Citrus Sinensis ID: 006594
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 639 | ||||||
| 359486892 | 636 | PREDICTED: dihydrolipoyllysine-residue a | 0.993 | 0.998 | 0.751 | 0.0 | |
| 296090376 | 659 | unnamed protein product [Vitis vinifera] | 0.993 | 0.963 | 0.751 | 0.0 | |
| 255571622 | 633 | dihydrolipoamide acetyltransferase compo | 0.971 | 0.981 | 0.743 | 0.0 | |
| 224100693 | 588 | predicted protein [Populus trichocarpa] | 0.913 | 0.993 | 0.774 | 0.0 | |
| 356576335 | 628 | PREDICTED: dihydrolipoyllysine-residue a | 0.978 | 0.995 | 0.693 | 0.0 | |
| 449441822 | 638 | PREDICTED: dihydrolipoyllysine-residue a | 0.987 | 0.989 | 0.690 | 0.0 | |
| 449493259 | 638 | PREDICTED: dihydrolipoyllysine-residue a | 0.987 | 0.989 | 0.688 | 0.0 | |
| 388502998 | 627 | unknown [Lotus japonicus] | 0.981 | 1.0 | 0.690 | 0.0 | |
| 297816492 | 636 | dihydrolipoamide S-acetyltransferase 3 [ | 0.985 | 0.990 | 0.674 | 0.0 | |
| 5881965 | 637 | dihydrolipoamide S-acetyltransferase [Ar | 0.985 | 0.989 | 0.664 | 0.0 |
| >gi|359486892|ref|XP_002262782.2| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 954 bits (2467), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 481/640 (75%), Positives = 551/640 (86%), Gaps = 5/640 (0%)
Query: 1 MALSRLRQPVIARTLSLFRARLSLSSFSSSTSLARISSGKNSFVDVNGILLRPLSSTLAP 60
MALSRLR P+++R SLFRAR+ LSS ++S SL S+ + S VD +G LLRP S + P
Sbjct: 1 MALSRLRHPIVSRAPSLFRARI-LSS-TASRSLPHTSTVQKSSVDGDGTLLRPASLLMVP 58
Query: 61 EVHDSPLKLKMQIGVRHFSSSELPSHTVVGMPALSPTMSQGNIAKWRKKEGDKIEIGDIL 120
V D KLK+Q+GVR+FSS+ELPSH V+GMPALSPTM+QGNIAKWRKKEGDKIE GD+L
Sbjct: 59 RVQDGSSKLKLQVGVRNFSSAELPSHMVLGMPALSPTMTQGNIAKWRKKEGDKIEPGDVL 118
Query: 121 CEIETDKATVEFESLEEGFLAKILVPEGSKDVPVGQPIAITVEDADDIQHIPATIAGGAE 180
CEIETDKAT+EFESLEEGFLAKILV EGSKDVPVGQPIAITVED +DIQ +PA++AGG+
Sbjct: 119 CEIETDKATLEFESLEEGFLAKILVAEGSKDVPVGQPIAITVEDEEDIQKVPASVAGGSG 178
Query: 181 AKEQSSTHQDVKKEAVQETSASRINTSELPPRVVLEMPALSPTMNQGNIAKWRKNEGDKI 240
+E+ S H++ E Q+ +S INT+ELPP +VL MPALSPTMNQGNIAKWRK EGDKI
Sbjct: 179 VEEKKSKHENAGNEDKQQEMSSTINTAELPPHIVLGMPALSPTMNQGNIAKWRKKEGDKI 238
Query: 241 EVGDVICEIETDKATLEFECLEEGYLAKILAPEGSKDVAVGQPIAITVEDPGDVGTVKNS 300
EVGDVICEIETDKATLEFE LEEGYLAKI+APEGSKDVAVGQPIAITVEDP D+ VK S
Sbjct: 239 EVGDVICEIETDKATLEFESLEEGYLAKIVAPEGSKDVAVGQPIAITVEDPDDIEIVKAS 298
Query: 301 VTSGAEVKGEKETHHDSKDVVKVQKGSFTKISPSAKLLILEHGLDASSLQASGPYGTLLK 360
V+SG+++K EK +S++ V+ +K SFT+ISPSAKLLI E GLDAS+L+ASGP GTLLK
Sbjct: 299 VSSGSDIKKEKPQQQESRNEVRAEKSSFTRISPSAKLLITEFGLDASTLKASGPRGTLLK 358
Query: 361 GDVLAAIKSGKVSSRISSHTEKTSPSPL-PQTSTAVSPGSKSDLELSDSFEDFPNTQIRK 419
GDVLAAIK+G + S SS +K P P+ Q S + SP +S L+ S+SFED PN+QIRK
Sbjct: 359 GDVLAAIKAG-IGSSSSSSKDKMPPPPVHSQASPSASP-ERSHLQQSESFEDMPNSQIRK 416
Query: 420 VIARRLLESKQNTPHLYLSSDVVLDPLLSFRKELKEKHNTKVSVNDIVIKAVAVALKNVP 479
VIA RLLESKQNTPHLYLSSDV+LDPLLSFRKELKEKH+ KVSVNDIVIKAVA+ALKNVP
Sbjct: 417 VIATRLLESKQNTPHLYLSSDVILDPLLSFRKELKEKHDVKVSVNDIVIKAVAMALKNVP 476
Query: 480 EANAYWDVEKGEIVLCDAIDISIAVATEKGLMTPIVRNADQKSISAISMEVKELAEKARA 539
EANAYW+ EKGE++L D++DISIAVATEKGLMTPIVRNADQK+IS+IS+EVKELAEKARA
Sbjct: 477 EANAYWNAEKGEVILSDSVDISIAVATEKGLMTPIVRNADQKTISSISIEVKELAEKARA 536
Query: 540 GKLAPHEFQGGTFSISNLGMFPVDQFCAIINPPQAGILAVGRGNQVVEPVIGSDGNETPA 599
GKL P+EFQGGTFSISNLGMFPVD FCAIINPPQ+GILAVGRGN+VVEPV+G DG E PA
Sbjct: 537 GKLKPNEFQGGTFSISNLGMFPVDHFCAIINPPQSGILAVGRGNKVVEPVVGGDGLEKPA 596
Query: 600 VVTKMNLTLSADHRVFEGKVGGAFFSALCSNFSDIRRLLL 639
VVTKMNLTLSADHRVF+GKVGGAF SAL SNFSDIRRLLL
Sbjct: 597 VVTKMNLTLSADHRVFDGKVGGAFLSALRSNFSDIRRLLL 636
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296090376|emb|CBI40195.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255571622|ref|XP_002526756.1| dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase, putative [Ricinus communis] gi|223533883|gb|EEF35610.1| dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224100693|ref|XP_002311977.1| predicted protein [Populus trichocarpa] gi|222851797|gb|EEE89344.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356576335|ref|XP_003556288.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449441822|ref|XP_004138681.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449493259|ref|XP_004159237.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388502998|gb|AFK39565.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|297816492|ref|XP_002876129.1| dihydrolipoamide S-acetyltransferase 3 [Arabidopsis lyrata subsp. lyrata] gi|297321967|gb|EFH52388.1| dihydrolipoamide S-acetyltransferase 3 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|5881965|gb|AAD55140.1|AF066080_1 dihydrolipoamide S-acetyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 639 | ||||||
| UNIPROTKB|F1N690 | 647 | DLAT "Dihydrolipoyllysine-resi | 0.331 | 0.327 | 0.474 | 2e-100 | |
| MGI|MGI:2385311 | 642 | Dlat "dihydrolipoamide S-acety | 0.838 | 0.834 | 0.407 | 6.4e-99 | |
| RGD|619859 | 632 | Dlat "dihydrolipoamide S-acety | 0.837 | 0.846 | 0.406 | 6.4e-99 | |
| UNIPROTKB|E1C6N5 | 632 | DLAT "Uncharacterized protein" | 0.848 | 0.857 | 0.413 | 2.5e-97 | |
| ZFIN|ZDB-GENE-030131-2921 | 652 | dlat "dihydrolipoamide S-acety | 0.824 | 0.808 | 0.404 | 2.2e-96 | |
| UNIPROTKB|P10515 | 647 | DLAT "Dihydrolipoyllysine-resi | 0.859 | 0.848 | 0.409 | 3.7e-96 | |
| UNIPROTKB|F1SMB2 | 647 | DLAT "Dihydrolipoyllysine-resi | 0.838 | 0.828 | 0.423 | 3.3e-95 | |
| UNIPROTKB|E2RQS9 | 647 | DLAT "Uncharacterized protein" | 0.854 | 0.843 | 0.416 | 4.2e-95 | |
| DICTYBASE|DDB_G0277847 | 635 | pdhC "dihydrolipoyllysine-resi | 0.827 | 0.833 | 0.386 | 3e-94 | |
| UNIPROTKB|E9PEJ4 | 542 | DLAT "Dihydrolipoyllysine-resi | 0.428 | 0.505 | 0.412 | 1.1e-78 |
| UNIPROTKB|F1N690 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 509 (184.2 bits), Expect = 2.0e-100, Sum P(2) = 2.0e-100
Identities = 101/213 (47%), Positives = 139/213 (65%)
Query: 83 LPSHTVVGMPALSPTMSQGNIAKWRKKEGDKIEIGDILCEIETDKATVEFESLEEGFLAK 142
LP H V +P+LSPTM G IA+W KKEG+KI G+++ E+ETDKATV FES+EE ++AK
Sbjct: 88 LPPHQKVPLPSLSPTMQAGTIARWEKKEGEKINEGELIAEVETDKATVGFESVEECYMAK 147
Query: 143 ILVPEGSKDVPVGQPIAITVEDADDIQHIPA-TIAGGAEAKEQSSTHQDVKKEAVQETSA 201
ILV EG++DVPVG I ITV+ +D++ T+ A ++ A T +
Sbjct: 148 ILVAEGTRDVPVGAIICITVDKPEDVEAFKNYTLDSSAAPAPPAAPAPTPAAPAPSPTPS 207
Query: 202 SRINTSELPPRVVLEMPALSPTMNQGNIAKWRKNEGDKIEVGDVICEIETDKATLEFECL 261
++ S P + + +PALSPTM G + +W K G+K+ GD++ EIETDKAT+ FE
Sbjct: 208 AQAPGSSYPTHMQVLLPALSPTMTMGTVQRWEKKVGEKLNEGDLLAEIETDKATIGFEVQ 267
Query: 262 EEGYLAKILAPEGSKDVAVGQPIAITVEDPGDV 294
EEGYLAKIL PEG++DV +G P+ I VE D+
Sbjct: 268 EEGYLAKILIPEGTRDVPLGTPLCIIVEKEADI 300
|
|
| MGI|MGI:2385311 Dlat "dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|619859 Dlat "dihydrolipoamide S-acetyltransferase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C6N5 DLAT "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-2921 dlat "dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P10515 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SMB2 DLAT "Dihydrolipoyllysine-residue acetyltransferase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RQS9 DLAT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0277847 pdhC "dihydrolipoyllysine-residue acetyltransferase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PEJ4 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_LG_VIII0227 | hypothetical protein (588 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.III.1461.1 | • | • | • | • | • | 0.963 | |||||
| estExt_fgenesh4_pm.C_LG_I0194 | • | • | • | • | • | 0.962 | |||||
| gw1.X.5451.1 | • | • | • | • | 0.958 | ||||||
| grail3.0009040502 | • | • | • | • | 0.958 | ||||||
| LPD1 | • | • | • | • | • | • | 0.957 | ||||
| fgenesh4_pg.C_LG_II001653 | • | • | • | • | 0.956 | ||||||
| estExt_Genewise1_v1.C_LG_IV4361 | • | • | • | 0.946 | |||||||
| grail3.0080008401 | • | • | • | 0.946 | |||||||
| LPD3 | • | • | • | • | • | 0.932 | |||||
| LPD4 | • | • | • | • | • | 0.932 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 639 | |||
| TIGR01349 | 436 | TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase | 1e-134 | |
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid | 1e-132 | |
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue ac | 1e-118 | |
| COG0508 | 404 | COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena | 1e-111 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 3e-88 | |
| pfam00198 | 212 | pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases | 6e-81 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 2e-78 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 1e-69 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 3e-64 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 2e-59 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 3e-53 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 4e-53 | |
| PRK14843 | 347 | PRK14843, PRK14843, dihydrolipoamide acetyltransfe | 4e-45 | |
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue ac | 5e-44 | |
| PLN02528 | 416 | PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase | 9e-44 | |
| PRK11857 | 306 | PRK11857, PRK11857, dihydrolipoamide acetyltransfe | 4e-39 | |
| TIGR01349 | 436 | TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase | 2e-37 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 3e-35 | |
| PLN02226 | 463 | PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E | 3e-32 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 7e-32 | |
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid | 2e-29 | |
| cd06849 | 74 | cd06849, lipoyl_domain, Lipoyl domain of the dihyd | 8e-28 | |
| cd06849 | 74 | cd06849, lipoyl_domain, Lipoyl domain of the dihyd | 5e-26 | |
| COG0508 | 404 | COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena | 6e-24 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subun | 3e-17 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subun | 2e-15 | |
| pfam00364 | 73 | pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | 4e-15 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ | 1e-14 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 4e-14 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 5e-14 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 1e-13 | |
| pfam00364 | 73 | pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | 1e-12 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ | 3e-12 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 1e-11 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-09 | |
| PLN02226 | 463 | PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E | 1e-08 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 9e-08 | |
| PRK09282 | 592 | PRK09282, PRK09282, pyruvate carboxylase subunit B | 1e-05 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or b | 2e-05 | |
| pfam02817 | 39 | pfam02817, E3_binding, e3 binding domain | 2e-05 | |
| PLN02528 | 416 | PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase | 4e-05 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or b | 9e-05 | |
| COG0511 | 140 | COG0511, AccB, Biotin carboxyl carrier protein [Li | 0.001 | |
| COG0511 | 140 | COG0511, AccB, Biotin carboxyl carrier protein [Li | 0.001 |
| >gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
Score = 398 bits (1025), Expect = e-134
Identities = 197/440 (44%), Positives = 258/440 (58%), Gaps = 42/440 (9%)
Query: 214 VLEMPALSPTMNQGNIAKWRKNEGDKIEVGDVICEIETDKATLEFECLEEGYLAKILAPE 273
+ MPALSPTM GN+AKW K EGDK+ GDVI EIETDKAT+EFE +EEGYLAKIL PE
Sbjct: 1 KITMPALSPTMTTGNLAKWLKKEGDKVNPGDVIAEIETDKATMEFEAVEEGYLAKILVPE 60
Query: 274 GSKDVAVGQPIAITVEDPGDVGTVKNSVTSGAEVKG----------------------EK 311
G+KDV V +PIA+ VE+ DV + + +K
Sbjct: 61 GTKDVPVNKPIAVLVEEKEDVADAFKNYKLESSASPAPKPSEIAPTAPPSAPKPSPAPQK 120
Query: 312 ETHHDSKDVVKVQKGSFTKI--SPSAKLLILEHGLDASSLQASGPYGTLLKGDVLAAIKS 369
++ S K S +I SP AK L E G+D S++ SGP G ++K D+ + +
Sbjct: 121 QSPEPSSPAPLSDKESGDRIFASPLAKKLAKEKGIDLSAVAGSGPNGRIVKKDIESFVPQ 180
Query: 370 GKVSSRISSHTEKTSPSPLPQTSTAVSPGSKSDLELSDSFEDFPNTQIRKVIARRLLESK 429
+ + +T + + + S+ED P + IRK+IA+RLLESK
Sbjct: 181 ------------SPASANQQAAATTPATYPAAAPVSTGSYEDVPLSNIRKIIAKRLLESK 228
Query: 430 QNTPHLYLSSDVVLDPLLSFRKELKEKHN--TKVSVNDIVIKAVAVALKNVPEANAYWDV 487
Q PH Y+S + +D LL+ RKEL + K+SVND +IKA A+AL+ VPEAN+ W
Sbjct: 229 QTIPHYYVSIECNVDKLLALRKELNAMASEVYKLSVNDFIIKASALALREVPEANSSWT- 287
Query: 488 EKGEIVLCDAIDISIAVATEKGLMTPIVRNADQKSISAISMEVKELAEKARAGKLAPHEF 547
I +DIS+AVAT GL+TPIVRNAD K +S IS E+K+LA++AR KL P EF
Sbjct: 288 -DNFIRRYKNVDISVAVATPDGLITPIVRNADAKGLSTISNEIKDLAKRARNNKLKPEEF 346
Query: 548 QGGTFSISNLGMFPVDQFCAIINPPQAGILAVGRGNQVVEPVIGSDGNETPAVVTKMNLT 607
QGGTF+ISNLGMF + F AIINPPQA ILAVG V V+ +D + AV + M++T
Sbjct: 347 QGGTFTISNLGMFGIKDFTAIINPPQACILAVGAVEDV--AVVDNDEEKGFAVASIMSVT 404
Query: 608 LSADHRVFEGKVGGAFFSAL 627
LS DHRV +G VG F +
Sbjct: 405 LSCDHRVIDGAVGAEFLKSF 424
|
This model represents one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex. It includes sequences from mitochondria and from alpha and beta branches of the proteobacteria, as well as from some other bacteria. Sequences from Gram-positive bacteria are not included. The non-enzymatic homolog protein X, which serves as an E3 component binding protein, falls within the clade phylogenetically but is rejected by its low score [Energy metabolism, Pyruvate dehydrogenase]. Length = 436 |
| >gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215782 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acyltransferase (catalytic domain) | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|236449 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >gnl|CDD|202412 pfam02817, E3_binding, e3 binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 639 | |||
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 100.0 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 100.0 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 100.0 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 100.0 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 100.0 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 100.0 | |
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| KOG0557 | 470 | consensus Dihydrolipoamide acetyltransferase [Ener | 100.0 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 100.0 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 100.0 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 100.0 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 100.0 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 100.0 | |
| KOG0558 | 474 | consensus Dihydrolipoamide transacylase (alpha-ket | 100.0 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 100.0 | |
| KOG0559 | 457 | consensus Dihydrolipoamide succinyltransferase (2- | 100.0 | |
| PRK14843 | 347 | dihydrolipoamide acetyltransferase; Provisional | 100.0 | |
| PRK11857 | 306 | dihydrolipoamide acetyltransferase; Reviewed | 100.0 | |
| PF00198 | 231 | 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransfe | 100.0 | |
| PRK12270 | 1228 | kgd alpha-ketoglutarate decarboxylase; Reviewed | 100.0 | |
| PRK13757 | 219 | chloramphenicol acetyltransferase; Provisional | 99.95 | |
| PF00302 | 206 | CAT: Chloramphenicol acetyltransferase; InterPro: | 99.95 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 99.94 | |
| COG4845 | 219 | Chloramphenicol O-acetyltransferase [Defense mecha | 99.88 | |
| KOG0557 | 470 | consensus Dihydrolipoamide acetyltransferase [Ener | 99.85 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 99.8 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 99.76 | |
| KOG0559 | 457 | consensus Dihydrolipoamide succinyltransferase (2- | 99.74 | |
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 99.71 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 99.71 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 99.71 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 99.66 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 99.66 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 99.64 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.63 | |
| PRK06748 | 83 | hypothetical protein; Validated | 99.62 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.61 | |
| PRK06748 | 83 | hypothetical protein; Validated | 99.58 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 99.57 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 99.57 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 99.52 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.5 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 99.48 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 99.48 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 99.46 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 99.45 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 99.45 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 99.42 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.39 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 99.38 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.34 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.31 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 99.29 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 99.29 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.27 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 99.24 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.22 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.21 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.21 | |
| PRK07051 | 80 | hypothetical protein; Validated | 99.19 | |
| PF02817 | 39 | E3_binding: e3 binding domain; InterPro: IPR004167 | 99.17 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 99.16 | |
| KOG0558 | 474 | consensus Dihydrolipoamide transacylase (alpha-ket | 99.15 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 99.15 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 99.15 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.09 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 99.07 | |
| PRK07051 | 80 | hypothetical protein; Validated | 99.06 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 99.03 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 99.02 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 98.97 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 98.95 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 98.92 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 98.9 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 98.83 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 98.83 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 98.8 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 98.79 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 98.78 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 98.7 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 98.69 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 98.64 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 98.6 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 98.57 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 98.54 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 98.42 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 98.41 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 98.29 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 98.28 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 98.25 | |
| KOG0369 | 1176 | consensus Pyruvate carboxylase [Energy production | 98.18 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 98.12 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 97.94 | |
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H-like protein, | 97.81 | |
| KOG0369 | 1176 | consensus Pyruvate carboxylase [Energy production | 97.79 | |
| KOG0238 | 670 | consensus 3-Methylcrotonyl-CoA carboxylase, biotin | 97.76 | |
| PRK00624 | 114 | glycine cleavage system protein H; Provisional | 97.71 | |
| KOG0368 | 2196 | consensus Acetyl-CoA carboxylase [Lipid transport | 97.68 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 97.6 | |
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H-like protein, | 97.57 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 97.54 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 97.52 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 97.49 | |
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 97.47 | |
| PRK00624 | 114 | glycine cleavage system protein H; Provisional | 97.44 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 97.38 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 97.38 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 97.36 | |
| KOG0238 | 670 | consensus 3-Methylcrotonyl-CoA carboxylase, biotin | 97.29 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 97.2 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 97.2 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 97.18 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 97.17 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 97.12 | |
| TIGR00527 | 127 | gcvH glycine cleavage system H protein. The genome | 97.04 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 97.04 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 97.0 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 96.99 | |
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 96.97 | |
| KOG0368 | 2196 | consensus Acetyl-CoA carboxylase [Lipid transport | 96.97 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 96.96 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 96.89 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 96.83 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 96.79 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 96.77 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 96.76 | |
| PRK14843 | 347 | dihydrolipoamide acetyltransferase; Provisional | 96.74 | |
| TIGR00527 | 127 | gcvH glycine cleavage system H protein. The genome | 96.69 | |
| PF01597 | 122 | GCV_H: Glycine cleavage H-protein; InterPro: IPR00 | 96.62 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 96.55 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 96.51 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 96.45 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 96.37 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 96.34 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 96.31 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 96.11 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 96.08 | |
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-bi | 96.04 | |
| PF01597 | 122 | GCV_H: Glycine cleavage H-protein; InterPro: IPR00 | 96.03 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 95.96 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 95.75 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 95.69 | |
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-bi | 95.69 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 95.67 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 95.56 | |
| PF13375 | 101 | RnfC_N: RnfC Barrel sandwich hybrid domain | 95.03 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 94.33 | |
| KOG3373 | 172 | consensus Glycine cleavage system H protein (lipoa | 94.29 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 94.13 | |
| PF05896 | 257 | NQRA: Na(+)-translocating NADH-quinone reductase s | 93.65 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 93.54 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 93.46 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 93.36 | |
| PF13375 | 101 | RnfC_N: RnfC Barrel sandwich hybrid domain | 93.05 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 92.61 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 92.44 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 92.18 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 91.67 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 91.48 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 91.43 | |
| PF09891 | 150 | DUF2118: Uncharacterized protein conserved in arch | 90.98 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 90.85 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 90.26 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 90.24 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 90.2 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 90.08 | |
| TIGR02946 | 446 | acyl_WS_DGAT acyltransferase, WS/DGAT/MGAT. This b | 89.98 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 89.86 | |
| COG1726 | 447 | NqrA Na+-transporting NADH:ubiquinone oxidoreducta | 89.5 | |
| PF05896 | 257 | NQRA: Na(+)-translocating NADH-quinone reductase s | 89.38 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 89.3 | |
| PF07247 | 480 | AATase: Alcohol acetyltransferase; InterPro: IPR01 | 89.1 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 88.23 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 87.79 | |
| PRK14844 | 2836 | bifunctional DNA-directed RNA polymerase subunit b | 87.67 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 87.55 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 87.11 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 87.06 | |
| PF07831 | 75 | PYNP_C: Pyrimidine nucleoside phosphorylase C-term | 86.46 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 86.25 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 86.14 | |
| PF09891 | 150 | DUF2118: Uncharacterized protein conserved in arch | 85.21 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 84.59 | |
| KOG3373 | 172 | consensus Glycine cleavage system H protein (lipoa | 84.44 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 84.06 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 83.98 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 83.97 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 83.1 | |
| PF07831 | 75 | PYNP_C: Pyrimidine nucleoside phosphorylase C-term | 82.23 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterize | 81.5 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 80.3 |
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.5e-101 Score=870.49 Aligned_cols=544 Identities=27% Similarity=0.405 Sum_probs=415.9
Q ss_pred eEEecCCCCCCCceEEEEEEEecCCCeeecCCeEEEEEcccceeEEecCCceEEEEEEecCCCccccCCCcEEEEecCCc
Q 006594 87 TVVGMPALSPTMSQGNIAKWRKKEGDKIEIGDILCEIETDKATVEFESLEEGFLAKILVPEGSKDVPVGQPIAITVEDAD 166 (639)
Q Consensus 87 ~~v~~p~~~~~~~eg~v~~w~v~~Gd~V~~g~~l~~ietdK~~~~i~s~~~G~i~~~~v~~g~~~v~~G~~l~~i~~~~~ 166 (639)
+.|.||++|++|.||+|++|+|++||.|++||+||+|||||++++|+|+.+|+|.++++++||. |++|+.|+.|+..++
T Consensus 3 ~~i~~P~lg~~~~eg~i~~w~v~~Gd~V~~g~~l~~vEtdKa~~ev~a~~~G~v~~i~v~~Gd~-v~vG~~ia~i~~~~~ 81 (590)
T TIGR02927 3 FSVEMPALGESVTEGTITQWLKAEGDTVELDEPLLEVSTDKVDTEIPSPAAGVILEIKAEEDDT-VDIGGEIAIIGEAGE 81 (590)
T ss_pred eeEECCCCCCCccEEEEEEEEECCCCEEeCCCeEEEEEecceEEEecCCCCEEEEEEeecCCCE-EeeeeeEEEEeeccc
Confidence 6799999999999999999999999999999999999999999999999999999999999999 999999999976443
Q ss_pred ccccccccccCCcccccccccc---cccc-hhhhcc-cccc---ccCCCCCCCceeeecCCCCCcccccccceeecCCCC
Q 006594 167 DIQHIPATIAGGAEAKEQSSTH---QDVK-KEAVQE-TSAS---RINTSELPPRVVLEMPALSPTMNQGNIAKWRKNEGD 238 (639)
Q Consensus 167 ~~~~~~~~~~~~~~~~~~~~~~---~~~~-~~~~~~-~~~~---~~~~~~~~~~~~~~~P~l~~~~~~g~i~~w~v~~Gd 238 (639)
....+.......+..+...+.. .... +.+... ..++ ..+........++.||+||++|++|+|++|+|++||
T Consensus 82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~P~lg~~~~eg~i~~w~v~~Gd 161 (590)
T TIGR02927 82 ASAEAGAEDSAAAAEPEEAPAEEAPKEEPKAAPAESVEQAPAESSAPSQGGGAATDIEMPELGESVTEGTITQWLKAVGD 161 (590)
T ss_pred ccccccccccccccccccccccccccccccccccccccccccccccccccCCCceEEEcCCCCCCcceEEEEEEEeCCCC
Confidence 2111111000000000000000 0000 000000 0000 001111123478999999999999999999999999
Q ss_pred ccccCCeeeEeecCcceeeEecCCCeeEEEEecCCCCccccCCCeEEEEecCCCCcCCc-C--CCC-C-------CCccc
Q 006594 239 KIEVGDVICEIETDKATLEFECLEEGYLAKILAPEGSKDVAVGQPIAITVEDPGDVGTV-K--NSV-T-------SGAEV 307 (639)
Q Consensus 239 ~V~~gd~l~~vetdK~~~ei~s~~~G~v~~i~~~~G~~~v~vG~~l~~i~~~~~~~~~~-~--~~~-~-------~~~~~ 307 (639)
.|++||+||+|||||+++||+|+++|+|.+|++++|+. |++|++|++|.+++++..+. . ... . ..+.+
T Consensus 162 ~V~~g~~l~~vEtdKa~~ev~s~~~G~v~~i~v~~G~~-v~vG~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 240 (590)
T TIGR02927 162 KIEVDEPILEVSTDKVDTEIPSPVAGTILEILAEEDDT-VDVGAEIAKIGDAGAAAAEDAKAEEEAEAKAEAKPEEKPDP 240 (590)
T ss_pred EecCCCEeEEEEecceeeEEcCCCCeEEEEEecCCCCE-ecCCCEEEEEecCCCccccccccccccccccccccCCCCcc
Confidence 99999999999999999999999999999999999999 99999999997654432110 0 000 0 00000
Q ss_pred CCC-C--CCC---C----CCcccc---c--cccCCCccCChhHHhhHHHcCCCcccccccCCCCeeeccchHHHHhcCCC
Q 006594 308 KGE-K--ETH---H----DSKDVV---K--VQKGSFTKISPSAKLLILEHGLDASSLQASGPYGTLLKGDVLAAIKSGKV 372 (639)
Q Consensus 308 ~~~-~--~~~---~----~~~~~~---~--~~~~~~~~asP~ar~lA~e~gIDls~v~gsGp~GrI~~~DV~~~~~~~~~ 372 (639)
..+ . ..+ . ..+..+ . ......+++||+||+||+|+||||+.|+|||++|||+++||++|+.....
T Consensus 241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~asP~aR~lA~e~gvdl~~v~GtG~~GrI~k~DV~~~~~~~~~ 320 (590)
T TIGR02927 241 KKDEAAEPEPDEPEAEKAEKKEEKAAAAPAANSDGSPYVTPLVRKLAAEHGIDLNSVKGTGIGGRIRKQDVLAAAEGAKA 320 (590)
T ss_pred ccccccccccccccccccccccccccccccccccCcccCCchhHHHHHHcCCCHHHCCCCCCCCeEeHHHHHHHHhcccc
Confidence 000 0 000 0 000000 0 00112356899999999999999999999999999999999999753211
Q ss_pred ccccCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCCcccccCcHHHHHHHHHhhhccCCcceEEeeeeeechHHHHHHHH
Q 006594 373 SSRISSHTEKTSPSPLPQTSTAVSPGSKSDLELSDSFEDFPNTQIRKVIARRLLESKQNTPHLYLSSDVVLDPLLSFRKE 452 (639)
Q Consensus 373 ~~~~~~a~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~s~~r~~ia~~m~~S~~~iP~~~~~~evDvt~l~~~rk~ 452 (639)
.. ..++.............+ ...+ .+.. ....++++|+++|||.||++|++|++++||||++.+||+|+|+++|++
T Consensus 321 ~~-~~~~~~~~~~~~~~~~~~-~~~~-~~~~-~~~~~~~~pls~~rk~ia~~m~~S~~~iPh~~~~~evdvt~l~~~R~~ 396 (590)
T TIGR02927 321 AA-EAPAAEAAAAAPAAAAAA-SASP-APAK-AHLRGTTQKANRIREITAKKTREALQASAQLTQLHEVDMTKIAALRAR 396 (590)
T ss_pred cc-ccccccccccCccccccc-cCCC-cccc-ccccCceeeccHHHHHHHHHHHHHhccCCeEEEEeEEEcHHHHHHHHH
Confidence 00 000000000000000000 0000 0000 001245679999999999999999999999999999999999999999
Q ss_pred Hhhh----CCCCcCHHHHHHHHHHHHHhhCcccceeeccCCCeEEEcCCccEEEEEecCCCeEEeeeecCCcCCHHHHHH
Q 006594 453 LKEK----HNTKVSVNDIVIKAVAVALKNVPEANAYWDVEKGEIVLCDAIDISIAVATEKGLMTPIVRNADQKSISAISM 528 (639)
Q Consensus 453 ~~~~----~g~kls~~~~likAva~Al~~~P~ln~~~~~~~~~i~~~~~v~i~iAV~~~~gl~~pvI~~a~~~sl~ei~~ 528 (639)
+|+. +|.|+||++||+||+++||++||.||++|+++.++|++|+++||||||++++||++|||++++.++|.+|++
T Consensus 397 l~~~~~~~~~~kls~~~~iiKA~a~AL~~~P~~Na~~~~~~~~i~~~~~vnigvAv~t~~GL~vPvIk~a~~~sl~~ia~ 476 (590)
T TIGR02927 397 AKAAFAEKEGVNLTFLPFFAKAVIDALKAHPNVNASYNADTKEITYHAAEHLGFAVDTDAGLLSPVIHNAGDLSLGEIAK 476 (590)
T ss_pred HHhhhHHhcCCcccHHHHHHHHHHHHHHhCCHhheEEecCCCEEEEeCCccEEEEEECCCCcEecccCCcccCCHHHHHH
Confidence 9842 478999999999999999999999999998654579999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHcCCCCCCCCCCCeEEEEeCCCCCccceeeccCCCcceEEEecCceEEEEEeeCCCCCcccEEEeEEEEEE
Q 006594 529 EVKELAEKARAGKLAPHEFQGGTFSISNLGMFPVDQFCAIINPPQAGILAVGRGNQVVEPVIGSDGNETPAVVTKMNLTL 608 (639)
Q Consensus 529 ~~~~l~~~ar~g~l~~~d~~ggtftISnlG~~g~~~~~pii~~p~~ail~vG~~~~~~~~~~g~~G~~~~~~r~~m~lsl 608 (639)
++++|.+++|+|+|+++||+||||||||||+||+++|+||||+||+|||++|++.++|+++++++|.+.+++|++|+|||
T Consensus 477 ~i~~l~~kAr~gkL~p~e~~GgTfTISNlG~~G~~~~tpIIn~PqvaILgvG~i~~~pv~~~~~~g~~~~~~~~~m~lsl 556 (590)
T TIGR02927 477 AIADIAARARNGKLKPDDLAGGTFTITNIGSEGALFDTPILIPPQAAILGTGAIVKRPRVITDEDGIDSIAIRQMCHLPL 556 (590)
T ss_pred HHHHHHHHHHcCCCChHHhCCCeEEEECCCCCCccceeceecCCCeEEEEcccceEEEEEeccCCCcccEEEEeeEEEee
Confidence 99999999999999999999999999999999999999999999999999999999998875334434599999999999
Q ss_pred EecccccChHHHHHHHHHHHHHHhchhh
Q 006594 609 SADHRVFEGKVGGAFFSALCSNFSDIRR 636 (639)
Q Consensus 609 t~DHRviDG~~aa~Fl~~l~~~Le~P~~ 636 (639)
+||||||||+++++||++|+++||||..
T Consensus 557 s~DHRviDGa~aa~Fl~~lk~~LE~~~~ 584 (590)
T TIGR02927 557 TYDHQLIDGADAGRFLTTIKDRLEEAAF 584 (590)
T ss_pred eccchhcCcHHHHHHHHHHHHHHhCccc
Confidence 9999999999999999999999999873
|
This model represents an Actinobacterial clade of E2 enzyme, a component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle. These proteins have multiple domains including the catalytic domain (pfam00198), one or two biotin domains (pfam00364) and an E3-component binding domain (pfam02817). |
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >KOG0557 consensus Dihydrolipoamide acetyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >KOG0558 consensus Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14843 dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11857 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF00198 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransferase (catalytic domain); InterPro: IPR001078 This domain is found in the lipoamide acyltransferase component of the branched-chain alpha-keto acid dehydrogenase complex 2 | Back alignment and domain information |
|---|
| >PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK13757 chloramphenicol acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00302 CAT: Chloramphenicol acetyltransferase; InterPro: IPR001707 Chloramphenicol acetyltransferase (CAT) (2 | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >COG4845 Chloramphenicol O-acetyltransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0557 consensus Dihydrolipoamide acetyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF02817 E3_binding: e3 binding domain; InterPro: IPR004167 A small domain of the E2 subunit of 2-oxo-acid dehydrogenases that is responsible for the binding of the E3 subunit | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >KOG0558 consensus Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PRK14843 dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein | Back alignment and domain information |
|---|
| >PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >KOG3373 consensus Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02946 acyl_WS_DGAT acyltransferase, WS/DGAT/MGAT | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF07247 AATase: Alcohol acetyltransferase; InterPro: IPR010828 This family contains a number of alcohol acetyltransferase (2 | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >PRK14844 bifunctional DNA-directed RNA polymerase subunit beta/beta'; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >KOG3373 consensus Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 639 | ||||
| 3b8k_A | 239 | Structure Of The Truncated Human Dihydrolipoyl Acet | 4e-47 | ||
| 3duf_I | 428 | Snapshots Of Catalysis In The E1 Subunit Of The Pyr | 4e-38 | ||
| 3mae_A | 256 | Crystal Structure Of Probable Dihydrolipamide Acety | 3e-31 | ||
| 1c4t_A | 233 | Catalytic Domain From Trimeric Dihydrolipoamide Suc | 1e-28 | ||
| 1b5s_A | 242 | Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalyt | 2e-28 | ||
| 1y8n_B | 128 | Crystal Structure Of The Pdk3-L2 Complex Length = 1 | 8e-26 | ||
| 1y8n_B | 128 | Crystal Structure Of The Pdk3-L2 Complex Length = 1 | 3e-22 | ||
| 1fyc_A | 106 | Inner Lipoyl Domain From Human Pyruvate Dehydrogena | 2e-24 | ||
| 1fyc_A | 106 | Inner Lipoyl Domain From Human Pyruvate Dehydrogena | 6e-22 | ||
| 3crk_C | 87 | Crystal Structure Of The Pdhk2-L2 Complex. Length = | 2e-23 | ||
| 3crk_C | 87 | Crystal Structure Of The Pdhk2-L2 Complex. Length = | 4e-21 | ||
| 2dne_A | 108 | Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain | 3e-23 | ||
| 2dne_A | 108 | Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain | 7e-22 | ||
| 1dpc_A | 243 | Crystallographic And Enzymatic Investigations On Th | 1e-22 | ||
| 1dpd_A | 243 | Crystallographic And Enzymatic Investigations On Th | 5e-22 | ||
| 1eaa_A | 243 | Atomic Structure Of The Cubic Core Of The Pyruvate | 8e-22 | ||
| 2dnc_A | 98 | Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain | 5e-21 | ||
| 2dnc_A | 98 | Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain | 4e-17 | ||
| 1dpb_A | 243 | Crystallographic And Enzymatic Investigations On Th | 5e-21 | ||
| 1zy8_L | 229 | The Crystal Structure Of Dihydrolipoamide Dehydroge | 7e-21 | ||
| 3rqc_A | 224 | Crystal Structure Of The Catalytic Core Of The 2-Ox | 1e-19 | ||
| 3l60_A | 250 | Crystal Structure Of Branched-Chain Alpha-Keto Acid | 1e-16 | ||
| 2ihw_A | 262 | Crystal Structure Of A Cubic Core Of The Dihydrolip | 3e-16 | ||
| 1lab_A | 80 | Three-Dimensional Structure Of The Lipoyl Domain Fr | 3e-07 | ||
| 1lab_A | 80 | Three-Dimensional Structure Of The Lipoyl Domain Fr | 1e-06 | ||
| 2l5t_A | 77 | Solution Nmr Structure Of E2 Lipoyl Domain From The | 5e-05 | ||
| 2xt6_A | 1113 | Crystal Structure Of Mycobacterium Smegmatis Alpha- | 1e-04 | ||
| 1pmr_A | 80 | Lipoyl Domain From The Dihydrolipoyl Succinyltransf | 2e-04 | ||
| 1pmr_A | 80 | Lipoyl Domain From The Dihydrolipoyl Succinyltransf | 6e-04 |
| >pdb|3B8K|A Chain A, Structure Of The Truncated Human Dihydrolipoyl Acetyltransferase (E2) Length = 239 | Back alignment and structure |
|
| >pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 | Back alignment and structure |
| >pdb|3MAE|A Chain A, Crystal Structure Of Probable Dihydrolipamide Acetyltransferase From Listeria Monocytogenes 4b F2365 Length = 256 | Back alignment and structure |
| >pdb|1C4T|A Chain A, Catalytic Domain From Trimeric Dihydrolipoamide Succinyltransferase Length = 233 | Back alignment and structure |
| >pdb|1B5S|A Chain A, Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalytic Domain (Residues 184-425) From Bacillus Stearothermophilus Length = 242 | Back alignment and structure |
| >pdb|1Y8N|B Chain B, Crystal Structure Of The Pdk3-L2 Complex Length = 128 | Back alignment and structure |
| >pdb|1Y8N|B Chain B, Crystal Structure Of The Pdk3-L2 Complex Length = 128 | Back alignment and structure |
| >pdb|1FYC|A Chain A, Inner Lipoyl Domain From Human Pyruvate Dehydrogenase (Pdh) Complex, Nmr, 1 Structure Length = 106 | Back alignment and structure |
| >pdb|1FYC|A Chain A, Inner Lipoyl Domain From Human Pyruvate Dehydrogenase (Pdh) Complex, Nmr, 1 Structure Length = 106 | Back alignment and structure |
| >pdb|3CRK|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87 | Back alignment and structure |
| >pdb|3CRK|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87 | Back alignment and structure |
| >pdb|2DNE|A Chain A, Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain Of Human 2-Oxoacid Dehydrogenase Length = 108 | Back alignment and structure |
| >pdb|2DNE|A Chain A, Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain Of Human 2-Oxoacid Dehydrogenase Length = 108 | Back alignment and structure |
| >pdb|1DPC|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|1DPD|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|1EAA|A Chain A, Atomic Structure Of The Cubic Core Of The Pyruvate Dehydrogenase Multienzyme Complex Length = 243 | Back alignment and structure |
| >pdb|2DNC|A Chain A, Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain From Human 2-Oxoacid Dehydrogenase Length = 98 | Back alignment and structure |
| >pdb|2DNC|A Chain A, Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain From Human 2-Oxoacid Dehydrogenase Length = 98 | Back alignment and structure |
| >pdb|1DPB|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|3RQC|A Chain A, Crystal Structure Of The Catalytic Core Of The 2-Oxoacid Dehydrogenase Multienzyme Complex From Thermoplasma Acidophilum Length = 224 | Back alignment and structure |
| >pdb|3L60|A Chain A, Crystal Structure Of Branched-Chain Alpha-Keto Acid Dehydrogenase Subunit E2 From Mycobacterium Tuberculosis Length = 250 | Back alignment and structure |
| >pdb|2IHW|A Chain A, Crystal Structure Of A Cubic Core Of The Dihydrolipoamide Acyltransferase (E2b) Component In The Branched-Chain Alpha-Ketoacid Dehydrogenase Complex (Bckdc), Apo Form Length = 262 | Back alignment and structure |
| >pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 | Back alignment and structure |
| >pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 | Back alignment and structure |
| >pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 | Back alignment and structure |
| >pdb|2XT6|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Alpha-Ketoglutarate Decarboxylase Homodimer (Orthorhombic Form) Length = 1113 | Back alignment and structure |
| >pdb|1PMR|A Chain A, Lipoyl Domain From The Dihydrolipoyl Succinyltransferase Component Of The 2-Oxoglutarate Dehydrogenase Multienzyme Complex Of Escherichia Coli, Nmr, 25 Structures Length = 80 | Back alignment and structure |
| >pdb|1PMR|A Chain A, Lipoyl Domain From The Dihydrolipoyl Succinyltransferase Component Of The 2-Oxoglutarate Dehydrogenase Multienzyme Complex Of Escherichia Coli, Nmr, 25 Structures Length = 80 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 639 | |||
| 3b8k_A | 239 | PDCE2;, dihydrolipoyllysine-residue acetyltransfer | 1e-111 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 2e-99 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 8e-18 | |
| 3l60_A | 250 | Branched-chain alpha-keto acid dehydrogenase; stru | 2e-80 | |
| 2ii3_A | 262 | Lipoamide acyltransferase component of branched-C | 5e-71 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 3e-69 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 3e-42 | |
| 1dpb_A | 243 | Dihydrolipoyl-transacetylase; dihydrolipoamide ace | 1e-68 | |
| 3rqc_A | 224 | Probable lipoamide acyltransferase; alpha beta fol | 2e-66 | |
| 3mae_A | 256 | 2-oxoisovalerate dehydrogenase E2 component, dihyd | 9e-62 | |
| 1scz_A | 233 | E2, dihydrolipoamide succinyltransferase; COA-depe | 1e-52 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 6e-51 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 3e-45 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 1e-49 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 1e-44 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 7e-49 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 4e-45 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 6e-44 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 5e-40 | |
| 1q23_A | 219 | Chloramphenicol acetyltransferase; CAT I, trimer, | 2e-34 | |
| 3cla_A | 213 | Type III chloramphenicol acetyltransferase; transf | 1e-30 | |
| 2i9d_A | 217 | Chloramphenicol acetyltransferase; structural geno | 5e-25 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 7e-16 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 6e-14 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 1e-15 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 5e-13 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 1e-14 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 3e-13 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 2e-14 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 3e-13 | |
| 2xt6_A | 1113 | 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET | 2e-09 | |
| 2f60_K | 64 | Pyruvate dehydrogenase protein X component; protei | 4e-08 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 4e-08 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 6e-08 | |
| 1bal_A | 51 | Dihydrolipoamide succinyltransferase; glycolysis; | 6e-08 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 6e-08 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 2eq7_C | 40 | 2-oxoglutarate dehydrogenase E2 component; protein | 2e-06 | |
| 3rnm_E | 58 | Lipoamide acyltransferase component of branched-C | 1e-05 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 2e-05 | |
| 2coo_A | 70 | Lipoamide acyltransferase component of branched- c | 2e-05 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 3e-05 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 5e-05 | |
| 1w4i_A | 62 | Pyruvate dehydrogenase E2; transferase, peripheral | 6e-05 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 7e-05 | |
| 1w85_I | 49 | Dihydrolipoyllysine-residue acetyltransferase comp | 2e-04 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 7e-04 |
| >3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 | Back alignment and structure |
|---|
Score = 333 bits (856), Expect = e-111
Identities = 111/236 (47%), Positives = 146/236 (61%), Gaps = 7/236 (2%)
Query: 406 SDSFEDFPNTQIRKVIARRLLESKQNTPHLYLSSDVVLDPLLSFRKELKE--KHNTKVSV 463
+ F D P + IR+VIA+RL++SKQ PH YLS DV + +L RKEL + + +K+SV
Sbjct: 9 TGVFTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGRSKISV 68
Query: 464 NDIVIKAVAVALKNVPEANAYWDVEKGEIVLCDAIDISIAVATEKGLMTPIVRNADQKSI 523
ND +IKA A+A VPEAN+ W I +D+S+AV+T GL+TPIV NA K +
Sbjct: 69 NDFIIKASALACLKVPEANSSWMDTV--IRQNHVVDVSVAVSTPAGLITPIVFNAHIKGV 126
Query: 524 SAISMEVKELAEKARAGKLAPHEFQGGTFSISNLGMFPVDQFCAIINPPQAGILAVGRGN 583
I+ +V LA KAR GKL PHEFQGGTF+ISNLGMF + F AIINPPQA ILA+G
Sbjct: 127 ETIANDVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASE 186
Query: 584 QVVEPVIGSDGNETPAVVTKMNLTLSADHRVFEGKVGGAFFSALCSNFSDIRRLLL 639
+ P D + V + M++TLS DHRV +G VG + + +LL
Sbjct: 187 DKLVPA---DNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL 239
|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 | Back alignment and structure |
|---|
| >2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Length = 262 | Back alignment and structure |
|---|
| >1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Length = 243 | Back alignment and structure |
|---|
| >3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Length = 224 | Back alignment and structure |
|---|
| >3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Length = 256 | Back alignment and structure |
|---|
| >1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Length = 233 | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 | Back alignment and structure |
|---|
| >1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Length = 219 | Back alignment and structure |
|---|
| >3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Length = 213 | Back alignment and structure |
|---|
| >2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} Length = 217 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Length = 1113 | Back alignment and structure |
|---|
| >2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K Length = 64 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Length = 51 | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Length = 40 | Back alignment and structure |
|---|
| >3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} PDB: 1zwv_A Length = 58 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 | Back alignment and structure |
|---|
| >2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Length = 62 | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 | Back alignment and structure |
|---|
| >1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Length = 49 | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 639 | |||
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| 1dpb_A | 243 | Dihydrolipoyl-transacetylase; dihydrolipoamide ace | 100.0 | |
| 3l60_A | 250 | Branched-chain alpha-keto acid dehydrogenase; stru | 100.0 | |
| 3mae_A | 256 | 2-oxoisovalerate dehydrogenase E2 component, dihyd | 100.0 | |
| 1scz_A | 233 | E2, dihydrolipoamide succinyltransferase; COA-depe | 100.0 | |
| 2ii3_A | 262 | Lipoamide acyltransferase component of branched-C | 100.0 | |
| 3rqc_A | 224 | Probable lipoamide acyltransferase; alpha beta fol | 100.0 | |
| 3b8k_A | 239 | PDCE2;, dihydrolipoyllysine-residue acetyltransfer | 100.0 | |
| 1q23_A | 219 | Chloramphenicol acetyltransferase; CAT I, trimer, | 100.0 | |
| 2xt6_A | 1113 | 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET | 100.0 | |
| 3cla_A | 213 | Type III chloramphenicol acetyltransferase; transf | 100.0 | |
| 2i9d_A | 217 | Chloramphenicol acetyltransferase; structural geno | 100.0 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 99.94 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.78 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.76 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.74 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 99.73 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 99.71 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.68 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.67 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 99.67 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.66 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 99.64 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.64 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 99.61 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 99.61 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 99.6 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 99.6 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 99.59 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 99.58 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 99.54 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 99.53 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 99.51 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 99.5 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 99.48 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 99.45 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 99.41 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.39 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.36 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 99.29 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.27 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 99.27 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 99.22 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 99.15 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 99.15 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 99.14 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 99.13 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 99.12 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 99.11 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 99.08 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 99.07 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.04 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 99.03 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 98.98 | |
| 2eq9_C | 41 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 98.96 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 98.96 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 98.96 | |
| 3rnm_E | 58 | Lipoamide acyltransferase component of branched-C | 98.95 | |
| 2eq8_C | 40 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 98.94 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 98.93 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 98.93 | |
| 2eq7_C | 40 | 2-oxoglutarate dehydrogenase E2 component; protein | 98.91 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 98.91 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 98.9 | |
| 1w85_I | 49 | Dihydrolipoyllysine-residue acetyltransferase comp | 98.85 | |
| 1bal_A | 51 | Dihydrolipoamide succinyltransferase; glycolysis; | 98.84 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 98.81 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 98.75 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 98.72 | |
| 1w4i_A | 62 | Pyruvate dehydrogenase E2; transferase, peripheral | 98.72 | |
| 2f60_K | 64 | Pyruvate dehydrogenase protein X component; protei | 98.71 | |
| 2coo_A | 70 | Lipoamide acyltransferase component of branched- c | 98.68 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 98.68 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 98.67 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 98.6 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 98.56 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 98.44 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 98.42 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 98.4 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 98.34 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 98.24 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 98.2 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 98.18 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 97.99 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 97.97 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 97.9 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 97.7 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 97.63 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 97.62 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 97.61 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 97.56 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 97.44 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 97.37 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 97.27 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 97.24 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 97.22 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 97.2 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 97.18 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 97.12 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 97.1 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 96.99 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 96.88 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 96.77 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 96.76 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 96.53 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 96.51 | |
| 2xhc_A | 352 | Transcription antitermination protein NUSG; 2.45A | 95.92 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 95.87 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 95.5 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 95.21 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 94.99 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 94.63 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 94.17 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 94.02 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 93.45 | |
| 3lu0_D | 1407 | DNA-directed RNA polymerase subunit beta'; E. coli | 92.95 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 92.53 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 91.49 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 91.29 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 90.69 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 89.51 | |
| 3d4r_A | 169 | Domain of unknown function from the PFAM-B_34464; | 89.01 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 87.17 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 86.8 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 86.45 | |
| 2auk_A | 190 | DNA-directed RNA polymerase beta' chain; sandwich- | 83.74 | |
| 3d4r_A | 169 | Domain of unknown function from the PFAM-B_34464; | 81.78 |
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
Probab=100.00 E-value=3.6e-88 Score=737.66 Aligned_cols=410 Identities=28% Similarity=0.429 Sum_probs=39.0
Q ss_pred eeeecCCCCCcccccccceeecCCCCccccCCeeeEeecCcceeeEecCCCeeEEEEecCCCCccccCCCeEEEEecCCC
Q 006594 213 VVLEMPALSPTMNQGNIAKWRKNEGDKIEVGDVICEIETDKATLEFECLEEGYLAKILAPEGSKDVAVGQPIAITVEDPG 292 (639)
Q Consensus 213 ~~~~~P~l~~~~~~g~i~~w~v~~Gd~V~~gd~l~~vetdK~~~ei~s~~~G~v~~i~~~~G~~~v~vG~~l~~i~~~~~ 292 (639)
++|+||+||++|++|+|++|+|++||.|++||+||+|||||++++|+||++|+|.++++++|+. |++|++|++|.++++
T Consensus 3 ~~i~mP~lg~~~~eg~i~~w~v~~Gd~V~~gd~l~~vEt~K~~~~i~ap~~G~v~~i~v~~G~~-V~~G~~l~~i~~~~~ 81 (428)
T 3dva_I 3 FEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTV-ATVGQTLITLDAPGY 81 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred eeEEcCCCCCCCccEEEEEEEcCCCCEECCCCEEEEEEeCCeeEEEecCCCeEEEEEEeCCCCE-eCCCCEEEEEecCCc
Confidence 4789999999999999999999999999999999999999999999999999999999999999 999999999987655
Q ss_pred CcCCcCC-CCCCC---cccC-CCCCCC--CCCcc--ccc--cccCCCccCChhHHhhHHHcCCCcccccccCCCCeeecc
Q 006594 293 DVGTVKN-SVTSG---AEVK-GEKETH--HDSKD--VVK--VQKGSFTKISPSAKLLILEHGLDASSLQASGPYGTLLKG 361 (639)
Q Consensus 293 ~~~~~~~-~~~~~---~~~~-~~~~~~--~~~~~--~~~--~~~~~~~~asP~ar~lA~e~gIDls~v~gsGp~GrI~~~ 361 (639)
+..+... ..... +.+. .+.+.+ ...+. .+. .......++||+||+||+|+||||+.|+||||+|||+++
T Consensus 82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~asP~~R~lA~e~gvdl~~v~gtG~~GrI~k~ 161 (428)
T 3dva_I 82 ENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAAEAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKE 161 (428)
T ss_dssp ----------------------------------------------CCCCCHHHHHHHHHTTCCGGGSCCCSTTSCCCTT
T ss_pred cccccccccccccccCCCcccCCccccccCCCccccccccccccccccccCHHHHHHHHHcCCCHHHCCCCCCCCceeHH
Confidence 4322110 00000 0000 000000 00000 000 011234579999999999999999999999999999999
Q ss_pred chHHHHhcCCCccccCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCCcccccCcHHHHHHHHHhhhccCCcceEEeeeee
Q 006594 362 DVLAAIKSGKVSSRISSHTEKTSPSPLPQTSTAVSPGSKSDLELSDSFEDFPNTQIRKVIARRLLESKQNTPHLYLSSDV 441 (639)
Q Consensus 362 DV~~~~~~~~~~~~~~~a~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~s~~r~~ia~~m~~S~~~iP~~~~~~ev 441 (639)
||++|+....... +..+ +.+ ....| ..+. .......++++|+++|||.||++|.+|++++||||++.+|
T Consensus 162 DV~~~~~~~~~~~-~~~~----~~~--~~~~~--~~~~--~~~~~~~~~~~p~s~~Rk~ia~~m~~S~~~~P~~~~~~ev 230 (428)
T 3dva_I 162 DIDAFLAGGAKPA-PAAA----EEK--AAPAA--AKPA--TTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEA 230 (428)
T ss_dssp TTTTTSCC------------------------------------------------------------------------
T ss_pred HHHHHhhcccccc-cccc----ccc--cccCC--CCcc--ccccCCccccccCcHHHHHHHHHHHHhcccCCeEEEEEEE
Confidence 9999875321110 0000 000 00001 0000 0011123677899999999999999999999999999999
Q ss_pred echHHHHHHHHHhh---hCCCCcCHHHHHHHHHHHHHhhCcccceeeccCCCeEEEcCCccEEEEEecCCCeEEeeeecC
Q 006594 442 VLDPLLSFRKELKE---KHNTKVSVNDIVIKAVAVALKNVPEANAYWDVEKGEIVLCDAIDISIAVATEKGLMTPIVRNA 518 (639)
Q Consensus 442 Dvt~l~~~rk~~~~---~~g~kls~~~~likAva~Al~~~P~ln~~~~~~~~~i~~~~~v~i~iAV~~~~gl~~pvI~~a 518 (639)
|+|+|+++|+++|. +.|.++||++||+||+++||++||+||++|+++.++|++|+++||||||++++||++|+|+++
T Consensus 231 Dvt~l~~~rk~~~~~~~~~g~kls~~~~~ikAva~Al~~~P~~Na~~~~~~~~i~~~~~v~igiAV~t~~GL~vPvi~~a 310 (428)
T 3dva_I 231 DVTKLVAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTDRGLLVPVIKHA 310 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred eHHHHHHHHHHhhhhHhhcCCCcCHHHHHHHHHHHHHHhCHHhhheEecCCCeEEEcCccCeEEEEEcCCceEEeeeccC
Confidence 99999999999874 468899999999999999999999999999874345999999999999999999999999999
Q ss_pred CcCCHHHHHHHHHHHHHHHHcCCCCCCCCCCCeEEEEeCCCCCccceeeccCCCcceEEEecCceEEEEEeeCCCCCccc
Q 006594 519 DQKSISAISMEVKELAEKARAGKLAPHEFQGGTFSISNLGMFPVDQFCAIINPPQAGILAVGRGNQVVEPVIGSDGNETP 598 (639)
Q Consensus 519 ~~~sl~ei~~~~~~l~~~ar~g~l~~~d~~ggtftISnlG~~g~~~~~pii~~p~~ail~vG~~~~~~~~~~g~~G~~~~ 598 (639)
+.++|.+|+++++++.+++|+|+|.++|++||||||||+||||+++|+||||+||++||++|++.++|++.+| ++
T Consensus 311 ~~~sl~eia~~~~~l~~~ar~gkL~~~e~~ggtftISnlG~~G~~~ftpIin~pq~aIl~vG~i~~~pv~~~g-----~i 385 (428)
T 3dva_I 311 DRKPIFALAQEINELAEKARDGKLTPGEMKGASCTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPIVRDG-----EI 385 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred CCCCHHHHHHHHHHHHHHHHcCCCCccccCCCEEEEEcCCCCCccceEeecCCCCceEEEccccEEEEEEECC-----EE
Confidence 9999999999999999999999999999999999999999999999999999999999999999999988655 79
Q ss_pred EEEeEEEEEEEecccccChHHHHHHHHHHHHHHhchhhhcC
Q 006594 599 AVVTKMNLTLSADHRVFEGKVGGAFFSALCSNFSDIRRLLL 639 (639)
Q Consensus 599 ~~r~~m~lslt~DHRviDG~~aa~Fl~~l~~~Le~P~~ll~ 639 (639)
++|++|+|||+||||+|||+|+++||+.|+++||||+.||+
T Consensus 386 ~~r~~m~lsls~DHRviDG~~aa~Fl~~lk~~Le~P~~lll 426 (428)
T 3dva_I 386 VAAPMLALSLSFDHRMIDGATAQKALNHIKRLLSDPELLLM 426 (428)
T ss_dssp -----------------------------------------
T ss_pred EEeeeEEEEEEecccccchHHHHHHHHHHHHHHhCHHHHhh
Confidence 99999999999999999999999999999999999999885
|
| >1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A | Back alignment and structure |
|---|
| >3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: c.43.1.0 | Back alignment and structure |
|---|
| >3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A | Back alignment and structure |
|---|
| >2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* | Back alignment and structure |
|---|
| >3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* | Back alignment and structure |
|---|
| >2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* | Back alignment and structure |
|---|
| >2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} SCOP: a.9.1.0 PDB: 1zwv_A | Back alignment and structure |
|---|
| >2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* | Back alignment and structure |
|---|
| >1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A | Back alignment and structure |
|---|
| >2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K | Back alignment and structure |
|---|
| >2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A | Back alignment and structure |
|---|
| >2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >3lu0_D DNA-directed RNA polymerase subunit beta'; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_D* | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 639 | ||||
| d1scza_ | 233 | c.43.1.1 (A:) Dihydrolipoamide succinyltransferase | 9e-62 | |
| d1b5sa_ | 242 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 4e-48 | |
| d1q23a_ | 214 | c.43.1.1 (A:) Chloramphenicol acetyltransferase, C | 1e-44 | |
| d3claa_ | 213 | c.43.1.1 (A:) Chloramphenicol acetyltransferase, C | 5e-44 | |
| d1dpba_ | 243 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 2e-39 | |
| d1y8ob1 | 102 | b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa | 3e-28 | |
| d1y8ob1 | 102 | b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa | 4e-26 | |
| d1k8ma_ | 87 | b.84.1.1 (A:) Lipoyl domain of the mitochondrial b | 7e-21 | |
| d1k8ma_ | 87 | b.84.1.1 (A:) Lipoyl domain of the mitochondrial b | 2e-18 | |
| d1pmra_ | 80 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 3e-20 | |
| d1pmra_ | 80 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 1e-19 | |
| d1ghja_ | 79 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 9e-19 | |
| d1ghja_ | 79 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 8e-18 | |
| d1laba_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 3e-18 | |
| d1laba_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 3e-17 | |
| d1gjxa_ | 81 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 7e-14 | |
| d1gjxa_ | 81 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 5e-13 | |
| d1qjoa_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 9e-13 | |
| d1qjoa_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 3e-11 | |
| d1iyua_ | 79 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 2e-12 | |
| d1iyua_ | 79 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 7e-12 | |
| d1dcza_ | 77 | b.84.1.1 (A:) Biotin carboxyl carrier domain of tr | 9e-11 | |
| d1dcza_ | 77 | b.84.1.1 (A:) Biotin carboxyl carrier domain of tr | 1e-09 | |
| d2cyua1 | 39 | a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoa | 2e-07 | |
| d1w85i_ | 42 | a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl | 4e-07 | |
| d1bdoa_ | 80 | b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carbox | 8e-04 | |
| d1bdoa_ | 80 | b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carbox | 0.002 |
| >d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 233 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: CoA-dependent acyltransferases superfamily: CoA-dependent acyltransferases family: CAT-like domain: Dihydrolipoamide succinyltransferase species: Escherichia coli [TaxId: 562]
Score = 202 bits (516), Expect = 9e-62
Identities = 81/234 (34%), Positives = 126/234 (53%), Gaps = 11/234 (4%)
Query: 410 EDFPNTQIRKVIARRLLESKQNTPHLYLSSDVVLDPLLSFRKEL----KEKHNTKVSVND 465
+ P T++RK +A RLLE+K +T L ++V + P++ RK+ +++H ++
Sbjct: 5 KRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMS 64
Query: 466 IVIKAVAVALKNVPEANAYWDVEKGEIVLCDAIDISIAVATEKGLMTPIVRNADQKSISA 525
+KAV ALK PE NA D ++V + D+S+AV+T +GL+TP++R+ D ++
Sbjct: 65 FYVKAVVEALKRYPEVNASID--GDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMAD 122
Query: 526 ISMEVKELAEKARAGKLAPHEFQGGTFSISNLGMFPVDQFCAIINPPQAGILAVGRGNQV 585
I ++KELA K R GKL + GG F+I+N G+F IINPPQ+ IL +
Sbjct: 123 IEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDR 182
Query: 586 VEPVIGSDGNETPAVVTKMNLTLSADHRVFEGKVGGAFFSALCSNFSDIRRLLL 639
V N ++ M L LS DHR+ +G+ F + D RLLL
Sbjct: 183 PMAV-----NGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLL 231
|
| >d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 | Back information, alignment and structure |
|---|
| >d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 214 | Back information, alignment and structure |
|---|
| >d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 213 | Back information, alignment and structure |
|---|
| >d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 243 | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 | Back information, alignment and structure |
|---|
| >d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 39 | Back information, alignment and structure |
|---|
| >d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 42 | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 639 | |||
| d1dpba_ | 243 | Dihydrolipoamide acetyltransferase {Azotobacter vi | 100.0 | |
| d1scza_ | 233 | Dihydrolipoamide succinyltransferase {Escherichia | 100.0 | |
| d1b5sa_ | 242 | Dihydrolipoamide acetyltransferase {Bacillus stear | 100.0 | |
| d1q23a_ | 214 | Chloramphenicol acetyltransferase, CAT {Escherichi | 100.0 | |
| d3claa_ | 213 | Chloramphenicol acetyltransferase, CAT {Escherichi | 100.0 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.87 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.86 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 99.85 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.84 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.82 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.81 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.79 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 99.79 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.78 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.78 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.78 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.78 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.75 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.72 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.7 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.67 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 99.54 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 99.47 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 99.35 | |
| d1w85i_ | 42 | E3/E1 binding domain of dihydrolipoyl acetyltransf | 99.33 | |
| d2cyua1 | 39 | E3-binding domain of dihydrolipoamide succinyltran | 99.32 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 99.24 | |
| d1onla_ | 127 | Protein H of glycine cleavage system {Thermus ther | 96.84 | |
| d1hpca_ | 131 | Protein H of glycine cleavage system {Pea (Pisum s | 96.71 | |
| d1onla_ | 127 | Protein H of glycine cleavage system {Thermus ther | 96.27 | |
| d1hpca_ | 131 | Protein H of glycine cleavage system {Pea (Pisum s | 96.16 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 95.16 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 93.49 | |
| d1e2wa2 | 64 | Cytochrome f, small domain {Chlamydomonas reinhard | 85.36 |
| >d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: CoA-dependent acyltransferases superfamily: CoA-dependent acyltransferases family: CAT-like domain: Dihydrolipoamide acetyltransferase species: Azotobacter vinelandii [TaxId: 354]
Probab=100.00 E-value=3.8e-58 Score=463.04 Aligned_cols=228 Identities=33% Similarity=0.442 Sum_probs=219.0
Q ss_pred CCcccccCcHHHHHHHHHhhhccCCcceEEeeeeeechHHHHHHHHHh---hhCCCCcCHHHHHHHHHHHHHhhCcccce
Q 006594 407 DSFEDFPNTQIRKVIARRLLESKQNTPHLYLSSDVVLDPLLSFRKELK---EKHNTKVSVNDIVIKAVAVALKNVPEANA 483 (639)
Q Consensus 407 ~~~~~~~~s~~r~~ia~~m~~S~~~iP~~~~~~evDvt~l~~~rk~~~---~~~g~kls~~~~likAva~Al~~~P~ln~ 483 (639)
+..+++|++++||.||++|++||+++||||++.++|+|+|+++|++++ ++.|.++|+++|++||++.||++||.+|+
T Consensus 13 G~~e~vpls~~Rk~iA~~m~~S~~~iPh~~~~~evD~t~l~~~r~~l~~~~~~~~~k~t~~~~iikA~a~Al~~~P~~Ns 92 (243)
T d1dpba_ 13 GEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAYLLKELPDFNS 92 (243)
T ss_dssp SCCCCCCCCHHHHHHHHHHHHHHHHSCEEEEEEEEECHHHHHHHHHTHHHHHHTTCCCCSHHHHHHHHHHHHHHSGGGGE
T ss_pred CCcEEEECcHHHHHHHHHHHHhhccCCEEEEEEEEecchHHHhhhhhhhhhhhcCccccHHHHHHHHHHHHHHHhhhhhh
Confidence 457789999999999999999999999999999999999999998876 45889999999999999999999999999
Q ss_pred eeccCCCeEEEcCCccEEEEEecCCCeEEeeeecCCcCCHHHHHHHHHHHHHHHHcCCCCCCCCCCCeEEEEeCCCCCcc
Q 006594 484 YWDVEKGEIVLCDAIDISIAVATEKGLMTPIVRNADQKSISAISMEVKELAEKARAGKLAPHEFQGGTFSISNLGMFPVD 563 (639)
Q Consensus 484 ~~~~~~~~i~~~~~v~i~iAV~~~~gl~~pvI~~a~~~sl~ei~~~~~~l~~~ar~g~l~~~d~~ggtftISnlG~~g~~ 563 (639)
.|+++..++++++++|||+||++++||++|||++++++|+.+|++++++|.+++|+|+|+++|++||||||||+|++|++
T Consensus 93 ~~~~~~~~~~~~~~inigiAv~~~~GL~vPVI~~a~~~sl~~i~~~~~~l~~~ar~~~l~~~d~~ggTfTiSNlG~~G~~ 172 (243)
T d1dpba_ 93 SLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGT 172 (243)
T ss_dssp EECTTSSCEEECSSCCEEECEEETTEEECCEETTGGGSCHHHHHHHHHHHHHHHHTTCCCGGGGSCCSEEEEECTTTCCS
T ss_pred ccccccccceeecccceeeeeccCcceeeeeecchhhhhHHHHHHHHHHHHHHhhhcccccccccCceeEEeccCCccce
Confidence 99877567999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ceeeccCCCcceEEEecCceEEEEEeeCCCCCcccEEEeEEEEEEEecccccChHHHHHHHHHHHHHHhchhhhcC
Q 006594 564 QFCAIINPPQAGILAVGRGNQVVEPVIGSDGNETPAVVTKMNLTLSADHRVFEGKVGGAFFSALCSNFSDIRRLLL 639 (639)
Q Consensus 564 ~~~pii~~p~~ail~vG~~~~~~~~~~g~~G~~~~~~r~~m~lslt~DHRviDG~~aa~Fl~~l~~~Le~P~~ll~ 639 (639)
+|+|||||||++||++|++.++|++++| ++++|++|+|||+||||++||+++|+||++|+++||||+.|||
T Consensus 173 ~~tpiInppq~aIlgvG~i~~~pv~~~~-----~i~~r~~m~ltls~DHRvidGa~aa~FL~~l~~~lE~P~~lll 243 (243)
T d1dpba_ 173 AFTPIVNAPEVAILGVSKASMQPVWDGK-----AFQPRLMLPLSLSYDCRVINGAAAARFTKRLGDLLADIRAILL 243 (243)
T ss_dssp CCCCCCCTTSSEEEEECCCEEEEEECSS-----SEEEEEEEEEEEEEETTTSCHHHHHHHHHHHHHHHHCGGGGGC
T ss_pred eEEeeeccccceeeecccceeeEEEECC-----EEEEEEEEEEEEEeecccccHHHHHHHHHHHHHHHhCHHHHhC
Confidence 9999999999999999999999988655 8999999999999999999999999999999999999999986
|
| >d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1e2wa2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|