ++ Sbjct: 123 N-ANIVVGTPGRILDHI-NRGTLNLKNVKYFILDEADEXLNXGFIKDVEKILNACNKDKR 180 Query: 305 TMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTXXXXXXXXXXXXNQ--EAVLL 362 +LFSAT ++ L+L K + D S + + + N+ EA+ Sbjct: 181 ILLFSATXPREI-----LNLAK--KYXGDYSFIK-AKINANIEQSYVEVNENERFEALCR 232 Query: 363 SLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVD 422 L +K F ++F TK+ L KA +HG+L+Q+QR + + LF+++ + Sbjct: 233 LLKNKEFYG--LVFCKTKRDTKELASXLRDIGFKAGAIHGDLSQSQREKVIRLFKQKKIR 290 Query: 423 FLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLL 482 LIATDV +RG+D+ + VINY P++ SY HR+GRT RAG++G A++ + + L Sbjct: 291 ILIATDVXSRGIDVNDLNCVINYHLPQNPESYXHRIGRTGRAGKKGKAISIINRREYKKL 350 Query: 483 KAIAK 487 + I + Sbjct: 351 RYIER 355
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|4GL2|A Chain A, Structural Basis For Dsrna Duplex Backbone Recognition By Mda5 Length = 699 Back     alignment and structure
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query643
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-130
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-128
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 1e-122
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-121
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-118
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-116
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 1e-115
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-115
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-112
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 1e-110
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 1e-109
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-108
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 1e-108
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 1e-107
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-105
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 1e-104
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-104
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-103
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 4e-89
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 2e-76
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 7e-73
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 7e-73
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 4e-71
3bor_A237 Human initiation factor 4A-II; translation initiat 3e-70
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 6e-70
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 7e-69
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 7e-68
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 7e-67
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 5e-66
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 8e-65
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 6e-63
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 5e-44
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 4e-41
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 5e-41
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 9e-41
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 2e-39
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 3e-38
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 4e-35
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 6e-33
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 9e-33
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-17
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 5e-17
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 6e-14
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-13
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 1e-11
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-11
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-10
3b6e_A216 Interferon-induced helicase C domain-containing P; 2e-11
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 3e-11
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 6e-09
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 3e-11
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 4e-10
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 3e-11
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-10
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 5e-11
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 9e-11
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 2e-10
1yks_A440 Genome polyprotein [contains: flavivirin protease 3e-09
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 9e-09
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 1e-08
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 1e-08
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 3e-08
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 1e-07
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 6e-06
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 4e-05
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 6e-05
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 1e-04
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 1e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-04
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
 Score =  392 bits (1009), Expect = e-130
 Identities = 120/503 (23%), Positives = 214/503 (42%), Gaps = 38/503 (7%)

Query: 49  YSESVSDEHFRRRTTSVDFKITKSLQQRSVPIVDNDHSDSEFDQHEDYKPEDEDDFSNAG 108
              +    +F R   + +    ++ +  S P   +   D E    +    +         
Sbjct: 5   NDGNRDQRNFGRNQRNNNSNRYRNSRFNSRPRTRSREDDDEVHFDKTTFSKLIHVPKEDN 64

Query: 109 DTKSFFAPADGASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTG--RDIC 166
             +             +   E  L + + +A   + +   TP+Q   I   L+    D+ 
Sbjct: 65  SKEVTLD---------SLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVI 115

Query: 167 GSAITGSGKTAAFALPTLERLL-YRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFT-- 223
             A TG+GKT AF +P  + L+  +      ++ +I+ PTR+LA+Q+ + ++KI      
Sbjct: 116 ARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYG 175

Query: 224 --DIRCCLVVGGLSTKMQETALRSM-PDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEA 280
                C  +VGG   +     +  + P+IV+ATPGR+ID L    +     +   +LDEA
Sbjct: 176 LKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEA 235

Query: 281 DRLLELGFSAEIHELVRLCPKRR-------QTMLFSATLTEDVDELIKLSLTKPLRLSAD 333
           DRLLE+GF  ++  +  +  ++        +T+LFSATL + V +L    + K   L  D
Sbjct: 236 DRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLD 295

Query: 334 PSAKR----PSTLTEEVVRIRRMREVNQEAVLLSLC---SKTFTSKVIIFSGTKQAAHRL 386
              K        + + VV   +       AV         +    K IIF+ T +    L
Sbjct: 296 TVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFL 355

Query: 387 KILFGLAA---LKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVI 443
             +        L   E HG +TQ +R   ++ F+K     L+ TDV ARG+D   V  V+
Sbjct: 356 CSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVL 415

Query: 444 NYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSI 503
               P +L +Y+HR+GRTAR+G+EG +V F+  ++   ++ +           I  ++  
Sbjct: 416 QIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELED----AKNIVIAKQEKY 471

Query: 504 TKWSKIIEQMEDQVAAILQEERE 526
               +I  ++ + V    ++  +
Sbjct: 472 EPSEEIKSEVLEAVTEEPEDISD 494


>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Length = 1054 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 643
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 1e-50
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 2e-46
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 4e-45
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 5e-45
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 1e-44
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 3e-43
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 9e-42
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 8e-41
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 3e-36
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 2e-34
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 1e-31
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 2e-28
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 2e-24
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 5e-24
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 7e-21
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 1e-20
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-18
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 2e-18
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 4e-16
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 6e-15
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 4e-14
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 9e-14
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 2e-13
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 2e-11
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 9e-11
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 2e-10
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-10
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 5e-07
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 3e-04
d1gm5a4206 c.37.1.19 (A:550-755) RecG helicase domain {Thermo 0.001
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 0.002
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score =  172 bits (437), Expect = 1e-50
 Identities = 78/208 (37%), Positives = 120/208 (57%), Gaps = 7/208 (3%)

Query: 126 SFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGR-DICGSAITGSGKTAAFALPTL 184
           +F ELNLS  +L A    G+ KPT IQ   IPL L    +I   A TGSGKTA+FA+P +
Sbjct: 5   NFNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIPLI 64

Query: 185 ERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALR 244
           E +            +ILTPTRELA+QV   IE +    +++   + GG +   Q  AL+
Sbjct: 65  ELVNENNGIEA----IILTPTRELAIQVADEIESLKGNKNLKIAKIYGGKAIYPQIKALK 120

Query: 245 SMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQ 304
           +  +IVV TPGR++DH+    +++L ++   ILDEAD +L +GF  ++ +++  C K ++
Sbjct: 121 N-ANIVVGTPGRILDHINRG-TLNLKNVKYFILDEADEMLNMGFIKDVEKILNACNKDKR 178

Query: 305 TMLFSATLTEDVDELIKLSLTKPLRLSA 332
            +LFSAT+  ++  L K  +     + A
Sbjct: 179 ILLFSATMPREILNLAKKYMGDYSFIKA 206


>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 206 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query643
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.96
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.96
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.96
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.96
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.95
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.95
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.95
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.94
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.93
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.93
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.93
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.92
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.92
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.89
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.82
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.82
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.79
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.79
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.78
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.77
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.76
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.76
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.75
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.75
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.68
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.64
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.64
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.64
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.63
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.54
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.49
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.43
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.16
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 99.08
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 99.0
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.61
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.41
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.61
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 97.55
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 97.49
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 97.45
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.07
d2qy9a2211 GTPase domain of the signal recognition particle r 97.03
d1vmaa2213 GTPase domain of the signal recognition particle r 96.93
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.92
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.91
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.82
d1okkd2207 GTPase domain of the signal recognition particle r 96.6
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 96.4
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.32
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.76
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 95.7
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.59
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.32
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.21
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.64
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.62
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.18
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.03
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 93.64
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 93.58
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 93.52
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 93.23
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 92.45
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 91.57
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 91.31
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 90.83
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 90.48
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 89.93
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 89.92
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 88.97
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 88.7
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 88.7
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 88.23
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 87.03
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 85.12
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 85.02
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 84.81
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 84.67
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 84.42
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 83.78
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 82.45
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 80.21
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=8.7e-42  Score=287.16  Aligned_cols=206  Identities=33%  Similarity=0.562  Sum_probs=192.6

Q ss_pred             CCCCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEE
Q ss_conf             66886568999889999998799999788999999983599868985799446899377599998429999998189998
Q 006500          123 HANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLIL  202 (643)
Q Consensus       123 ~~~~~~~l~l~~~l~~~l~~~g~~~~~~~Q~~~i~~~l~g~d~li~~~TGsGKT~~~~l~~l~~l~~~~~~~~~~~vLil  202 (643)
                      ...+|++++|++.+++++..+||..|+++|..+||.++.|+|+++.++||||||++|++|+++.+....   ..++++|+
T Consensus        15 ~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~---~~~~~lil   91 (222)
T d2j0sa1          15 VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQV---RETQALIL   91 (222)
T ss_dssp             CCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTS---CSCCEEEE
T ss_pred             CCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCEEEECCCCHHHHHHHCCCCCCCCCCCC---CCCEEEEE
T ss_conf             999977779899999999987999999999999999987998699757434145440454011003334---67425775


Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHCCCCCEEEECCHHHHHHHHCCCCCCCCCEEEEEEECCCH
Q ss_conf             58289999999999997513894699985698747899974489969998924689988426865788811999818740
Q 006500          203 TPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADR  282 (643)
Q Consensus       203 ~Ptr~La~Q~~~~~~~l~~~~~~~v~~~~g~~~~~~~~~~l~~~~~Iii~Tp~~L~~~l~~~~~~~l~~i~~iViDEah~  282 (643)
                      +||++||.|+++.+..++.+.++++..++|+.....+...+..+++|+|+||++|.+++... ...+.+++++|+||||+
T Consensus        92 ~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~-~~~~~~l~~lVlDEaD~  170 (222)
T d2j0sa1          92 APTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRR-SLRTRAIKMLVLDEADE  170 (222)
T ss_dssp             CSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTT-SSCCTTCCEEEEETHHH
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCHHHHHHHCCCCEEEECCCCCHHHCCCCC-CCCCCCCEEEEECCHHH
T ss_conf             55288889999999998475634588875112102467875148738867987577612001-03444230355422467


Q ss_pred             HCCCCHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHCCCCEEEEC
Q ss_conf             00389099999999979999606887502413399999985599838724
Q 006500          283 LLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSA  332 (643)
Q Consensus       283 l~~~~~~~~~~~i~~~~~~~~q~i~~SAT~~~~~~~~~~~~~~~p~~~~~  332 (643)
                      |++.||...+..+++.+|+.+|+++||||+++++.++++.++++|+.+.+
T Consensus       171 ll~~~f~~~i~~I~~~l~~~~Q~ilfSAT~~~~v~~l~~~~l~~Pv~I~V  220 (222)
T d2j0sa1         171 MLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILV  220 (222)
T ss_dssp             HTSTTTHHHHHHHHTTSCTTCEEEEEESCCCHHHHTTGGGTCSSCEEECC
T ss_pred             HHHCCCHHHHHHHHHHCCCCCEEEEEEEECCHHHHHHHHHHCCCCEEEEE
T ss_conf             65257399999999968988879999972888999999998899889997



>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure