Citrus Sinensis ID: 006562


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAVI
cccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHcHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHccccHHHcHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccccHHHHHHcccHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccccccHHHHHcccHHHHccccccHHHHHHcHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccEEEccccccccccHHHHHcccccccEcccccccHHHHHHHcccccccHHccccHHcccccccccHHcHcccccccHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHcc
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGcafsalgrkEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKqdrsvtceydvsnsmssltvsesglnandkmsetsenhnksdicdsssqsrdvsetcsksshdpdlcngrsdeakggssvpvsksglhingklrevsenhngssdgsksthasrdaseinrqssddfdicngpidkasvnerhgrqtngthdvhdklssdsaslndsntnsesyskssisdnkssdstesrsklSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQilkedpmypealigRGTARAFQRELEAAISDFTEAiqsnpsagEAWKRRGQARAALGESVEAIQDLSKalefepnsadilhergivnfkfkdFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDlssglgidpsnieCLYLRASCYHAIGEYREAVI
mlkrklldsryrlnkthkticeidelvrvDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETsenhnksdicdsssqsrDVSEtcsksshdpdlcngrsdeakggssvpvsksgLHINGKLrevsenhngssdgsksthasrdaseinrqssddfdicNGPIDKAsvnerhgrqtngthdvhdklssdsaslndsntnsesyskssisdnkssdstesrsklsfkWDMLKetsneakrnkkfcvtrisksksisvdfrlsrgiaqvnegkyASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAVI
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAkggssvpvsksgLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKlssdsaslndsntnsesyskssisdnkssdstesrsklsFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYhlrglllhglgqhKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAVI
*********RYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQ**SVTCE************************************************************************************************************************************************************************************************************KFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDF*************************************LEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYR****
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAVI
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNAN*************************************LCNGRS**********VSKSGLHINGKLREVS***********************RQSSDDFDICNGPIDKASVNER**************************************************KLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQS******************GESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAVI
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAVI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query640 2.2.26 [Sep-21-2011]
Q8NBP0 860 Tetratricopeptide repeat yes no 0.385 0.287 0.296 1e-27
Q8RVB2 931 Probable UDP-N-acetylgluc N/A no 0.354 0.243 0.243 2e-11
O82039 932 Probable UDP-N-acetylgluc N/A no 0.340 0.233 0.248 2e-10
Q9M8Y0 977 Probable UDP-N-acetylgluc no no 0.317 0.207 0.247 3e-10
Q68FQ7 659 RNA polymerase II-associa no no 0.367 0.356 0.276 6e-10
Q58741314 TPR repeat-containing pro yes no 0.284 0.579 0.268 1e-09
Q5ZKQ3 665 RNA polymerase II-associa no no 0.368 0.354 0.252 2e-09
Q96301 914 Probable UDP-N-acetylgluc no no 0.340 0.238 0.248 3e-09
Q54VG4334 Small glutamine-rich tetr no no 0.181 0.347 0.316 3e-09
Q9H6T3 665 RNA polymerase II-associa no no 0.367 0.353 0.26 5e-09
>sp|Q8NBP0|TTC13_HUMAN Tetratricopeptide repeat protein 13 OS=Homo sapiens GN=TTC13 PE=2 SV=3 Back     alignment and function desciption
 Score =  125 bits (314), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 134/253 (52%), Gaps = 6/253 (2%)

Query: 392 VNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQ-----RELEAAISDFTEAIQSNP 446
           +  G Y  AI  F  +L+E+P    A+ GRG A   +     +  E A+ + +  I   P
Sbjct: 154 IGSGLYDEAIRHFSTMLQEEPDLVSAIYGRGIAYGKKGLHDIKNAELALFELSRVITLEP 213

Query: 447 SAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDL 506
              E +++R +  + LG   EA+ DL+KA++ +P SA +   RG + F  +D+  A ED 
Sbjct: 214 DRPEVFEQRAEILSPLGRINEAVNDLTKAIQLQP-SARLYRHRGTLYFISEDYATAHEDF 272

Query: 507 SACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLAN 566
              ++L+K    A  Y GL     G  K+A E+  +A++   +F++A+  L Q Y++L N
Sbjct: 273 QQSLELNKNQPIAMLYKGLTFFHRGLLKEAIESFKEALKQKVDFIDAYKSLGQAYRELGN 332

Query: 567 SEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRA 626
            E A E  Q+ L +++   +   LRG++L+  G  ++A+K+    L ++P N  C Y++ 
Sbjct: 333 FEAATESFQKALLLNQNHVQTLQLRGMMLYHHGSLQEALKNFKRCLQLEPYNEVCQYMKG 392

Query: 627 SCYHAIGEYREAV 639
             + A+G++ E +
Sbjct: 393 LSHVAMGQFYEGI 405





Homo sapiens (taxid: 9606)
>sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 Back     alignment and function description
>sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=2 SV=1 Back     alignment and function description
>sp|Q58741|Y1345_METJA TPR repeat-containing protein MJ1345 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1345 PE=4 SV=1 Back     alignment and function description
>sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 Back     alignment and function description
>sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 Back     alignment and function description
>sp|Q54VG4|SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum GN=sgt PE=1 SV=1 Back     alignment and function description
>sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query640
255567975 1101 tetratricopeptide repeat protein, tpr, p 0.942 0.547 0.671 0.0
225438920 1068 PREDICTED: tetratricopeptide repeat prot 0.893 0.535 0.655 0.0
449448472 1046 PREDICTED: tetratricopeptide repeat prot 0.85 0.520 0.590 0.0
449520722 1046 PREDICTED: tetratricopeptide repeat prot 0.85 0.520 0.590 0.0
356565517 1042 PREDICTED: tetratricopeptide repeat prot 0.842 0.517 0.592 0.0
224071273526 predicted protein [Populus trichocarpa] 0.820 0.998 0.676 0.0
356514306 1050 PREDICTED: tetratricopeptide repeat prot 0.826 0.503 0.583 1e-180
356496945 1047 PREDICTED: tetratricopeptide repeat prot 0.837 0.511 0.575 1e-176
297798124 1043 hypothetical protein ARALYDRAFT_912592 [ 0.837 0.513 0.555 1e-171
4468812 1013 putative protein [Arabidopsis thaliana] 0.846 0.535 0.549 1e-169
>gi|255567975|ref|XP_002524965.1| tetratricopeptide repeat protein, tpr, putative [Ricinus communis] gi|223535800|gb|EEF37462.1| tetratricopeptide repeat protein, tpr, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/608 (67%), Positives = 478/608 (78%), Gaps = 5/608 (0%)

Query: 33  MASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDC 92
           MASAI+ R+ELAKLC+ R+WSKAIR+LDSLL+QS  IQDICNRAFCYSQLELHKHVI+DC
Sbjct: 1   MASAISERVELAKLCASRDWSKAIRVLDSLLSQSCTIQDICNRAFCYSQLELHKHVIKDC 60

Query: 93  DKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTA 152
           DKALQLDP LLQAYILKG AFS+LGRK++AL VW++GYEHAL QSADLKQ LELEELL  
Sbjct: 61  DKALQLDPMLLQAYILKGRAFSSLGRKDDALLVWQQGYEHALRQSADLKQLLELEELLKF 120

Query: 153 AKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNK-SDICDSSSQSRDVSETC 211
           AKQ+R++     V+ S + +  +E   + N K +E S+N ++ SDI +S  +S D SE C
Sbjct: 121 AKQERNIGLRDHVTES-TPMNTTEFATHTNGKSNEASKNRDQLSDISNSCRESGDGSEIC 179

Query: 212 SKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDAS 271
           SK   + D  N   D+A G S + + +   H+NGK  +V  NH+   D SK  + SRD  
Sbjct: 180 SKFGGNFDAMNVIRDKAGGESPITIPECRPHMNGKSDDVCTNHDKLGDKSKLHNESRDTY 239

Query: 272 EINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKS 331
           +I   S D+  I N    KA  + +  +  NGTH+  DK+S DS S N  +  S   SKS
Sbjct: 240 KICCNSGDNCAIQNYLSRKAEGDVKTDK--NGTHNFIDKIS-DSESCNVLSDTSVPSSKS 296

Query: 332 SISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQ 391
           S     S D+++ R KLS K D+  E  +E K++KKF VTRISK+KSI+VDFRLSRGIAQ
Sbjct: 297 STISISSGDTSDIRVKLSNKTDIPNEAGDETKKSKKFSVTRISKTKSITVDFRLSRGIAQ 356

Query: 392 VNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEA 451
           VNEGKYASAISIFDQIL EDP YPEALIGRGTA AFQRELEAAI+DF++AIQSNP AGEA
Sbjct: 357 VNEGKYASAISIFDQILTEDPTYPEALIGRGTAHAFQRELEAAIADFSKAIQSNPLAGEA 416

Query: 452 WKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVK 511
           WKRRGQARAALGES+EAI DL+KALEFEPNSADILHERGIVNFKFKDF+AAV+DLSACVK
Sbjct: 417 WKRRGQARAALGESIEAIHDLTKALEFEPNSADILHERGIVNFKFKDFDAAVQDLSACVK 476

Query: 512 LDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKAL 571
           LDK+NKSAYTYLGLALSS GEYKKAEEAHLK+IQLDR+FLE W HLTQFYQDLAN  KA 
Sbjct: 477 LDKDNKSAYTYLGLALSSTGEYKKAEEAHLKSIQLDRSFLEGWAHLTQFYQDLANLTKAF 536

Query: 572 ECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHA 631
           EC++QVL ID RF+KAYHL GLLLHG+G+H+KAIK+LS GL I+ SNIECLYLRASCYHA
Sbjct: 537 ECIKQVLQIDARFAKAYHLHGLLLHGMGEHRKAIKELSLGLSIENSNIECLYLRASCYHA 596

Query: 632 IGEYREAV 639
           IGEY EAV
Sbjct: 597 IGEYGEAV 604




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225438920|ref|XP_002279290.1| PREDICTED: tetratricopeptide repeat protein 13-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449448472|ref|XP_004141990.1| PREDICTED: tetratricopeptide repeat protein 13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449520722|ref|XP_004167382.1| PREDICTED: tetratricopeptide repeat protein 13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356565517|ref|XP_003550986.1| PREDICTED: tetratricopeptide repeat protein 13-like [Glycine max] Back     alignment and taxonomy information
>gi|224071273|ref|XP_002303385.1| predicted protein [Populus trichocarpa] gi|222840817|gb|EEE78364.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356514306|ref|XP_003525847.1| PREDICTED: tetratricopeptide repeat protein 13-like [Glycine max] Back     alignment and taxonomy information
>gi|356496945|ref|XP_003517325.1| PREDICTED: tetratricopeptide repeat protein 13-like [Glycine max] Back     alignment and taxonomy information
>gi|297798124|ref|XP_002866946.1| hypothetical protein ARALYDRAFT_912592 [Arabidopsis lyrata subsp. lyrata] gi|297312782|gb|EFH43205.1| hypothetical protein ARALYDRAFT_912592 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|4468812|emb|CAB38213.1| putative protein [Arabidopsis thaliana] gi|7270728|emb|CAB80411.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query640
TAIR|locus:2126347 1052 SRFR1 "SUPPRESSOR OF RPS4-RLD 0.437 0.266 0.704 4.6e-148
DICTYBASE|DDB_G0272186 1050 DDB_G0272186 "TPR_1 repeat-con 0.348 0.212 0.290 6.1e-29
ZFIN|ZDB-GENE-080722-25 826 ttc13 "tetratricopeptide repea 0.396 0.307 0.284 2.5e-23
UNIPROTKB|Q74DZ8266 GSU1166 "TPR domain protein" [ 0.348 0.838 0.271 9.1e-15
TIGR_CMR|GSU_1166266 GSU_1166 "TPR domain protein" 0.348 0.838 0.271 9.1e-15
UNIPROTKB|Q08E34609 TOMM70A "Translocase of outer 0.414 0.435 0.220 2.6e-12
UNIPROTKB|O94826608 TOMM70A "Mitochondrial import 0.414 0.435 0.216 5.5e-12
UNIPROTKB|F1NNH9599 TOMM70A "Uncharacterized prote 0.401 0.429 0.221 6.6e-12
UNIPROTKB|P72802266 mom72 "Mitochondrial outer mem 0.284 0.684 0.279 7.2e-12
RGD|1303049610 Tomm70a "translocase of outer 0.414 0.434 0.220 3.3e-11
TAIR|locus:2126347 SRFR1 "SUPPRESSOR OF RPS4-RLD 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1023 (365.2 bits), Expect = 4.6e-148, Sum P(2) = 4.6e-148
 Identities = 198/281 (70%), Positives = 236/281 (83%)

Query:   359 SNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEAL 418
             S+E+++NKK+ + RIS + SISVDFRLSRGIAQVNEG Y  AISIFD++LKE+P YPEAL
Sbjct:   275 SDESRKNKKYTIARISGTHSISVDFRLSRGIAQVNEGNYTKAISIFDKVLKEEPTYPEAL 334

Query:   419 IGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEF 478
             IGRGTA AFQRELE+AI+DFT+AIQSNP+A EAWKRRGQARAALGE VEA++DL+KAL F
Sbjct:   335 IGRGTAYAFQRELESAIADFTKAIQSNPAASEAWKRRGQARAALGEYVEAVEDLTKALVF 394

Query:   479 EPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEE 538
             EPNS D+LHERGIVNFK KDF AAV+DLS C+K +K+NKSAYTYLGLA +S+GEYKKAEE
Sbjct:   395 EPNSPDVLHERGIVNFKSKDFTAAVKDLSICLKQEKDNKSAYTYLGLAFASLGEYKKAEE 454

Query:   539 AHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYXXXXXXXXXX 598
             AHLK+IQLD N+LEAW HL QFYQ+LA+  KALEC++QVL +D R  KAY          
Sbjct:   455 AHLKSIQLDSNYLEAWLHLAQFYQELADHCKALECIEQVLQVDNRVWKAYHLRGLVFHGL 514

Query:   599 XXXKKAIKDLSSGLGIDPSNIECLYLRASCYHAIGEYREAV 639
                +KAI++LS GL I+ + IECLYLR SCYHA+GEYR+AV
Sbjct:   515 GEHRKAIQELSIGLSIE-NTIECLYLRGSCYHAVGEYRDAV 554


GO:0042742 "defense response to bacterium" evidence=IGI
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0009816 "defense response to bacterium, incompatible interaction" evidence=IMP
GO:0032947 "protein complex scaffold" evidence=TAS
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=TAS
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
GO:0031348 "negative regulation of defense response" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0010048 "vernalization response" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
DICTYBASE|DDB_G0272186 DDB_G0272186 "TPR_1 repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080722-25 ttc13 "tetratricopeptide repeat domain 13" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q74DZ8 GSU1166 "TPR domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1166 GSU_1166 "TPR domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q08E34 TOMM70A "Translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O94826 TOMM70A "Mitochondrial import receptor subunit TOM70" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNH9 TOMM70A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P72802 mom72 "Mitochondrial outer membrane 72K protein" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
RGD|1303049 Tomm70a "translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00030573
hypothetical protein (526 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query640
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-17
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-17
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-16
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 3e-15
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-14
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-13
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-13
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 8e-13
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 8e-13
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-12
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 3e-12
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-11
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-11
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 3e-11
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-10
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-09
pfam1341469 pfam13414, TPR_11, TPR repeat 8e-09
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 1e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-08
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 3e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-08
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-07
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-07
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 7e-07
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 8e-07
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 1e-06
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-06
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-06
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-06
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 6e-06
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 6e-06
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 7e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 9e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-05
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 3e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-05
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 1e-04
TIGR02795117 TIGR02795, tol_pal_ybgF, tol-pal system protein Yb 1e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 3e-04
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 3e-04
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 4e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 4e-04
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 7e-04
TIGR03939 800 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g 7e-04
COG2956 389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 7e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.001
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 0.001
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.001
pfam1289580 pfam12895, Apc3, Anaphase-promoting complex, cyclo 0.001
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.002
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.003
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 0.003
PRK09782 987 PRK09782, PRK09782, bacteriophage N4 receptor, out 0.004
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 77.4 bits (191), Expect = 2e-17
 Identities = 37/100 (37%), Positives = 57/100 (57%)

Query: 450 EAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSAC 509
           EA    G     LG+  EA++   KALE +P++AD  +      +K   +  A+ED    
Sbjct: 1   EALLNLGNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKA 60

Query: 510 VKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRN 549
           ++LD +N  AY  LGLA   +G+Y++A EA+ KA++LD N
Sbjct: 61  LELDPDNAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100


Length = 100

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|188247 TIGR02795, tol_pal_ybgF, tol-pal system protein YbgF Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|221837 pfam12895, Apc3, Anaphase-promoting complex, cyclosome, subunit 3 Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|236624 PRK09782, PRK09782, bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 640
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG0547606 consensus Translocase of outer mitochondrial membr 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.98
KOG0547606 consensus Translocase of outer mitochondrial membr 99.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.97
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.97
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.96
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.96
KOG1126638 consensus DNA-binding cell division cycle control 99.96
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.95
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.95
KOG1126638 consensus DNA-binding cell division cycle control 99.95
KOG2003 840 consensus TPR repeat-containing protein [General f 99.94
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.94
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.94
PRK11788389 tetratricopeptide repeat protein; Provisional 99.94
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.94
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
KOG2003 840 consensus TPR repeat-containing protein [General f 99.92
PRK14574 822 hmsH outer membrane protein; Provisional 99.91
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.91
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 99.9
KOG2076 895 consensus RNA polymerase III transcription factor 99.9
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.9
KOG1129478 consensus TPR repeat-containing protein [General f 99.89
PRK12370553 invasion protein regulator; Provisional 99.89
KOG2076 895 consensus RNA polymerase III transcription factor 99.88
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.87
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.87
PRK14574 822 hmsH outer membrane protein; Provisional 99.87
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.87
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.86
PRK11189296 lipoprotein NlpI; Provisional 99.86
KOG1125579 consensus TPR repeat-containing protein [General f 99.86
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.86
PRK12370553 invasion protein regulator; Provisional 99.85
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.85
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.84
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.84
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.84
PRK11189296 lipoprotein NlpI; Provisional 99.84
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.84
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.83
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.83
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.83
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.83
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.83
KOG1129478 consensus TPR repeat-containing protein [General f 99.82
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.82
KOG3785 557 consensus Uncharacterized conserved protein [Funct 99.81
PLN02789320 farnesyltranstransferase 99.81
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.81
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.8
PLN03218 1060 maturation of RBCL 1; Provisional 99.79
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.78
KOG1125579 consensus TPR repeat-containing protein [General f 99.78
KOG0553304 consensus TPR repeat-containing protein [General f 99.78
PLN03077 857 Protein ECB2; Provisional 99.78
PLN03218 1060 maturation of RBCL 1; Provisional 99.78
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.78
PLN02789320 farnesyltranstransferase 99.77
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.77
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.76
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.75
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.75
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.73
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.73
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.73
KOG1915677 consensus Cell cycle control protein (crooked neck 99.72
PLN03077 857 Protein ECB2; Provisional 99.71
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.68
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.67
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.66
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.66
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.65
PRK15359144 type III secretion system chaperone protein SscB; 99.62
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.6
PRK15359144 type III secretion system chaperone protein SscB; 99.6
KOG4234271 consensus TPR repeat-containing protein [General f 99.6
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.59
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.58
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.56
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.56
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.55
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.55
PRK10370198 formate-dependent nitrite reductase complex subuni 99.54
PRK10370198 formate-dependent nitrite reductase complex subuni 99.54
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.53
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.53
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.53
KOG1915677 consensus Cell cycle control protein (crooked neck 99.52
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.51
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.51
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.5
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.48
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.45
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.45
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.44
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.43
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.43
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.41
KOG4648536 consensus Uncharacterized conserved protein, conta 99.41
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.4
KOG0553304 consensus TPR repeat-containing protein [General f 99.4
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.4
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.37
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.35
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.34
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.34
PRK04841 903 transcriptional regulator MalT; Provisional 99.33
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.33
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.32
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.32
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.31
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 99.27
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.26
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.25
KOG4340 459 consensus Uncharacterized conserved protein [Funct 99.24
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.24
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.23
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.22
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.22
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.17
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.17
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.17
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.16
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.15
PRK04841 903 transcriptional regulator MalT; Provisional 99.14
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.09
PRK11906458 transcriptional regulator; Provisional 99.07
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.06
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.06
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 99.05
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.05
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.05
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.05
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.04
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.03
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.03
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.02
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.01
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.0
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.99
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.98
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.98
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.98
PRK11906458 transcriptional regulator; Provisional 98.98
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.97
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.97
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.97
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.97
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.97
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.95
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.95
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.93
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.92
PRK15331165 chaperone protein SicA; Provisional 98.92
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.9
PRK15331165 chaperone protein SicA; Provisional 98.89
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.88
PRK10803263 tol-pal system protein YbgF; Provisional 98.88
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.86
KOG4555175 consensus TPR repeat-containing protein [Function 98.86
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.85
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.84
PRK10803263 tol-pal system protein YbgF; Provisional 98.81
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.81
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.8
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.77
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.77
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.75
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.74
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.74
PF1337173 TPR_9: Tetratricopeptide repeat 98.72
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.72
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.71
PF12688120 TPR_5: Tetratrico peptide repeat 98.71
PF12688120 TPR_5: Tetratrico peptide repeat 98.69
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.68
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.65
PF13512142 TPR_18: Tetratricopeptide repeat 98.64
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.62
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.61
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.6
KOG4234271 consensus TPR repeat-containing protein [General f 98.59
COG4700251 Uncharacterized protein conserved in bacteria cont 98.57
PF1337173 TPR_9: Tetratricopeptide repeat 98.57
COG4700251 Uncharacterized protein conserved in bacteria cont 98.55
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.5
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.5
PF13512142 TPR_18: Tetratricopeptide repeat 98.48
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.48
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.47
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.42
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.38
KOG2471696 consensus TPR repeat-containing protein [General f 98.35
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.33
KOG2471 696 consensus TPR repeat-containing protein [General f 98.31
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.31
KOG4555175 consensus TPR repeat-containing protein [Function 98.3
KOG2610 491 consensus Uncharacterized conserved protein [Funct 98.27
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.23
KOG1586288 consensus Protein required for fusion of vesicles 98.23
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.22
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.18
PF1343134 TPR_17: Tetratricopeptide repeat 98.15
KOG2610 491 consensus Uncharacterized conserved protein [Funct 98.15
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.14
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.12
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.1
KOG1586288 consensus Protein required for fusion of vesicles 98.09
PF1342844 TPR_14: Tetratricopeptide repeat 98.08
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.08
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.06
PF13281374 DUF4071: Domain of unknown function (DUF4071) 98.06
KOG1585308 consensus Protein required for fusion of vesicles 98.06
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.02
PF1342844 TPR_14: Tetratricopeptide repeat 98.0
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.97
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.94
KOG1585308 consensus Protein required for fusion of vesicles 97.88
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.88
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.88
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.82
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.77
PF1343134 TPR_17: Tetratricopeptide repeat 97.76
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.75
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.7
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.68
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.68
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.68
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.66
KOG1310758 consensus WD40 repeat protein [General function pr 97.64
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.58
KOG1550552 consensus Extracellular protein SEL-1 and related 97.57
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.54
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.53
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.49
KOG1258 577 consensus mRNA processing protein [RNA processing 97.49
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.47
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.44
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.42
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.4
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.39
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.31
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.31
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.26
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.25
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.22
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.22
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.22
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 97.21
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.21
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.12
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.12
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.12
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.11
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.1
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.09
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.09
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.08
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.05
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.93
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.91
KOG1550552 consensus Extracellular protein SEL-1 and related 96.72
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.68
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.67
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.63
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.59
KOG4507886 consensus Uncharacterized conserved protein, conta 96.58
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.57
PRK10941269 hypothetical protein; Provisional 96.56
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.56
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.5
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.48
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 96.48
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.41
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.39
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.3
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 96.29
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 96.26
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.22
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.17
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.17
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.14
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.14
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.13
PRK10941269 hypothetical protein; Provisional 96.11
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 96.04
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.03
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 95.93
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.89
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 95.82
KOG2041 1189 consensus WD40 repeat protein [General function pr 95.8
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.79
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 95.77
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.75
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.67
COG4976287 Predicted methyltransferase (contains TPR repeat) 95.66
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.65
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 95.56
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.5
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.48
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.46
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 95.39
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.37
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.26
KOG4814872 consensus Uncharacterized conserved protein [Funct 95.24
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 95.2
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 95.14
KOG3364149 consensus Membrane protein involved in organellar 95.11
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.99
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 94.95
KOG2041 1189 consensus WD40 repeat protein [General function pr 94.62
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.59
KOG3364149 consensus Membrane protein involved in organellar 94.51
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 94.4
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.36
KOG3783546 consensus Uncharacterized conserved protein [Funct 94.24
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.17
KOG1310 758 consensus WD40 repeat protein [General function pr 94.06
COG5191 435 Uncharacterized conserved protein, contains HAT (H 93.82
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.81
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.71
KOG2422 665 consensus Uncharacterized conserved protein [Funct 93.7
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.69
KOG4814 872 consensus Uncharacterized conserved protein [Funct 93.67
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 93.62
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 93.58
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.54
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.52
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.43
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.43
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.31
KOG0529 421 consensus Protein geranylgeranyltransferase type I 93.31
COG5191 435 Uncharacterized conserved protein, contains HAT (H 93.31
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 93.23
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 93.14
KOG2422 665 consensus Uncharacterized conserved protein [Funct 93.08
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.69
COG3629280 DnrI DNA-binding transcriptional activator of the 92.17
KOG2581493 consensus 26S proteasome regulatory complex, subun 92.14
KOG0529 421 consensus Protein geranylgeranyltransferase type I 92.07
KOG1463411 consensus 26S proteasome regulatory complex, subun 91.99
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 91.92
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.86
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.82
COG1747 711 Uncharacterized N-terminal domain of the transcrip 91.44
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 91.31
COG2912269 Uncharacterized conserved protein [Function unknow 91.02
COG5159421 RPN6 26S proteasome regulatory complex component [ 91.01
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 90.78
COG2912269 Uncharacterized conserved protein [Function unknow 90.71
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 90.56
KOG1258577 consensus mRNA processing protein [RNA processing 90.05
KOG2581493 consensus 26S proteasome regulatory complex, subun 89.9
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 89.6
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 89.44
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 89.37
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.25
COG5159 421 RPN6 26S proteasome regulatory complex component [ 89.22
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 88.98
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 88.96
COG3947361 Response regulator containing CheY-like receiver a 88.35
COG3629280 DnrI DNA-binding transcriptional activator of the 87.88
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 87.36
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 87.23
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 86.96
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 86.82
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 86.63
COG4941415 Predicted RNA polymerase sigma factor containing a 86.61
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 85.98
PRK11619 644 lytic murein transglycosylase; Provisional 85.7
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 84.72
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 84.46
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 84.44
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 83.64
KOG1463411 consensus 26S proteasome regulatory complex, subun 83.18
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 82.89
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 82.85
PF1304150 PPR_2: PPR repeat family 82.6
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 81.95
PRK11619 644 lytic murein transglycosylase; Provisional 81.81
COG3947361 Response regulator containing CheY-like receiver a 81.5
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 81.23
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 81.09
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 80.69
PHA02537230 M terminase endonuclease subunit; Provisional 80.09
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=2.2e-41  Score=325.69  Aligned_cols=267  Identities=18%  Similarity=0.232  Sum_probs=257.9

Q ss_pred             HHhhhhccCcccHHHHHHHHHHHHHcCChHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCc
Q 006562          369 CVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSA  448 (640)
Q Consensus       369 ~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~  448 (640)
                      .+.++.+.+|.-+++++++|.+|-..+.|++|+..|.+++...|+++.++-++|.+|+.+|..+-|+..|+++++..|+.
T Consensus       240 ~y~eAvkldP~f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~~P~F  319 (966)
T KOG4626|consen  240 HYEEAVKLDPNFLDAYINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYKRALELQPNF  319 (966)
T ss_pred             HHHHhhcCCCcchHHHhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccceEEEEeccccHHHHHHHHHHHHhcCCCc
Confidence            45667789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHH
Q 006562          449 GEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALS  528 (640)
Q Consensus       449 ~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~la~~~~  528 (640)
                      ++++.++|..+...|+..+|..+|.+++.+.|.++++.+++|.++..+|.+++|...|.++++..|....++.++|.+|.
T Consensus       320 ~~Ay~NlanALkd~G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa~nNLa~i~k  399 (966)
T KOG4626|consen  320 PDAYNNLANALKDKGSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNNLASIYK  399 (966)
T ss_pred             hHHHhHHHHHHHhccchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhhhhhhhhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCHHHHHHHHHHHHccCcccHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhcCCHHHHHHHH
Q 006562          529 SIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDL  608 (640)
Q Consensus       529 ~~g~~~~A~~~~~~a~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~la~~~~~~g~~~~A~~~~  608 (640)
                      ++|++++|+.+|++++++.|...+++.++|..|..+|+.+.|+..|.+++..+|..++++.++|.+|...|+..+|+..|
T Consensus       400 qqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~AeAhsNLasi~kDsGni~~AI~sY  479 (966)
T KOG4626|consen  400 QQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAEAHSNLASIYKDSGNIPEAIQSY  479 (966)
T ss_pred             hcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHHHHhhHHHHhhccCCcHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhccCCCCHHHHHHHHHHHHHcCCc
Q 006562          609 SSGLGIDPSNIECLYLRASCYHAIGEY  635 (640)
Q Consensus       609 ~~al~~~p~~~~~~~~la~~~~~~g~~  635 (640)
                      +.++++.|+.++++-+++.++.-.-++
T Consensus       480 ~~aLklkPDfpdA~cNllh~lq~vcdw  506 (966)
T KOG4626|consen  480 RTALKLKPDFPDAYCNLLHCLQIVCDW  506 (966)
T ss_pred             HHHHccCCCCchhhhHHHHHHHHHhcc
Confidence            999999999999999998887655444



>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query640
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-13
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 9e-08
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-07
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-10
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 6e-08
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 4e-05
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 9e-10
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 4e-08
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-07
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 2e-09
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 2e-07
1w3b_A 388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 2e-08
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 5e-08
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 1e-05
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 8e-04
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 3e-05
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 4e-05
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 6e-05
3uq3_A258 Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 2e-04
3upv_A126 Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 3e-04
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 3e-04
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure

Iteration: 1

Score = 75.1 bits (183), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 46/134 (34%), Positives = 71/134 (52%) Query: 450 EAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSAC 509 EAW G A G+ EAI+ KALE +P SA+ + G +K D++ A+E Sbjct: 2 EAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKA 61 Query: 510 VKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEK 569 ++LD + A+ LG A G+Y +A E + KA++LD EAW +L Y + ++ Sbjct: 62 LELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDE 121 Query: 570 ALECLQQVLYIDKR 583 A+E Q+ L +D R Sbjct: 122 AIEYYQKALELDPR 135
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 Back     alignment and structure
>pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query640
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-55
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-53
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-53
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-53
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-52
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-43
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-54
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-53
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-53
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-53
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-52
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-49
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-47
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-44
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-27
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-25
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 8e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-50
2gw1_A 514 Mitochondrial precursor proteins import receptor; 4e-34
2gw1_A 514 Mitochondrial precursor proteins import receptor; 7e-28
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-09
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-50
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-44
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-41
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-39
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-25
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-07
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-04
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-49
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-44
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-43
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-08
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-04
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-04
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-49
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-43
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-41
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-41
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-34
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-17
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-10
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-48
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-40
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-48
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-46
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-41
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-37
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-35
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-32
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-44
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-38
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-46
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-44
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-20
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 5e-10
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-44
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-41
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-40
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-37
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-26
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-26
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-07
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 8e-42
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-40
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-29
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-25
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-41
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-41
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-40
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-40
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-39
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-38
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-38
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-37
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-35
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-34
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-33
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-28
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-27
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-41
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-38
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-26
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-05
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-40
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-26
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-24
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 7e-21
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 7e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 5e-40
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-36
4eqf_A365 PEX5-related protein; accessory protein, tetratric 9e-32
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-30
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 6e-28
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-19
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-33
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-29
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-23
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-15
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-32
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-29
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-27
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-23
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-18
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-32
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-22
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-20
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 5e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 5e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-31
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-31
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-29
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-20
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-30
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-29
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-21
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-17
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-17
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 8e-05
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-04
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-28
4g1t_A 472 Interferon-induced protein with tetratricopeptide 7e-27
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-24
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-17
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-26
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-21
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-25
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-24
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-23
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-17
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-08
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-05
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 7e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-23
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-18
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-14
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-09
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-06
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 8e-04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-22
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 9e-20
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-19
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-14
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-11
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-07
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-05
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-21
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-21
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-20
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-04
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 2e-21
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 2e-20
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 1e-19
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 1e-06
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 4e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-21
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-20
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-19
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-18
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-15
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-13
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 9e-19
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-15
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 4e-10
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-18
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-17
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-15
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 6e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-12
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-16
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-16
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 9e-15
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-09
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-12
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 8e-08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-17
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 8e-16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-15
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-11
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 6e-17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 8e-17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-16
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-09
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-09
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 7e-04
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 5e-17
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 8e-15
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 7e-14
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-08
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 6e-05
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 9e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-16
3q15_A378 PSP28, response regulator aspartate phosphatase H; 6e-13
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-09
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-16
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 6e-15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-12
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-08
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-15
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 5e-14
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 7e-13
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 5e-06
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 7e-06
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 6e-04
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-16
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-14
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-09
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-16
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-13
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-13
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-12
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 7e-16
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 8e-12
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-08
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 8e-16
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-15
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 3e-13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-12
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-06
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-15
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 5e-13
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 5e-10
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 2e-06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-15
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 9e-14
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-13
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 9e-13
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 8e-09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-04
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-15
3q49_B137 STIP1 homology and U box-containing protein 1; E3 4e-13
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 7e-12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-11
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-15
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 5e-14
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-12
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 6e-10
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-04
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-15
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 4e-13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 7e-13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 9e-11
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-15
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-14
2kat_A115 Uncharacterized protein; NESG, structure, structur 5e-12
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-10
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-08
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-08
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-15
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-14
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 3e-13
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 1e-12
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 5e-10
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-14
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-13
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-13
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 8e-11
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-14
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 6e-13
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 4e-04
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-14
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 6e-14
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 2e-12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-11
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 4e-11
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 4e-05
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 3e-13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 9e-13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-10
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 3e-09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 8e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-13
3k9i_A117 BH0479 protein; putative protein binding protein, 7e-13
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-10
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-09
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-12
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 8e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 4e-08
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-12
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 5e-12
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-11
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 5e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 9e-12
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-09
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-08
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-04
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-11
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-11
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-09
2l6j_A111 TPR repeat-containing protein associated with HSP; 6e-09
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-07
2l6j_A111 TPR repeat-containing protein associated with HSP; 8e-05
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 3e-11
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-10
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-07
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 2e-10
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 5e-10
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 3e-08
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 8e-07
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 1e-06
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 3e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-10
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 8e-09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-08
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 8e-07
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 6e-10
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-07
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 8e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 3e-04
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 8e-10
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 3e-07
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 1e-09
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 1e-08
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 2e-06
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 4e-06
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 4e-05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 3e-04
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-09
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 4e-09
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-06
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-04
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 4e-04
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 4e-09
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 1e-08
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 5e-07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-04
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 9e-04
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 8e-09
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 8e-06
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-08
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-07
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-07
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 1e-08
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 3e-06
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 4e-05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-08
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-07
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 8e-06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-08
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-06
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 4e-08
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 5e-07
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 5e-07
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 7e-06
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 3e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 8e-08
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 1e-06
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 1e-06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 3e-06
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 7e-06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 5e-05
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 5e-04
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
 Score =  191 bits (489), Expect = 3e-55
 Identities = 54/255 (21%), Positives = 101/255 (39%)

Query: 385 LSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQS 444
           +     +   G + +A     Q+ +++P     L+   +     R L+ +    T AI+ 
Sbjct: 3   MELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ 62

Query: 445 NPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVE 504
           NP   EA+   G      G+  EAI+    AL  +P+  D             D   AV+
Sbjct: 63  NPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQ 122

Query: 505 DLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDL 564
              + ++ + +     + LG  L ++G  ++A+  +LKAI+   NF  AW +L   +   
Sbjct: 123 AYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQ 182

Query: 565 ANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYL 624
                A+   ++ + +D  F  AY   G +L       +A+      L + P++      
Sbjct: 183 GEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGN 242

Query: 625 RASCYHAIGEYREAV 639
            A  Y+  G    A+
Sbjct: 243 LACVYYEQGLIDLAI 257


>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Length = 129 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query640
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.97
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.97
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.97
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.97
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.96
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.96
3u4t_A272 TPR repeat-containing protein; structural genomics 99.95
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.95
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.95
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.95
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.95
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.95
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.95
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.94
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.94
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.94
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.94
3u4t_A272 TPR repeat-containing protein; structural genomics 99.93
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.93
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.93
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.93
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.93
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.92
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.92
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.92
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.92
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.92
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.92
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.92
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.91
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.91
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.91
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.91
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.91
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.91
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.91
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.9
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.9
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.9
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.9
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.9
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.9
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.89
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.89
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.87
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.87
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.86
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.86
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.86
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.86
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.86
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.85
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.85
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.85
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.83
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.83
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.83
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.83
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.82
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.82
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.81
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.81
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.81
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.81
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.81
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.81
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.81
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.8
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.8
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.8
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.79
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.79
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.79
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.79
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.78
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.76
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.76
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.75
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.74
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.74
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.73
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.73
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.72
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.72
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.72
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.72
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.7
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.7
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.69
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.69
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.69
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.69
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.68
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.68
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.68
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.67
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.67
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.67
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.66
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.65
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.65
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.65
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.64
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.64
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.63
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.62
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.62
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.62
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.61
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.6
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.6
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.58
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.58
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.58
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.57
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.57
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.57
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.56
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.56
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.56
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.55
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.55
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.55
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.55
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.55
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.55
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.54
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.54
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.53
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.53
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.52
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.52
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.51
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.5
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.49
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.49
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.48
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.48
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.47
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.47
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.47
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.47
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.47
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.46
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.46
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.45
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.45
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.45
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.43
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.42
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.42
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.41
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.41
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.4
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.39
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.38
3k9i_A117 BH0479 protein; putative protein binding protein, 99.38
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.36
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.35
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.35
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.35
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.35
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.35
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.34
3k9i_A117 BH0479 protein; putative protein binding protein, 99.34
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.34
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.34
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.34
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.32
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.32
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.31
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.26
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.25
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 99.15
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.14
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.08
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.06
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.06
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.03
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.96
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.91
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.9
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.89
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.88
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.86
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.86
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.85
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.83
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.8
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.73
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.71
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.58
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.54
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.53
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.5
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.48
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.48
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.39
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.34
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.21
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.2
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.13
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.1
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.0
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.97
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.84
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.83
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.62
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.42
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.23
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.06
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.03
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.97
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.65
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.47
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.33
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.29
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 96.28
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.2
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.16
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.77
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.39
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 95.38
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 95.36
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 95.13
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.99
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.99
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 94.9
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 94.74
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.41
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 94.01
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 93.41
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 93.38
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.35
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 93.26
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 92.11
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 92.04
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 91.88
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 91.66
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 91.51
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 90.76
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 90.07
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.57
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 85.86
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=2.2e-40  Score=338.47  Aligned_cols=381  Identities=16%  Similarity=0.157  Sum_probs=349.6

Q ss_pred             HHHHhcCCHHHHHHHHHHHHcccCc-hhHHHhHHHHHHhhhcHHHHHHHHHHHHHcCCCchHHHHHHHHHHHHcCCHHHH
Q 006562           44 AKLCSLRNWSKAIRILDSLLAQSYE-IQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEA  122 (640)
Q Consensus        44 ~~~~~~~~y~~Ai~~y~~ai~~~~~-~~~~~~~A~~~~~~g~~~~Ai~~~~~al~~~P~~~~a~~~~g~~y~~~g~~~~A  122 (640)
                      ..+++.|+|++|+..|.+++..+|+ +..+..++.++.+.|++++|+..++++++.+|.++.+++.+|.+|...|++++|
T Consensus         7 ~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A   86 (388)
T 1w3b_A            7 HREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEA   86 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHH
T ss_pred             HHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHCCCHHHH
Confidence            4568999999999999999999955 456889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhccCChHHHHHHHhHHHHHHHHhhhccchhhhhhcccccccccccCCCCCCCcchhhhhcCCCCCcccccc
Q 006562          123 LSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSS  202 (640)
Q Consensus       123 ~~~~~~al~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  202 (640)
                      +..|++++++.|+.+..+..+..+..                                                      
T Consensus        87 ~~~~~~al~~~p~~~~~~~~l~~~~~------------------------------------------------------  112 (388)
T 1w3b_A           87 IEHYRHALRLKPDFIDGYINLAAALV------------------------------------------------------  112 (388)
T ss_dssp             HHHHHHHHHHCTTCHHHHHHHHHHHH------------------------------------------------------
T ss_pred             HHHHHHHHHcCcchHHHHHHHHHHHH------------------------------------------------------
Confidence            99999998888877544322211110                                                      


Q ss_pred             CCccccccccCCCCCCCCcccccccccCCCcccccccccccCCccccccccCCCCCCCCccccccccchhhccccCCccc
Q 006562          203 QSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFD  282 (640)
Q Consensus       203 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  282 (640)
                                                                                                      
T Consensus       113 --------------------------------------------------------------------------------  112 (388)
T 1w3b_A          113 --------------------------------------------------------------------------------  112 (388)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ccCCCCCcccccccCCcccccccccccccccCccCCCCCCCCcccccccccCCCCCCchHHHHHhhHHHhhhhHHHHHHH
Q 006562          283 ICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEA  362 (640)
Q Consensus       283 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~  362 (640)
                                                                         ..++++.+...+.+               
T Consensus       113 ---------------------------------------------------~~g~~~~A~~~~~~---------------  126 (388)
T 1w3b_A          113 ---------------------------------------------------AAGDMEGAVQAYVS---------------  126 (388)
T ss_dssp             ---------------------------------------------------HHSCSSHHHHHHHH---------------
T ss_pred             ---------------------------------------------------HcCCHHHHHHHHHH---------------
Confidence                                                               11223444333322               


Q ss_pred             HhhHHHHHhhhhccCcccHHHHHHHHHHHHHcCChHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHH
Q 006562          363 KRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAI  442 (640)
Q Consensus       363 ~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al  442 (640)
                                +....|.....+..+|.++...|++++|+..|+++++.+|+++.++..+|.++...|++++|+..|++++
T Consensus       127 ----------al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al  196 (388)
T 1w3b_A          127 ----------ALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAV  196 (388)
T ss_dssp             ----------HHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHH
T ss_pred             ----------HHHhCCCcHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHH
Confidence                      2334678888999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCcHHHHHH
Q 006562          443 QSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTY  522 (640)
Q Consensus       443 ~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~  522 (640)
                      +.+|++..++..+|.++...|++++|+..+++++...|+++.++..+|.++...|++++|+..++++++.+|+++.++..
T Consensus       197 ~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~  276 (388)
T 1w3b_A          197 TLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCN  276 (388)
T ss_dssp             HHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHH
T ss_pred             hcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCHHHHHHHHHHHHccCcccHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhcCCHH
Q 006562          523 LGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHK  602 (640)
Q Consensus       523 la~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~la~~~~~~g~~~  602 (640)
                      +|.++...|++++|+..|++++...|.++.++..+|.++...|++++|+..++++++..|+++.++..+|.++...|+++
T Consensus       277 l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~  356 (388)
T 1w3b_A          277 LANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQ  356 (388)
T ss_dssp             HHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCH
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHcCCHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhccCCCCHHHHHHHHHHHHHcCC
Q 006562          603 KAIKDLSSGLGIDPSNIECLYLRASCYHAIGE  634 (640)
Q Consensus       603 ~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~  634 (640)
                      +|+..|+++++++|+++.+++.+|.++..+|+
T Consensus       357 ~A~~~~~~a~~~~p~~~~a~~~lg~~~~~~~~  388 (388)
T 1w3b_A          357 EALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHhhCCCCHHHHHhHHHHHHHccC
Confidence            99999999999999999999999999998875



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 640
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-33
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-30
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-29
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-27
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-27
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-17
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-13
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-19
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 7e-15
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-12
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-08
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.004
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-18
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-07
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 6e-18
d1dcea1 334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 3e-09
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 4e-09
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.002
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-16
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-14
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-13
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-05
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 0.001
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-15
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-14
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-13
d1xnfa_ 259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-14
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 2e-11
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 7e-04
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 4e-13
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 7e-13
d2h6fa1 315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 2e-08
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-11
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-11
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 7e-11
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-09
d1hz4a_ 366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-05
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 6e-05
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 7e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 8e-09
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 4e-06
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 2e-05
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 6e-05
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 9e-09
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 9e-07
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-08
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 3e-05
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 7e-04
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 2e-07
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 0.003
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-06
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 6e-07
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 5e-05
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 6e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-05
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 6e-06
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 7e-06
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-04
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 1e-05
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 0.002
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  129 bits (323), Expect = 4e-33
 Identities = 43/233 (18%), Positives = 93/233 (39%)

Query: 401 ISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARA 460
            + + + ++  P +  A    G     Q E+  AI  F +A+  +P+  +A+   G    
Sbjct: 155 KACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLK 214

Query: 461 ALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAY 520
                  A+    +AL   PN A +      V ++    + A++     ++L      AY
Sbjct: 215 EARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAY 274

Query: 521 TYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYI 580
             L  AL   G   +AE+ +  A++L     ++  +L    ++  N E+A+   ++ L +
Sbjct: 275 CNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEV 334

Query: 581 DKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGLGIDPSNIECLYLRASCYHAIG 633
              F+ A+     +L   G+ ++A+      + I P+  +      +    + 
Sbjct: 335 FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query640
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.96
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.95
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.91
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.89
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.87
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.86
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.86
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.85
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.8
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.78
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.67
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.67
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.66
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.65
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.64
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.62
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.61
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.61
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.61
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.6
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.59
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.58
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.58
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.51
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.47
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.46
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.44
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.44
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.41
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.4
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.4
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.4
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.39
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.39
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.33
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.32
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.32
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.03
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.03
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.98
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.96
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.87
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.86
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.65
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.06
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.06
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.96
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.96
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.97
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.27
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.06
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.22
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.5e-38  Score=321.70  Aligned_cols=381  Identities=16%  Similarity=0.154  Sum_probs=338.0

Q ss_pred             HHHHhcCCHHHHHHHHHHHHcccC-chhHHHhHHHHHHhhhcHHHHHHHHHHHHHcCCCchHHHHHHHHHHHHcCCHHHH
Q 006562           44 AKLCSLRNWSKAIRILDSLLAQSY-EIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEA  122 (640)
Q Consensus        44 ~~~~~~~~y~~Ai~~y~~ai~~~~-~~~~~~~~A~~~~~~g~~~~Ai~~~~~al~~~P~~~~a~~~~g~~y~~~g~~~~A  122 (640)
                      ..+|+.|+|++|+..|+++++.+| ++.+++.+|.+|.++|++++|+..++++++.+|+++.+++.+|.+|..+|++++|
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A   86 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEA   86 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccccc
Confidence            357999999999999999999995 4677999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhccCChHHHHHHHhHHHHHHHHhhhccchhhhhhcccccccccccCCCCCCCcchhhhhcCCCCCcccccc
Q 006562          123 LSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSS  202 (640)
Q Consensus       123 ~~~~~~al~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  202 (640)
                      +..|..+++..|...............       .      .                                      
T Consensus        87 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~------~--------------------------------------  115 (388)
T d1w3ba_          87 IEHYRHALRLKPDFIDGYINLAAALVA-------A------G--------------------------------------  115 (388)
T ss_dssp             HHHHHHHHHHCTTCHHHHHHHHHHHHH-------H------S--------------------------------------
T ss_pred             ccccccccccccccccccccccccccc-------c------c--------------------------------------
Confidence            999999988777654332211110000       0      0                                      


Q ss_pred             CCccccccccCCCCCCCCcccccccccCCCcccccccccccCCccccccccCCCCCCCCccccccccchhhccccCCccc
Q 006562          203 QSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFD  282 (640)
Q Consensus       203 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  282 (640)
                                                                                                      
T Consensus       116 --------------------------------------------------------------------------------  115 (388)
T d1w3ba_         116 --------------------------------------------------------------------------------  115 (388)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ccCCCCCcccccccCCcccccccccccccccCccCCCCCCCCcccccccccCCCCCCchHHHHHhhHHHhhhhHHHHHHH
Q 006562          283 ICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEA  362 (640)
Q Consensus       283 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~  362 (640)
                                                                            .......                   
T Consensus       116 ------------------------------------------------------~~~~~~~-------------------  122 (388)
T d1w3ba_         116 ------------------------------------------------------DMEGAVQ-------------------  122 (388)
T ss_dssp             ------------------------------------------------------CSSHHHH-------------------
T ss_pred             ------------------------------------------------------ccccccc-------------------
Confidence                                                                  0000000                   


Q ss_pred             HhhHHHHHhhhhccCcccHHHHHHHHHHHHHcCChHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHH
Q 006562          363 KRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAI  442 (640)
Q Consensus       363 ~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al  442 (640)
                            .........+.........+......+....+...+.+.+...|+++.++..+|.++...|++++|...+++++
T Consensus       123 ------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al  196 (388)
T d1w3ba_         123 ------AYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAV  196 (388)
T ss_dssp             ------HHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHH
T ss_pred             ------ccccccccccccccccccccccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHH
Confidence                  00011112333345556667778888999999999999999999999999999999999999999999999999


Q ss_pred             HhCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCcHHHHHH
Q 006562          443 QSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTY  522 (640)
Q Consensus       443 ~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~  522 (640)
                      +.+|+++.++..+|.++...|++++|+..++++....|.....+..+|.++...|++++|+..|+++++.+|+++.++..
T Consensus       197 ~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~  276 (388)
T d1w3ba_         197 TLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCN  276 (388)
T ss_dssp             HHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHH
T ss_pred             HhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCHHHHHHHHHHHHccCcccHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhcCCHH
Q 006562          523 LGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHK  602 (640)
Q Consensus       523 la~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~la~~~~~~g~~~  602 (640)
                      +|.++...|++++|+..++.++...|.....+..+|.++...|++++|+..|+++++.+|+++.++..+|.++...|+++
T Consensus       277 l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~  356 (388)
T d1w3ba_         277 LANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQ  356 (388)
T ss_dssp             HHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCH
T ss_pred             HHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhccCCCCHHHHHHHHHHHHHcCC
Q 006562          603 KAIKDLSSGLGIDPSNIECLYLRASCYHAIGE  634 (640)
Q Consensus       603 ~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~  634 (640)
                      +|+..|+++++++|++++++.++|.+|.++|+
T Consensus       357 ~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         357 EALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            99999999999999999999999999999986



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure