Citrus Sinensis ID: 006616
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 638 | ||||||
| 296085519 | 832 | unnamed protein product [Vitis vinifera] | 1.0 | 0.766 | 0.860 | 0.0 | |
| 224072473 | 830 | predicted protein [Populus trichocarpa] | 0.996 | 0.766 | 0.844 | 0.0 | |
| 224057840 | 840 | predicted protein [Populus trichocarpa] | 0.995 | 0.755 | 0.821 | 0.0 | |
| 255543198 | 1369 | ATP binding protein, putative [Ricinus c | 0.996 | 0.464 | 0.835 | 0.0 | |
| 356523716 | 1228 | PREDICTED: ADP-ribosylation factor GTPas | 0.984 | 0.511 | 0.834 | 0.0 | |
| 356567188 | 1231 | PREDICTED: ADP-ribosylation factor GTPas | 0.965 | 0.500 | 0.843 | 0.0 | |
| 449469220 | 1191 | PREDICTED: ADP-ribosylation factor GTPas | 0.995 | 0.533 | 0.810 | 0.0 | |
| 449520667 | 1194 | PREDICTED: ADP-ribosylation factor GTPas | 0.995 | 0.531 | 0.810 | 0.0 | |
| 357502667 | 832 | ADP-ribosylation factor GTPase-activatin | 0.996 | 0.764 | 0.803 | 0.0 | |
| 297811447 | 828 | hypothetical protein ARALYDRAFT_488148 [ | 0.981 | 0.756 | 0.764 | 0.0 |
| >gi|296085519|emb|CBI29251.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1111 bits (2873), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 549/638 (86%), Positives = 581/638 (91%)
Query: 1 MDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNERMQEYKRQIDRESRW 60
MDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERS YEQAALNE+MQE+KRQIDRESRW
Sbjct: 195 MDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSKYEQAALNEKMQEFKRQIDRESRW 254
Query: 61 ASNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRF 120
SNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRF
Sbjct: 255 PSNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRF 314
Query: 121 FVLDSRGMLYYYRKQCSKSSGSGSQLSSQRNSSELGSGLLSRWLSSHYHGGVHDEKSAAR 180
FVLDSRGMLYYYRKQ SK SGSGSQ S QRNSSELGSGLLSRWLSSHYHGGVHDEKS A
Sbjct: 315 FVLDSRGMLYYYRKQNSKPSGSGSQHSGQRNSSELGSGLLSRWLSSHYHGGVHDEKSVAH 374
Query: 181 HTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLSSQ 240
HTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLSSQ
Sbjct: 375 HTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLSSQ 434
Query: 241 APERCLPTSPMGSGHHRSASDSSSFESSDFDHAAVEEYTSERNLTSAYHERQSRGSQQQR 300
APERCLP SPMGS HHRSAS+SSS+ES+DFDH AVEEYTSER+ +A+HER S+G QQ R
Sbjct: 435 APERCLPISPMGSSHHRSASESSSYESTDFDHTAVEEYTSERSSATAHHERPSKGLQQIR 494
Query: 301 SCVKSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRS 360
SC+KSEKPIDVLRRVCGND+CADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRS
Sbjct: 495 SCIKSEKPIDVLRRVCGNDKCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRS 554
Query: 361 LTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGK 420
LTLDVKVWEPSV+TLFQSLGN FANSVWEELLQSR+AF VDL P L+KSDKPQL + K
Sbjct: 555 LTLDVKVWEPSVLTLFQSLGNTFANSVWEELLQSRNAFQVDLVPTGLYKSDKPQLHFISK 614
Query: 421 PSHSDSISVKEKFIHAKYAEKLFVRKPKDNQYLHSVAHQIWEGVRTNDKKAVYRHIVNFE 480
PSH+DSIS+KEK+IHAKYAEKLFVRKPKDNQY V QIW+ VRTNDKKAVYR+IVN E
Sbjct: 615 PSHADSISIKEKYIHAKYAEKLFVRKPKDNQYPCLVTQQIWDAVRTNDKKAVYRYIVNSE 674
Query: 481 VDVNAVYEQVSCISSLTLAKAMLLNEQTSLERSSSSLTGNSSDRSSSGSLNLAGTSEGQT 540
DVN VYEQ C SSLTLAK MLL EQT+L+ SS LTG+S D+SS S N A TSEGQT
Sbjct: 675 ADVNVVYEQTLCNSSLTLAKVMLLQEQTNLDHSSRCLTGDSFDKSSVSSSNAASTSEGQT 734
Query: 541 MDDLEGCTLLHLACDSADIGMLELLLQYGANINATDSRGLTPLHRCILRGKAMFAKLLLT 600
M+D +G +LLHLAC++ADIGMLELLLQYGANINA DSRG PLHRCILRGKA FAKLLLT
Sbjct: 735 MEDFDGWSLLHLACETADIGMLELLLQYGANINACDSRGQMPLHRCILRGKATFAKLLLT 794
Query: 601 RGADPRAVNREGKTSLELAVESNFADSEVLAILSDSHG 638
RGADPRAVN EGKT ELAVESNF DS+VLA+LSDS+G
Sbjct: 795 RGADPRAVNGEGKTPFELAVESNFVDSDVLALLSDSNG 832
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224072473|ref|XP_002303749.1| predicted protein [Populus trichocarpa] gi|222841181|gb|EEE78728.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224057840|ref|XP_002299350.1| predicted protein [Populus trichocarpa] gi|222846608|gb|EEE84155.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255543198|ref|XP_002512662.1| ATP binding protein, putative [Ricinus communis] gi|223548623|gb|EEF50114.1| ATP binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356523716|ref|XP_003530481.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356567188|ref|XP_003551803.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449469220|ref|XP_004152319.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449520667|ref|XP_004167355.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357502667|ref|XP_003621622.1| ADP-ribosylation factor GTPase-activating protein AGD3 [Medicago truncatula] gi|355496637|gb|AES77840.1| ADP-ribosylation factor GTPase-activating protein AGD3 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297811447|ref|XP_002873607.1| hypothetical protein ARALYDRAFT_488148 [Arabidopsis lyrata subsp. lyrata] gi|297319444|gb|EFH49866.1| hypothetical protein ARALYDRAFT_488148 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 638 | ||||||
| TAIR|locus:2183916 | 827 | SFC "SCARFACE" [Arabidopsis th | 0.979 | 0.755 | 0.651 | 3.3e-214 | |
| TAIR|locus:2197359 | 775 | AGD4 "ARF-GAP domain 4" [Arabi | 0.373 | 0.307 | 0.444 | 1.8e-110 | |
| TAIR|locus:2025850 | 776 | AGD2 "ARF-GAP domain 2" [Arabi | 0.271 | 0.222 | 0.502 | 6.4e-110 | |
| UNIPROTKB|Q96P50 | 834 | ACAP3 "Arf-GAP with coiled-coi | 0.133 | 0.101 | 0.574 | 1.3e-46 | |
| UNIPROTKB|F1MWF6 | 820 | ACAP3 "Uncharacterized protein | 0.133 | 0.103 | 0.574 | 6.2e-46 | |
| UNIPROTKB|D4AAD1 | 833 | Acap3 "Protein Acap3" [Rattus | 0.133 | 0.102 | 0.574 | 1.6e-45 | |
| UNIPROTKB|E2QY37 | 833 | ACAP3 "Uncharacterized protein | 0.133 | 0.102 | 0.563 | 2e-44 | |
| UNIPROTKB|F1RJG0 | 821 | ACAP3 "Uncharacterized protein | 0.133 | 0.103 | 0.574 | 9.1e-43 | |
| UNIPROTKB|F1NGZ5 | 834 | ACAP3 "Uncharacterized protein | 0.133 | 0.101 | 0.563 | 1.3e-42 | |
| UNIPROTKB|D4A346 | 563 | Acap3 "Protein Acap3" [Rattus | 0.133 | 0.150 | 0.574 | 1.5e-42 |
| TAIR|locus:2183916 SFC "SCARFACE" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2070 (733.7 bits), Expect = 3.3e-214, P = 3.3e-214
Identities = 417/640 (65%), Positives = 469/640 (73%)
Query: 1 MDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNERMQEYKRQIDRESRW 60
MDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNE+MQEYKRQ+DRESRW
Sbjct: 195 MDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNEKMQEYKRQVDRESRW 254
Query: 61 AXXXXXXXXXXDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRF 120
DGIQAIGRSSHKMI+AVMQSAA+GKVQTIRQGYLSKRSSNLRGDWKRRF
Sbjct: 255 GSNGSNGSPNGDGIQAIGRSSHKMIDAVMQSAARGKVQTIRQGYLSKRSSNLRGDWKRRF 314
Query: 121 FVLDSRGMLYYYRKQCXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXHYHGGVHDEKSA 178
FVLDSRGMLYYYRKQC H HGGVHDEKS
Sbjct: 315 FVLDSRGMLYYYRKQCSKPSGSGSQLSGQRNSSELGSGLLSRWLSSNNHGHGGVHDEKSV 374
Query: 179 ARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLS 238
ARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLS
Sbjct: 375 ARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLS 434
Query: 239 SQAPERCLPTSPMXXXXXXXXXXXXXXXXXXXXXXXVEEYTSERNLTSAYHEXXXXXXXX 298
SQ PE+ LP SPM EE+ ER+ Y+E
Sbjct: 435 SQVPEQRLPGSPMGSGHHRSASESSSYESSEYDHPTTEEFVCERSFLG-YNERPSRSFQP 493
Query: 299 XXXCVKSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKV 358
K EKPID LR+VCGND+CADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKV
Sbjct: 494 QRSIRKGEKPIDALRKVCGNDKCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKV 553
Query: 359 RSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLM 418
RSLTLDVKVWEPSVI+LFQ+LGN FAN+VWEELL SRSA H D P L SDK ++++
Sbjct: 554 RSLTLDVKVWEPSVISLFQALGNTFANTVWEELLHSRSAIHFD---PGLTVSDKSRVMVT 610
Query: 419 GKPSHSDSISVKEKFIHAKYAEKLFVRKPKDNQYLHSVAHQIWEGVRTNDKKAVYRHIVN 478
GKPS++D IS+KEK+I AKYAEKLFVR+ +D+ + S A Q+W+ V NDKKAVYR IVN
Sbjct: 611 GKPSYADMISIKEKYIQAKYAEKLFVRRSRDSDFPQSAAQQMWDAVSGNDKKAVYRLIVN 670
Query: 479 FEVDVNAVYEQVSCISSLTLAKAMLLNEQXXXXXXXXXXXXXXXXXXXXXXXXXAGTSEG 538
+ DVN VY+Q S SSLTL++ +L+ E+ G+S
Sbjct: 671 GDADVNYVYDQTSS-SSLTLSRVILVPERPKREDVLLRLRNELLDRT--------GSSSN 721
Query: 539 QTMDDLEGCTLLHLACDSADIGMLELLLQYGANINATDSRGLTPLHRCILRGKAMFAKLL 598
+ + G +LLH AC+ AD+GM+ELLLQYGAN+NA+DS G TPLH C+LRGK A+LL
Sbjct: 722 ISPEGSGGSSLLHCACEKADLGMVELLLQYGANVNASDSSGQTPLHCCLLRGKVTIARLL 781
Query: 599 LTRGADPRAVNREGKTSLELAVESNFADSEVLAILSDSHG 638
LTRGADP A+NREGKT+L++A ESNF D EVLA+LSD++G
Sbjct: 782 LTRGADPEAMNREGKTALDIAAESNFTDPEVLALLSDTNG 821
|
|
| TAIR|locus:2197359 AGD4 "ARF-GAP domain 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025850 AGD2 "ARF-GAP domain 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96P50 ACAP3 "Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MWF6 ACAP3 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4AAD1 Acap3 "Protein Acap3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QY37 ACAP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RJG0 ACAP3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NGZ5 ACAP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A346 Acap3 "Protein Acap3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00006190001 | SubName- Full=Chromosome chr1 scaffold_166, whole genome shotgun sequence; (832 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 638 | |||
| pfam01412 | 117 | pfam01412, ArfGap, Putative GTPase activating prot | 1e-46 | |
| smart00105 | 119 | smart00105, ArfGap, Putative GTP-ase activating pr | 2e-39 | |
| cd13250 | 98 | cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin | 4e-34 | |
| COG5347 | 319 | COG5347, COG5347, GTPase-activating protein that r | 9e-27 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 7e-23 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 9e-21 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 8e-14 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 1e-13 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 3e-13 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 4e-13 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 2e-12 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 6e-12 | |
| PLN03114 | 395 | PLN03114, PLN03114, ADP-ribosylation factor GTPase | 4e-11 | |
| cd13276 | 117 | cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin | 9e-11 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 1e-10 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 3e-10 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 3e-10 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 2e-09 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 4e-09 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 8e-09 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 1e-08 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 3e-08 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 6e-08 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 1e-07 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 1e-07 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 2e-07 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 2e-07 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 4e-07 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 6e-07 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 8e-07 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 1e-06 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 3e-06 | |
| cd01251 | 105 | cd01251, PH2_ADAP, ArfGAP with dual PH domains Ple | 3e-06 | |
| cd13288 | 120 | cd13288, PH_Ses, Sesquipedalian family Pleckstrin | 4e-06 | |
| cd13282 | 96 | cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology | 8e-06 | |
| smart00248 | 30 | smart00248, ANK, ankyrin repeats | 1e-05 | |
| pfam13606 | 30 | pfam13606, Ank_3, Ankyrin repeat | 1e-05 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 3e-05 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 3e-05 | |
| cd01233 | 111 | cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein p | 4e-05 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 5e-05 | |
| cd13296 | 111 | cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P | 5e-05 | |
| cd13255 | 110 | cd13255, PH_TAAP2-like, Tandem PH-domain-containin | 5e-05 | |
| cd10573 | 96 | cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosin | 7e-05 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 1e-04 | |
| cd13247 | 125 | cd13247, BAR-PH_APPL, Adaptor protein containing P | 1e-04 | |
| cd07606 | 202 | cd07606, BAR_SFC_plant, The Bin/Amphiphysin/Rvs (B | 1e-04 | |
| cd13298 | 106 | cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin | 1e-04 | |
| cd13266 | 106 | cd13266, PH_Skap_family, Src kinase-associated pho | 1e-04 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 2e-04 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 2e-04 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 2e-04 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 2e-04 | |
| PHA02798 | 489 | PHA02798, PHA02798, ankyrin-like protein; Provisio | 2e-04 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 3e-04 | |
| cd13301 | 108 | cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin | 3e-04 | |
| cd13269 | 106 | cd13269, PH_alsin, Alsin Pleckstrin homology (PH) | 3e-04 | |
| cd01265 | 101 | cd01265, PH_TBC1D2A, TBC1 domain family member 2A | 3e-04 | |
| cd01218 | 123 | cd01218, PH_Phafin2-like, Phafin2 (also called EAP | 3e-04 | |
| cd13248 | 104 | cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate | 3e-04 | |
| cd13380 | 106 | cd13380, PH_Skap1, Src kinase-associated phosphopr | 3e-04 | |
| cd13292 | 103 | cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol bin | 4e-04 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 5e-04 | |
| cd13271 | 114 | cd13271, PH2_TAPP1_2, Tandem PH-domain-containing | 5e-04 | |
| cd13277 | 111 | cd13277, PH_Bem3, Bud emergence protein 3 (Bem3) P | 6e-04 | |
| cd01235 | 106 | cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als | 7e-04 | |
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 9e-04 | |
| cd13273 | 110 | cd13273, PH_SWAP-70, Switch-associated protein-70 | 0.001 | |
| cd01250 | 114 | cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat | 0.001 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 0.002 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 0.002 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 0.002 | |
| cd13251 | 108 | cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin | 0.002 | |
| cd13263 | 114 | cd13263, PH_RhoGap25-like, Rho GTPase activating p | 0.002 | |
| PHA02946 | 446 | PHA02946, PHA02946, ankyin-like protein; Provision | 0.003 | |
| cd13265 | 108 | cd13265, PH_evt, Evectin Pleckstrin homology (PH) | 0.003 | |
| cd13281 | 139 | cd13281, PH_PLEKHD1, Pleckstrin homology (PH) doma | 0.003 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 0.004 |
| >gnl|CDD|216485 pfam01412, ArfGap, Putative GTPase activating protein for Arf | Back alignment and domain information |
|---|
Score = 159 bits (405), Expect = 1e-46
Identities = 62/142 (43%), Positives = 75/142 (52%), Gaps = 25/142 (17%)
Query: 306 EKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDV 365
++ + LR++ GN CADCGAP P WASLNLG+ +CI CSGVHR+LGVHISKVRSLTLD
Sbjct: 1 KRLLRELRKLPGNKVCADCGAPNPTWASLNLGIFICIRCSGVHRSLGVHISKVRSLTLD- 59
Query: 366 KVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHSD 425
W P + ++ GN AN WE P+ P S
Sbjct: 60 -KWTPEQLEFMKAGGNKRANEFWE------------------ANLPPPK-----PPPSSS 95
Query: 426 SISVKEKFIHAKYAEKLFVRKP 447
+E FI AKY EKLF
Sbjct: 96 DREKRESFIRAKYVEKLFAEAE 117
|
Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs. Length = 117 |
| >gnl|CDD|214518 smart00105, ArfGap, Putative GTP-ase activating proteins for the small GTPase, ARF | Back alignment and domain information |
|---|
| >gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|227651 COG5347, COG5347, GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|178661 PLN03114, PLN03114, ADP-ribosylation factor GTPase-activating protein AGD10; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|197603 smart00248, ANK, ankyrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241266 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and 3-Phosphoinositides Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241401 cd13247, BAR-PH_APPL, Adaptor protein containing PH domain, PTB domain, and Leucine zipper motif Bin1/amphiphysin/Rvs167 (BAR)-Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|153290 cd07606, BAR_SFC_plant, The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC) | Back alignment and domain information |
|---|
| >gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241420 cd13266, PH_Skap_family, Src kinase-associated phosphoprotein family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241423 cd13269, PH_alsin, Alsin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241253 cd01218, PH_Phafin2-like, Phafin2 (also called EAPF, FLJ13187, ZFYVE18 or PLEKHF2) Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241531 cd13380, PH_Skap1, Src kinase-associated phosphoprotein 1 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241446 cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol binding protein homologs 1 and 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat | Back alignment and domain information |
|---|
| >gnl|CDD|241431 cd13277, PH_Bem3, Bud emergence protein 3 (Bem3) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241281 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat and PH domain-containing protein Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241405 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241435 cd13281, PH_PLEKHD1, Pleckstrin homology (PH) domain containing, family D (with coiled-coil domains) member 1 PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 638 | |||
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 100.0 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 100.0 | |
| KOG0703 | 287 | consensus Predicted GTPase-activating protein [Sig | 100.0 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 100.0 | |
| PF01412 | 116 | ArfGap: Putative GTPase activating protein for Arf | 100.0 | |
| smart00105 | 112 | ArfGap Putative GTP-ase activating proteins for th | 100.0 | |
| KOG1117 | 1186 | consensus Rho- and Arf-GTPase activating protein A | 99.97 | |
| COG5347 | 319 | GTPase-activating protein that regulates ARFs (ADP | 99.97 | |
| PLN03119 | 648 | putative ADP-ribosylation factor GTPase-activating | 99.96 | |
| PLN03131 | 705 | hypothetical protein; Provisional | 99.95 | |
| PLN03114 | 395 | ADP-ribosylation factor GTPase-activating protein | 99.93 | |
| KOG0704 | 386 | consensus ADP-ribosylation factor GTPase activator | 99.92 | |
| KOG0706 | 454 | consensus Predicted GTPase-activating protein [Sig | 99.92 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.9 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.85 | |
| KOG1451 | 812 | consensus Oligophrenin-1 and related Rho GTPase-ac | 99.84 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.83 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.83 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.82 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.82 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 99.8 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.8 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.79 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.79 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.79 | |
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 99.79 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.79 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.78 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.78 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 99.78 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.78 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.78 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.77 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.77 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.77 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.77 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.77 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.77 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.76 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.76 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 99.76 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.76 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 99.76 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.76 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.76 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 99.76 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.75 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 99.75 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.75 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.75 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.75 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.74 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.73 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.73 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.72 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 99.71 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 99.7 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 99.7 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.7 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.7 | |
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 99.69 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 99.69 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.69 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.69 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.68 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.68 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.68 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 99.67 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.67 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.67 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.66 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 99.66 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.66 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.65 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.65 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 99.65 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.64 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 99.62 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 99.62 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.62 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.62 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.62 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.6 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.6 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 99.59 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 99.58 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.58 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.57 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 99.57 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.57 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.56 | |
| KOG0930 | 395 | consensus Guanine nucleotide exchange factor Cytoh | 99.53 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.52 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.52 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.52 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.51 | |
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 99.51 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 99.51 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.51 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 99.5 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.49 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.48 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.46 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.42 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.42 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 99.41 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.41 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.38 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 99.38 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.37 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.37 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 99.37 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 99.36 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.34 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.34 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.34 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.33 | |
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 99.32 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.32 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.31 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 99.3 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.28 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.27 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.26 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.25 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.23 | |
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 99.19 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.19 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.15 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.13 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 99.12 | |
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 99.07 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.07 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.06 | |
| KOG0690 | 516 | consensus Serine/threonine protein kinase [Signal | 99.04 | |
| KOG0702 | 524 | consensus Predicted GTPase-activating protein [Sig | 99.02 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.97 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 98.97 | |
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 98.93 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.9 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 98.89 | |
| KOG4424 | 623 | consensus Predicted Rho/Rac guanine nucleotide exc | 98.83 | |
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 98.82 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.78 | |
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 98.72 | |
| KOG1090 | 1732 | consensus Predicted dual-specificity phosphatase [ | 98.71 | |
| cd01259 | 114 | PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr | 98.65 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.58 | |
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 98.53 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.52 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.51 | |
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 98.49 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.48 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.47 | |
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 98.46 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.42 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.38 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.37 | |
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 98.33 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.18 | |
| KOG0932 | 774 | consensus Guanine nucleotide exchange factor EFA6 | 98.07 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 98.07 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 98.07 | |
| KOG3751 | 622 | consensus Growth factor receptor-bound proteins (G | 98.03 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 98.01 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 98.01 | |
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 97.99 | |
| KOG3640 | 1116 | consensus Actin binding protein Anillin [Cell cycl | 97.98 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 97.95 | |
| cd01226 | 100 | PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin | 97.93 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 97.85 | |
| cd01262 | 89 | PH_PDK1 3-Phosphoinositide dependent protein kinas | 97.79 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.72 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 97.72 | |
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 97.67 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 97.65 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 97.63 | |
| cd01240 | 116 | PH_beta-ARK Beta adrenergic receptor kinase 1(beta | 97.63 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 97.55 | |
| KOG3723 | 851 | consensus PH domain protein Melted [Signal transdu | 97.53 | |
| PLN02866 | 1068 | phospholipase D | 97.45 | |
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 97.32 | |
| KOG1739 | 611 | consensus Serine/threonine protein kinase GPBP [Si | 97.31 | |
| KOG0248 | 936 | consensus Cytoplasmic protein Max-1, contains PH, | 97.31 | |
| PF12814 | 123 | Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin | 97.29 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 97.16 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 97.14 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.07 | |
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 96.99 | |
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 96.86 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 96.49 | |
| cd01223 | 116 | PH_Vav Vav pleckstrin homology (PH) domain. Vav pl | 96.47 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.32 | |
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 96.17 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.14 | |
| cd01228 | 96 | PH_BCR-related BCR (breakpoint cluster region)-rel | 96.0 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 95.93 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 95.72 | |
| PF15404 | 185 | PH_4: Pleckstrin homology domain | 95.63 | |
| KOG3531 | 1036 | consensus Rho guanine nucleotide exchange factor C | 95.58 | |
| cd01227 | 133 | PH_Dbs Dbs (DBL's big sister) pleckstrin homology | 95.44 | |
| KOG1117 | 1186 | consensus Rho- and Arf-GTPase activating protein A | 95.34 | |
| PF15406 | 112 | PH_6: Pleckstrin homology domain | 95.17 | |
| KOG3543 | 1218 | consensus Ca2+-dependent activator protein [Signal | 94.94 | |
| KOG1737 | 799 | consensus Oxysterol-binding protein [Lipid transpo | 94.12 | |
| PF15408 | 104 | PH_7: Pleckstrin homology domain | 94.11 | |
| cd01248 | 115 | PH_PLC Phospholipase C (PLC) pleckstrin homology ( | 92.61 | |
| cd01231 | 107 | PH_Lnk LNK-family Pleckstrin homology (PH) domain. | 91.18 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 90.82 | |
| PF08458 | 110 | PH_2: Plant pleckstrin homology-like region; Inter | 89.38 | |
| KOG0248 | 936 | consensus Cytoplasmic protein Max-1, contains PH, | 89.27 | |
| KOG3531 | 1036 | consensus Rho guanine nucleotide exchange factor C | 88.27 | |
| cd05135 | 333 | RasGAP_RASAL Ras GTPase activating-like protein (R | 88.1 | |
| cd05394 | 313 | RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the | 86.65 | |
| cd05128 | 315 | RasGAP_GAP1_like The GAP1 family of Ras GTPase-act | 84.73 | |
| KOG2070 | 661 | consensus Guanine nucleotide exchange factor [Nucl | 83.9 | |
| cd05134 | 310 | RasGAP_RASA3 RASA3 (or GAP1_IP4BP) is a member of | 83.02 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 82.35 | |
| KOG1729 | 288 | consensus FYVE finger containing protein [General | 80.65 |
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.4e-67 Score=589.55 Aligned_cols=510 Identities=42% Similarity=0.644 Sum_probs=365.0
Q ss_pred ChhhhhHHHhHHHHHhhhhhHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhhhhhhccCCCCCCCCCCCccccccc
Q 006616 1 MDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNERMQEYKRQIDRESRWASNGSNGSPNGDGIQAIGRS 80 (638)
Q Consensus 1 ~~a~~~ff~~G~~l~~~l~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (638)
||||++||++||+++.+|+||++++.+++++++++++.+++.|++++++++.+.+...+.... ...|.+.
T Consensus 199 ~~aq~~fF~~g~~l~~~m~p~~~~i~~~v~ql~~~~~~e~~am~~~~q~l~~~~~~~~~~~~~--~~~~~~~-------- 268 (785)
T KOG0521|consen 199 MHAQINFFKQGEDLLSQMDPYIKKVATYVQQLREESDAEQRAMEQRYQELRSASNLESRPKSD--SASPSGG-------- 268 (785)
T ss_pred HHhccchhcccHhHHhhhhHHHHHHHHHHHHHHHhhHHHHHHHHhHHHHHHHHhhhhhhcccc--ccccccc--------
Confidence 799999999999999999999999999999999999999999999999999987766555211 1122221
Q ss_pred hhHHHHHHHhhhcCCCcceeEEEEEEeecCCCCCCceeeEEEEecCceEEEEecCCCCCCCCCCccccccCcCcccCCcc
Q 006616 81 SHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRFFVLDSRGMLYYYRKQCSKSSGSGSQLSSQRNSSELGSGLL 160 (638)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~~~k~GyL~Kr~~~~~~~WkrRwfvL~~~~~l~y~~~~~~~~~g~~~~~~~~~~~~~~~~g~~ 160 (638)
+......+.|||+|+.++..++|+||||.++ ++.+.|.......
T Consensus 269 -------------~~~~~~~~~~~l~~k~~~~~~tw~r~~f~~q-~~~l~~~~r~~~~---------------------- 312 (785)
T KOG0521|consen 269 -------------NLKLGYRMEGYLRKKASNASKTWKRRWFSIQ-DGQLGYQHRGADA---------------------- 312 (785)
T ss_pred -------------cccchhhhhhhhhhhcccchhhHHhhhhhhh-ccccccccccccc----------------------
Confidence 1223334689999999988999999999998 4444443332110
Q ss_pred ccccccccCCCCCCccccccceeecccceeecCCCCCCCcceEEEecCCeeEEEEeCCHHHHHHHHHHHHHHHHHHhccC
Q 006616 161 SRWLSSHYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLSSQ 240 (638)
Q Consensus 161 ~~~~~~~~~~~~~~~~~~~~~~i~l~~~~v~~~~~~~~rr~cF~I~t~~rt~~lqA~se~e~~~Wi~ai~~~i~~~~~~~ 240 (638)
.. ....+|.+|+|++.++..++||||+|++|+|+|+|||+|+.|.++||.+|+++|.++++..
T Consensus 313 ---------------~~--~~~~dL~~csvk~~~~~~drr~CF~iiS~tks~~lQAes~~d~~~Wi~~i~nsi~s~l~~~ 375 (785)
T KOG0521|consen 313 ---------------EN--VLIEDLRTCSVKPDAEQRDRRFCFEIISPTKSYLLQAESEKDCQDWISALQNSILSALNSA 375 (785)
T ss_pred ---------------cc--cccccchhccccCCcccccceeeEEEecCCcceEEecCchhHHHHHHHHHHHHHHHHHhcc
Confidence 00 2236899999999888789999999999999999999999999999999999999999987
Q ss_pred CCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCcchhhhhhccccccccccccccccccccccccCCchHHHHHHcccCCc
Q 006616 241 APERCLPTSP-MGSGHHRSASDSSSFESSDFDHAAVEEYTSERNLTSAYHERQSRGSQQQRSCVKSEKPIDVLRRVCGND 319 (638)
Q Consensus 241 ~~~~~~~~~~-~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~ 319 (638)
.++...+... .+..+..+.+ .....+.. ...++ ..+...++..+++.|||.
T Consensus 376 ~~~~~~~~~~~~~~~~~~~~s---------~~~~~s~~---------~s~~~----------~~~~~~~~~~vq~~pgN~ 427 (785)
T KOG0521|consen 376 FLGQDSTGGRNTQSGHSSSAS---------YSTITSAN---------TSRER----------LNKGISVIEEVQSVPGNA 427 (785)
T ss_pred CcccccccCCCcccccccccc---------cccccccc---------ccccc----------cccCcchhhhhhcCCchh
Confidence 7765433211 1111111111 00000000 00000 011223578899999999
Q ss_pred ccccCCCCCCCceecccceeEeccchhhhccCCCccceeEEeecCCCccCHHHHHHHHHhchHHHHHHHHhhhccccccc
Q 006616 320 RCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFH 399 (638)
Q Consensus 320 ~c~dC~~~~p~w~~~~~g~~~C~~Csg~hr~lg~~~skvrsl~ld~~~~~~~~~~~~~~~gN~~~n~i~e~~~~~~~~~~ 399 (638)
.|||||++.|+|+|+|+||.+||+|||+||+||||+||||||||| .|+++.+.+++++||..+|.|||+.++.-.
T Consensus 428 ~c~Dcg~p~ptw~S~NLgv~~CIecSGvhRslGvh~SkvrsLtLD--~~~~~l~~l~~~lgn~~~N~i~e~~l~~~~--- 502 (785)
T KOG0521|consen 428 QCCDCGAPEPTWASINLGVLLCIECSGVHRSLGVHISKVRSLTLD--VWEPELLLLFKNLGNKYVNEIYEALLPSYD--- 502 (785)
T ss_pred hhhhcCCCCCchHhhhhchhhHhhccccccccCchhhhhhhhhhh--ccCcHHHHHHHHhCcchhhhhhhccccccc---
Confidence 999999999999999999999999999999999999999999999 599999999999999999999999998721
Q ss_pred cCCCCCCCCCCCCccccccCCCCCCCCHHHHHHHHHHHHhhhhhccCCCCcccc--c--------------ccccceecc
Q 006616 400 VDLTPPSLHKSDKPQLLLMGKPSHSDSISVKEKFIHAKYAEKLFVRKPKDNQYL--H--------------SVAHQIWEG 463 (638)
Q Consensus 400 ~~~~~~~~~~~~~~~~~~~~kp~~~~~~~~re~fI~~KY~~k~fv~~~~~~~~~--~--------------~~~~~L~~A 463 (638)
..+|.+..++..|++||++||+++.|....+..... . ....+++.+
T Consensus 503 ------------------~~~~~~~~~~~~r~~~i~~kyve~~F~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 564 (785)
T KOG0521|consen 503 ------------------SSKPTASSSRQAREAWIKAKYVERRFSVKEPQIKRLYLERLLEAIKSILESASASGVQISEG 564 (785)
T ss_pred ------------------ccCCCCccchhhhhHhhhcccceeeEeecccchhhhhhhhhhhhhhhhhhhhhhhhhhHhhc
Confidence 358888888999999999999999999876654311 1 112233444
Q ss_pred cccccchh-hhhhhcccccCccccccchhc----------cchhhH---HHHHhhhhccccCCCcccccccccCCccccc
Q 006616 464 VRTNDKKA-VYRHIVNFEVDVNAVYEQVSC----------ISSLTL---AKAMLLNEQTSLERSSSSLTGNSSDRSSSGS 529 (638)
Q Consensus 464 v~~~d~~~-v~~lLl~~gaDvN~~~~~~~~----------~~~~~l---~~~ll~~~~~~~~~~~~~l~~~~~~~~~~~~ 529 (638)
+..+.... |..++.....|.+........ ..+.+. .+..+... .+..............
T Consensus 565 ~~~~~~~~~v~~l~~~~~~d~~~~~~~~~~~~~~~~~~~~~~h~e~~~~~~~~l~~~-------~~~~~~~~~~~~~~~~ 637 (785)
T KOG0521|consen 565 VSGSSREETVYHLIVSTLNDASIRSADFSVPDKSSADGSTTLHYEILECLKLLLFIK-------ELLVKASSDGECLPRI 637 (785)
T ss_pred cccCCccccceeeeccCcccccccccccccccccccccccccchhhhhccccccchH-------HHHHHhccCccchhhh
Confidence 43333333 555554443344443332111 111111 00000000 0000000000000001
Q ss_pred ccccCCCCCCCc--CCCCCCcHHHHHHHhCCHHHHHHHHHcCCCCcccCCCCCcHHHHHHHhCCHHHHHHHHhCCCCCCC
Q 006616 530 LNLAGTSEGQTM--DDLEGCTLLHLACDSADIGMLELLLQYGANINATDSRGLTPLHRCILRGKAMFAKLLLTRGADPRA 607 (638)
Q Consensus 530 ~lL~~~~~~~~~--~d~~G~TpLh~Aa~~g~~~~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~lLl~~gad~~~ 607 (638)
-.-...++++|. .-..|.|+||.|+..|...++++||++|+++|..|..|+||||.+...|+...+.+|+++||++++
T Consensus 638 ~~~~~~~~~~n~~~~~~~~~s~lh~a~~~~~~~~~e~ll~~ga~vn~~d~~g~~plh~~~~~g~~~~~~~ll~~~a~~~a 717 (785)
T KOG0521|consen 638 ATALAHGCCENWPVVLCIGCSLLHVAVGTGDSGAVELLLQNGADVNALDSKGRTPLHHATASGHTSIACLLLKRGADPNA 717 (785)
T ss_pred hhhhcchhhhccchhhhcccchhhhhhccchHHHHHHHHhcCCcchhhhccCCCcchhhhhhcccchhhhhccccccccc
Confidence 111122333332 234589999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCCCCCHHHHHHHcCCCcHHHHH
Q 006616 608 VNREGKTSLELAVESNFADSEVLA 631 (638)
Q Consensus 608 ~d~~g~TpL~~A~~~g~~d~eiv~ 631 (638)
.+.+|.+||++|....+.|...+.
T Consensus 718 ~~~~~~~~l~~a~~~~~~d~~~l~ 741 (785)
T KOG0521|consen 718 FDPDGKLPLDIAMEAANADIVLLL 741 (785)
T ss_pred cCccCcchhhHHhhhccccHHHHH
Confidence 999999999999888665544333
|
|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0703 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] | Back alignment and domain information |
|---|
| >smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF | Back alignment and domain information |
|---|
| >KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional | Back alignment and domain information |
|---|
| >PLN03131 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional | Back alignment and domain information |
|---|
| >KOG0704 consensus ADP-ribosylation factor GTPase activator [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0706 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1451 consensus Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0702 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0932 consensus Guanine nucleotide exchange factor EFA6 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3751 consensus Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3723 consensus PH domain protein Melted [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02866 phospholipase D | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01223 PH_Vav Vav pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF15404 PH_4: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15406 PH_6: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG3543 consensus Ca2+-dependent activator protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1737 consensus Oxysterol-binding protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF15408 PH_7: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05135 RasGAP_RASAL Ras GTPase activating-like protein (RASAL) or RASAL1 is a member of the GAP1 family, and a Ca2+ sensor responding in-phase to repetitive Ca2+ signals by associating with the plasma membrane and deactivating Ras | Back alignment and domain information |
|---|
| >cd05394 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the GAP1 family of Ras GTPase-activating proteins that includes GAP1_IP4BP (or RASA3), CAPRI, and RASAL | Back alignment and domain information |
|---|
| >cd05128 RasGAP_GAP1_like The GAP1 family of Ras GTPase-activating proteins includes GAP1(m) (or RASA2), GAP1_IP4BP (or RASA3), Ca2+ -promoted Ras inactivator (CAPRI, or RASAL4), and Ras GTPase activating-like proteins (RASAL) or RASAL1 | Back alignment and domain information |
|---|
| >KOG2070 consensus Guanine nucleotide exchange factor [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd05134 RasGAP_RASA3 RASA3 (or GAP1_IP4BP) is a member of the GAP1 family and has been shown to specifically bind 1,3,4,5-tetrakisphosphate (IP4) | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >KOG1729 consensus FYVE finger containing protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 638 | ||||
| 1dcq_A | 278 | Crystal Structure Of The Arf-Gap Domain And Ankyrin | 1e-26 | ||
| 3t9k_A | 390 | Crystal Structure Of Acap1 C-portion Mutant S554d F | 3e-25 | ||
| 3t9k_A | 390 | Crystal Structure Of Acap1 C-portion Mutant S554d F | 6e-08 | ||
| 4f1p_A | 368 | Crystal Structure Of Mutant S554d For Arfgap And An | 3e-25 | ||
| 4f1p_A | 368 | Crystal Structure Of Mutant S554d For Arfgap And An | 6e-08 | ||
| 3jue_A | 368 | Crystal Structure Of Arfgap And Ank Repeat Domain O | 3e-25 | ||
| 3jue_A | 368 | Crystal Structure Of Arfgap And Ank Repeat Domain O | 6e-08 | ||
| 3feh_A | 386 | Crystal Structure Of Full Length Centaurin Alpha-1 | 2e-19 | ||
| 3fm8_C | 392 | Crystal Structure Of Full Length Centaurin Alpha-1 | 3e-19 | ||
| 2b0o_E | 301 | Crystal Structure Of Uplc1 Gap Domain Length = 301 | 4e-19 | ||
| 3lvq_E | 497 | The Crystal Structure Of Asap3 In Complex With Arf6 | 4e-19 | ||
| 2iqj_A | 134 | Crystal Structure Of The Gap Domain Of Smap1l (Loc6 | 1e-16 | ||
| 2crr_A | 141 | Solution Structure Of Arfgap Domain From Human Smap | 1e-15 | ||
| 2p57_A | 144 | Gap Domain Of Znf289, An Id1-Regulated Zinc Finger | 2e-14 | ||
| 2crw_A | 149 | Solution Structure Of The Arfgap Domain Of Adp-Ribo | 6e-14 | ||
| 3sub_A | 163 | Crystal Structure Of The Catalytic Domain Of Plasmo | 7e-14 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 3e-13 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 1e-12 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 2e-12 | ||
| 3o47_A | 329 | Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le | 9e-12 | ||
| 3dwd_A | 147 | Crystal Structure Of The Arfgap Domain Of Human Arf | 2e-11 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 3e-11 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 4e-11 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 5e-11 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 6e-11 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 6e-11 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 8e-11 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 1e-10 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 1e-10 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 2e-10 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 2e-10 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 2e-10 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 3e-10 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 3e-10 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 3e-10 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 4e-10 | ||
| 2xzd_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4 | 4e-10 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 5e-10 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 6e-10 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 9e-10 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 1e-09 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 1e-09 | ||
| 3twu_A | 167 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 1e-09 | ||
| 3twq_A | 175 | Crystal Structure Of Arc4 From Human Tankyrase 2 (A | 1e-09 | ||
| 3twr_A | 165 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 1e-09 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 1e-09 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 2e-09 | ||
| 3hg0_D | 136 | Crystal Structure Of A Darpin In Complex With Orf49 | 2e-09 | ||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-09 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 2e-09 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-09 | ||
| 1s70_B | 299 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 3e-09 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 3e-09 | ||
| 2jab_A | 136 | A Designed Ankyrin Repeat Protein Evolved To Picomo | 4e-09 | ||
| 2owa_A | 138 | Crystal Structure Of Putative Gtpase Activating Pro | 2e-08 | ||
| 1n11_A | 437 | D34 Region Of Human Ankyrin-R And Linker Length = 4 | 2e-08 | ||
| 3utm_A | 351 | Crystal Structure Of A Mouse Tankyrase-Axin Complex | 3e-08 | ||
| 4b93_B | 269 | Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri | 7e-08 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 7e-08 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 8e-08 | ||
| 1qym_A | 227 | X-Ray Structure Of Human Gankyrin Length = 227 | 9e-08 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 1e-07 | ||
| 3aji_A | 231 | Structure Of Gankyrin-S6atpase Photo-Cross-Linked S | 2e-07 | ||
| 1myo_A | 118 | Solution Structure Of Myotrophin, Nmr, 44 Structure | 2e-07 | ||
| 3aaa_C | 123 | Crystal Structure Of Actin Capping Protein In Compl | 4e-07 | ||
| 2rfm_A | 192 | Structure Of A Thermophilic Ankyrin Repeat Protein | 5e-07 | ||
| 3c5r_A | 137 | Crystal Structure Of The Bard1 Ankyrin Repeat Domai | 5e-06 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 7e-06 | ||
| 2olm_A | 140 | Arfgap Domain Of Hiv-1 Rev Binding Protein Length = | 1e-05 | ||
| 2xen_A | 91 | Structural Determinants For Improved Thermal Stabil | 3e-05 | ||
| 2zgd_A | 110 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 5e-05 | ||
| 2zgg_A | 92 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 6e-05 | ||
| 4a63_B | 239 | Crystal Structure Of The P73-Aspp2 Complex At 2.6a | 8e-05 | ||
| 1ycs_B | 239 | P53-53bp2 Complex Length = 239 | 9e-05 | ||
| 1oy3_D | 282 | Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer | 1e-04 | ||
| 1k3z_D | 282 | X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi | 1e-04 | ||
| 1awc_B | 153 | Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 | 2e-04 | ||
| 3v2o_A | 183 | Crystal Structure Of The Peptide Bound Complex Of T | 2e-04 | ||
| 3v2x_A | 167 | Crystal Structure Of The Peptide Bound Complex Of T | 2e-04 | ||
| 3so8_A | 162 | Crystal Structure Of Ankra Length = 162 | 2e-04 | ||
| 2d9l_A | 134 | Solution Structure Of The Arfgap Domain Of Human Ri | 2e-04 | ||
| 2kbx_A | 171 | Solution Structure Of Ilk-Pinch Complex Length = 17 | 4e-04 | ||
| 2vge_A | 229 | Crystal Structure Of The C-Terminal Region Of Human | 4e-04 | ||
| 3f6q_A | 179 | Crystal Structure Of Integrin-Linked Kinase Ankyrin | 5e-04 | ||
| 3d9h_A | 285 | Crystal Structure Of The Splice Variant Of Human As | 7e-04 |
| >pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 | Back alignment and structure |
|
| >pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 | Back alignment and structure |
| >pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 | Back alignment and structure |
| >pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 | Back alignment and structure |
| >pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 | Back alignment and structure |
| >pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 | Back alignment and structure |
| >pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 | Back alignment and structure |
| >pdb|3FEH|A Chain A, Crystal Structure Of Full Length Centaurin Alpha-1 Length = 386 | Back alignment and structure |
| >pdb|3FM8|C Chain C, Crystal Structure Of Full Length Centaurin Alpha-1 Bound With The Fha Domain Of Kif13b (Capri Target) Length = 392 | Back alignment and structure |
| >pdb|2B0O|E Chain E, Crystal Structure Of Uplc1 Gap Domain Length = 301 | Back alignment and structure |
| >pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Length = 497 | Back alignment and structure |
| >pdb|2IQJ|A Chain A, Crystal Structure Of The Gap Domain Of Smap1l (Loc64744) Stromal Membrane-Associated Protein 1-Like Length = 134 | Back alignment and structure |
| >pdb|2CRR|A Chain A, Solution Structure Of Arfgap Domain From Human Smap1 Length = 141 | Back alignment and structure |
| >pdb|2P57|A Chain A, Gap Domain Of Znf289, An Id1-Regulated Zinc Finger Protein Length = 144 | Back alignment and structure |
| >pdb|2CRW|A Chain A, Solution Structure Of The Arfgap Domain Of Adp-Ribosylation Factor Gtpaseactivating Protein 3 (Arfgap 3) Length = 149 | Back alignment and structure |
| >pdb|3SUB|A Chain A, Crystal Structure Of The Catalytic Domain Of Plasmodium Falciparum Arf Gtpase Activating Protein Length = 163 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 | Back alignment and structure |
| >pdb|3DWD|A Chain A, Crystal Structure Of The Arfgap Domain Of Human Arfgap1 Length = 147 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 | Back alignment and structure |
| >pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 | Back alignment and structure |
| >pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 | Back alignment and structure |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 | Back alignment and structure |
| >pdb|2OWA|A Chain A, Crystal Structure Of Putative Gtpase Activating Protein For Adp Ribosylation Factor From Cryptosporidium Parvum (Cgd5_1040) Length = 138 | Back alignment and structure |
| >pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 | Back alignment and structure |
| >pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 | Back alignment and structure |
| >pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
| >pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 | Back alignment and structure |
| >pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 | Back alignment and structure |
| >pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 | Back alignment and structure |
| >pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 | Back alignment and structure |
| >pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|2OLM|A Chain A, Arfgap Domain Of Hiv-1 Rev Binding Protein Length = 140 | Back alignment and structure |
| >pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 | Back alignment and structure |
| >pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 | Back alignment and structure |
| >pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 | Back alignment and structure |
| >pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 | Back alignment and structure |
| >pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 | Back alignment and structure |
| >pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 | Back alignment and structure |
| >pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 | Back alignment and structure |
| >pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 | Back alignment and structure |
| >pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 | Back alignment and structure |
| >pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 | Back alignment and structure |
| >pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 | Back alignment and structure |
| >pdb|2D9L|A Chain A, Solution Structure Of The Arfgap Domain Of Human Rip Length = 134 | Back alignment and structure |
| >pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 | Back alignment and structure |
| >pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 | Back alignment and structure |
| >pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 | Back alignment and structure |
| >pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 638 | |||
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 2e-82 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 5e-79 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 2e-77 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 2e-76 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 4e-50 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 5e-30 | |
| 2iqj_A | 134 | Stromal membrane-associated protein 1-like; zinc, | 7e-48 | |
| 2crr_A | 141 | Stromal membrane-associated protein SMAP1B; arfgap | 4e-47 | |
| 2olm_A | 140 | Nucleoporin-like protein RIP; arfgap, GTPase-activ | 2e-44 | |
| 2owa_A | 138 | Arfgap-like finger domain containing protein; zinc | 2e-39 | |
| 3dwd_A | 147 | ADP-ribosylation factor GTPase-activating protein; | 3e-38 | |
| 3sub_A | 163 | ADP-ribosylation factor GTPase-activating protein; | 6e-38 | |
| 2p57_A | 144 | GTPase-activating protein ZNF289; zinc finger, GAP | 1e-36 | |
| 2crw_A | 149 | ARF GAP 3, ADP-ribosylation factor GTPase-activati | 2e-35 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 3e-23 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 1e-21 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 2e-19 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 3e-19 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 7e-19 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 1e-18 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 3e-16 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 6e-14 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 1e-18 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 4e-16 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 5e-15 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 6e-15 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 7e-15 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 4e-04 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-18 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-16 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 3e-16 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-15 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 5e-12 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-11 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-10 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-08 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 4e-18 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 3e-17 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 1e-14 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 7e-13 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 6e-18 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 5e-17 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 2e-10 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 8e-08 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 9e-18 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 1e-17 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 1e-17 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 3e-16 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 4e-15 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 1e-13 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 5e-12 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-09 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 1e-06 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-17 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 6e-17 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 3e-16 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-16 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-16 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-16 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-16 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 6e-16 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 3e-15 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 3e-12 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-09 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 2e-17 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 7e-17 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 5e-13 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 3e-17 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 7e-16 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 4e-14 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 9e-13 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-10 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-04 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 3e-17 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 1e-14 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 3e-17 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 4e-17 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 3e-11 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 3e-10 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 6e-05 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 3e-17 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 5e-17 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 5e-15 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-11 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-10 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 3e-10 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 6e-09 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 4e-17 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 5e-17 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 8e-15 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 3e-11 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 5e-11 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 5e-17 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 3e-14 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 5e-17 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 5e-17 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 6e-17 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 6e-15 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 4e-14 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 9e-14 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-11 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-04 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 6e-17 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 8e-17 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 7e-14 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 1e-11 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 3e-11 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 6e-05 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 2e-16 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 2e-16 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 3e-14 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 8e-14 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 3e-10 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 1e-09 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 2e-16 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 3e-15 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 5e-15 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 2e-13 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-09 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-16 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-14 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 5e-13 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 1e-11 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 1e-07 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 2e-16 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 3e-16 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 1e-14 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 4e-07 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 3e-16 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 3e-13 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 4e-13 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 2e-10 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 2e-06 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 3e-16 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 3e-16 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 4e-16 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 4e-16 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 4e-16 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 9e-14 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 3e-12 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-10 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-10 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 5e-10 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 1e-09 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-04 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 5e-16 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-15 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 4e-15 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 6e-13 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 6e-11 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 7e-07 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 5e-16 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 4e-15 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 6e-15 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 8e-14 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 6e-10 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 4e-07 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 5e-16 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 1e-14 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 1e-13 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 3e-07 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 5e-16 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 6e-16 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 6e-16 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 2e-15 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 3e-15 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 3e-09 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 2e-08 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 6e-16 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 1e-15 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 1e-15 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 3e-11 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 6e-16 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 2e-15 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 8e-14 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 2e-13 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 3e-12 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 2e-11 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-10 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 7e-09 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 9e-16 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 5e-12 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 6e-12 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-15 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 8e-15 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 4e-14 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 9e-14 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 9e-14 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 7e-11 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 1e-15 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 2e-15 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 2e-15 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 2e-15 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 3e-14 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 3e-09 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 2e-15 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 2e-15 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 5e-14 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 3e-08 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-15 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 3e-15 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 4e-13 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-08 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-15 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 3e-15 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-11 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-11 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 6e-11 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-06 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 2e-15 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 3e-11 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 6e-09 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 3e-06 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 3e-15 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 4e-15 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-14 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-13 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 4e-05 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 3e-15 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 4e-14 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 2e-11 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 1e-09 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 3e-15 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 4e-15 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 5e-15 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 8e-15 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 4e-13 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 6e-13 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 4e-10 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 8e-08 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 1e-14 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 1e-14 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 4e-14 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 1e-13 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-06 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 1e-14 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 1e-14 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 1e-14 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 2e-14 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 2e-09 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 3e-06 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 2e-14 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 3e-14 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 7e-14 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 1e-13 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-11 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 5e-11 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 3e-14 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 5e-14 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 7e-14 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-13 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 4e-12 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 8e-11 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-10 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 3e-10 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 6e-10 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 4e-06 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 8e-14 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 3e-13 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 4e-13 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 1e-11 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 9e-14 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 2e-13 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 2e-13 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 2e-13 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 3e-13 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 1e-12 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 2e-12 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 6e-08 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 6e-08 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 6e-07 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 7e-12 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 9e-12 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 1e-10 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 2e-07 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 2e-07 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 5e-07 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 2e-11 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 4e-11 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-09 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 4e-08 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 3e-04 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 3e-11 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 4e-11 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 5e-11 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 6e-11 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 2e-10 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 4e-10 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 4e-10 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 4e-09 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 6e-09 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 7e-09 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 1e-08 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 2e-08 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 3e-08 | |
| 2q12_A | 265 | DIP13 alpha, DCC-interacting protein 13 alpha; APP | 6e-08 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 7e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 5e-07 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 8e-07 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 1e-06 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 4e-06 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 7e-06 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 2e-05 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 1e-04 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 5e-04 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 2e-05 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 5e-05 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 5e-05 | |
| 2z0v_A | 240 | SH3-containing GRB2-like protein 3; helix bundle, | 1e-04 | |
| 1zww_A | 256 | SH3-containing GRB2-like protein 2; coiled coil, t | 2e-04 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 5e-04 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 9e-04 |
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
Score = 263 bits (673), Expect = 2e-82
Identities = 107/387 (27%), Positives = 154/387 (39%), Gaps = 63/387 (16%)
Query: 250 PMGSGHHRSASDSSSFESSDFDHAAVEEYTSERNLTSAYHERQSRGSQQQRSCVKSEKPI 309
P+GSG A S++ S G + R +
Sbjct: 2 PLGSGSGHLAIGSAATLGS-------------------------GGMARGREPGGVGHVV 36
Query: 310 DVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWE 369
++ V GN +C DC P P+WAS+NLGV +CI+CSG+HR+LGVH SKVRSLTLD WE
Sbjct: 37 AQVQSVDGNAQCCDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLD--SWE 94
Query: 370 PSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHSDSISV 429
P ++ L LGN N ++E +++ + + KP S S
Sbjct: 95 PELVKLMCELGNVIINQIYEARVEAMA---------------------VKKPGPSCSRQE 133
Query: 430 KEKFIHAKYAEKLFVRKPKDNQYLHSVAHQIWEGVRTNDKKAVYRHIVNFEVDVNAVYEQ 489
KE +IHAKY EK F+ K + + + K ++ + E
Sbjct: 134 KEAWIHAKYVEKKFLTKLPEIRGRRGGRGRPRGQPPVPPKPSIRPRPGSLRSKPEPPSED 193
Query: 490 VSCISSLTLAKAMLLNEQTSLERSSSSLTGNSSDRSSSGSLNLAGTSEGQTMDDLEGCTL 549
+ + +G+ + G + T
Sbjct: 194 LGSLHPG---------------ALLFRASGHPPSLPTMADALAHGADVNWVNGGQDNATP 238
Query: 550 LHLACDSADIGMLELLLQYGANINATDSRGLTPLHRCILRGKAMFAKLLLTRGADPRAVN 609
L A + + E LLQ GAN+N DS G PLH + G A L L RGAD A +
Sbjct: 239 LIQATAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFLKRGADLGARD 298
Query: 610 REGKTSLELAVESNFADSEVLAILSDS 636
EG+ L +A+E+ AD L L+
Sbjct: 299 SEGRDPLTIAMETANADIVTLLRLAKM 325
|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 | Back alignment and structure |
|---|
| >2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Length = 140 | Back alignment and structure |
|---|
| >2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Length = 138 | Back alignment and structure |
|---|
| >3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Length = 163 | Back alignment and structure |
|---|
| >2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 | Back alignment and structure |
|---|
| >2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A Length = 265 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Length = 113 | Back alignment and structure |
|---|
| >2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A Length = 256 | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 638 | |||
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 100.0 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 100.0 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 100.0 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 100.0 | |
| 2iqj_A | 134 | Stromal membrane-associated protein 1-like; zinc, | 100.0 | |
| 2crr_A | 141 | Stromal membrane-associated protein SMAP1B; arfgap | 100.0 | |
| 2olm_A | 140 | Nucleoporin-like protein RIP; arfgap, GTPase-activ | 100.0 | |
| 2owa_A | 138 | Arfgap-like finger domain containing protein; zinc | 99.98 | |
| 2crw_A | 149 | ARF GAP 3, ADP-ribosylation factor GTPase-activati | 99.97 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.97 | |
| 3dwd_A | 147 | ADP-ribosylation factor GTPase-activating protein; | 99.97 | |
| 2p57_A | 144 | GTPase-activating protein ZNF289; zinc finger, GAP | 99.96 | |
| 3sub_A | 163 | ADP-ribosylation factor GTPase-activating protein; | 99.96 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.96 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 99.94 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 99.94 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 99.91 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.9 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.89 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.89 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.88 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.88 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.88 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.88 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.88 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.87 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.87 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.87 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.87 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.87 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.87 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.87 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.87 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.87 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.86 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.86 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.86 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 99.85 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.85 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.85 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.85 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.85 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.85 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.85 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.85 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.85 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.84 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.84 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.84 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.84 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.84 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.84 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.84 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.84 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.84 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.83 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.83 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.83 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.83 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.83 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.83 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.82 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.82 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.82 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.82 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.82 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.82 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.82 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.81 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.81 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.81 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.81 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.81 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.81 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.8 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.8 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.8 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.8 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.8 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.8 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.8 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.8 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.79 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.79 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.79 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.79 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.79 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.79 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.79 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.79 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.79 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.79 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.79 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.78 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.78 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.78 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.78 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.78 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.77 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 99.77 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.77 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.77 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.77 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.77 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.77 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.76 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.76 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.76 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 99.76 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.76 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.76 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 99.76 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.76 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 99.76 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.76 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.75 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 99.75 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.75 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.75 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.75 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.75 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.75 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 99.75 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.75 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.74 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.74 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.74 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.74 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.74 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.74 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.74 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.74 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.74 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.74 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.74 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.74 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 99.74 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.74 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.74 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.73 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.73 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.73 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.73 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.72 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 99.72 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.72 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 99.72 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 99.71 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.71 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.71 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 99.71 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.71 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.71 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 99.7 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 99.7 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.7 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.69 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.69 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.69 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 99.68 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.67 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.66 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 99.66 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.66 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 99.65 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 99.63 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.61 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 99.61 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 99.6 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.6 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 99.59 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.59 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 99.58 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.56 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.55 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.53 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.52 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 99.51 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.49 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.46 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 99.43 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.43 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 99.38 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 99.37 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.36 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 99.33 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.23 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 99.21 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 99.21 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 99.09 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 99.02 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 99.02 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 98.96 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 98.88 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 98.83 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 98.59 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 98.4 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 98.26 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 98.06 | |
| 1v5m_A | 136 | SH2 and PH domain-containing adapter protein APS; | 98.02 | |
| 3qwm_A | 140 | Iqsec1, IQ motif and SEC7 domain-containing protei | 98.01 | |
| 2q12_A | 265 | DIP13 alpha, DCC-interacting protein 13 alpha; APP | 98.0 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 97.95 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 97.9 | |
| 1xcg_A | 368 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 97.88 | |
| 3t06_A | 418 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 97.84 | |
| 2lg1_A | 185 | A-kinase anchor protein 13; metal binding protein; | 97.76 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 97.7 | |
| 3p6a_A | 377 | RHO guanine nucleotide exchange factor 1; regulati | 97.69 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 97.64 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 97.6 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 97.45 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 97.41 | |
| 3ml4_A | 224 | Protein DOK-7; tyrosine phosphorylation, adapter p | 97.38 | |
| 1mai_A | 131 | Phospholipase C delta-1; pleckstrin, inositol tris | 97.27 | |
| 1nty_A | 311 | Triple functional domain protein; DBL, pleckstrin, | 97.24 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 97.15 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 97.13 | |
| 2z0q_A | 346 | XPLN, RHO guanine nucleotide exchange factor 3; DH | 97.11 | |
| 1foe_A | 377 | T-lymphoma invasion and metastasis inducing protei | 96.92 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 96.71 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 95.91 | |
| 1fho_A | 119 | UNC-89; pleckstrin homology domain, electrostatics | 94.89 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 93.97 | |
| 2adz_A | 178 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 93.89 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 91.72 |
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-55 Score=469.61 Aligned_cols=286 Identities=34% Similarity=0.506 Sum_probs=221.1
Q ss_pred ccCCchHHHHHHcccCCcccccCCCCCCCceecccceeEeccchhhhccCCCccceeEEeecCCCccCHHHHHHHHHhch
Q 006616 302 CVKSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGN 381 (638)
Q Consensus 302 ~~~~~~~~~~~~~~~~n~~c~dC~~~~p~w~~~~~g~~~C~~Csg~hr~lg~~~skvrsl~ld~~~~~~~~~~~~~~~gN 381 (638)
..+.+++++.|++.|+|+.|||||+++|+|+|+|||||+|++||||||+||+||||||||+|| .|+++++++|+.+||
T Consensus 29 ~~~~~~~~~~~~~~~~n~~c~dc~~~~p~w~s~~~g~~~c~~c~~~hr~lg~~~s~v~s~~~d--~w~~~~~~~~~~~gn 106 (368)
T 3jue_A 29 PGGVGHVVAQVQSVDGNAQCCDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLD--SWEPELVKLMCELGN 106 (368)
T ss_dssp ---CCCHHHHHHTSTTTTBCTTTCCBSCCEEETTTTEEECHHHHHHHHHHCTTTCCEEETTTS--CCCHHHHHHHHHSCH
T ss_pred hhHHHHHHHHHHcCCCcCcCCCCCCCCCCeEEecCCeEEcHhHHHHHhccCCCcCeeEEeecc--cccHHHHHHHHHHcc
Confidence 345788999999999999999999999999999999999999999999999999999999999 799999999999999
Q ss_pred HHHHHHHHhhhccccccccCCCCCCCCCCCCccccccCCCCCCCCHHHHHHHHHHHHhhhhhccCCCCccccc-----cc
Q 006616 382 AFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHSDSISVKEKFIHAKYAEKLFVRKPKDNQYLH-----SV 456 (638)
Q Consensus 382 ~~~n~i~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kp~~~~~~~~re~fI~~KY~~k~fv~~~~~~~~~~-----~~ 456 (638)
..+|+|||+.+++. ...||.++++...|++||++||++++|+.+........ ..
T Consensus 107 ~~~n~~~e~~~~~~---------------------~~~kp~~~~~~~~re~fIr~KY~~k~f~~~l~~~~~~~~~~~~~r 165 (368)
T 3jue_A 107 VIINQIYEARVEAM---------------------AVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGRPR 165 (368)
T ss_dssp HHHHHHHTTTTTTT---------------------TCCCCCTTSCHHHHHHHHHHHHTSCTTCCSCC-------------
T ss_pred HHHHHHHHhhcccc---------------------cCcCCCCCCCHHHHHHHHHHHHHhhcccccchhhhhccccccCcc
Confidence 99999999999862 14689999999999999999999999998865322100 00
Q ss_pred ccceec-ccccccchhhhhhh-cccccCccccccchhccchhhHHHHHhhhhccccCCCcccccccccC-Cccccccccc
Q 006616 457 AHQIWE-GVRTNDKKAVYRHI-VNFEVDVNAVYEQVSCISSLTLAKAMLLNEQTSLERSSSSLTGNSSD-RSSSGSLNLA 533 (638)
Q Consensus 457 ~~~L~~-Av~~~d~~~v~~lL-l~~gaDvN~~~~~~~~~~~~~l~~~ll~~~~~~~~~~~~~l~~~~~~-~~~~~~~lL~ 533 (638)
.+.... .....+.....+.. .....+++..... ..|+.+... +....+..|+
T Consensus 166 ~~~~~~p~~~~~~~~~~~~~~~~~~~~~l~~~~~~-------------------------t~L~~Aa~~~g~~~~v~~LL 220 (368)
T 3jue_A 166 GQPPVPPKPSIRPRPGSLRSKPEPPSEDLGSLHPG-------------------------ALLFRASGHPPSLPTMADAL 220 (368)
T ss_dssp -------------------------------CCHH-------------------------HHHHHHTSSSCCHHHHHHHH
T ss_pred cCCCCCCCcccCCCCccccccccccccccccCCCC-------------------------cHHHHHHHccCCHHHHHHHH
Confidence 000000 00000000000000 0111222221111 122233333 4555666667
Q ss_pred CCCCCCCcCC--CCCCcHHHHHHHhCCHHHHHHHHHcCCCCcccCCCCCcHHHHHHHhCCHHHHHHHHhCCCCCCCccCC
Q 006616 534 GTSEGQTMDD--LEGCTLLHLACDSADIGMLELLLQYGANINATDSRGLTPLHRCILRGKAMFAKLLLTRGADPRAVNRE 611 (638)
Q Consensus 534 ~~~~~~~~~d--~~G~TpLh~Aa~~g~~~~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~lLl~~gad~~~~d~~ 611 (638)
..|++++..+ ..|.||||+||..|+.++|++||++|+++|.+|..|+||||+|+..|+.+++++||++|++++.+|.+
T Consensus 221 ~~Gadvn~~~~~~~g~TpLh~Aa~~g~~~iv~~LL~~Gadvn~~d~~G~TpLh~A~~~g~~~~v~~LL~~Gad~~~~d~~ 300 (368)
T 3jue_A 221 AHGADVNWVNGGQDNATPLIQATAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFLKRGADLGARDSE 300 (368)
T ss_dssp HTTCCTTCCCTTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCTTCCCTT
T ss_pred HcCCCCCccccccCCCCHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCcHHHHHHHHHCcCCCCCcCCC
Confidence 7777777777 78999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCHHHHHHHcCCCcHHHHHHHhhCC
Q 006616 612 GKTSLELAVESNFADSEVLAILSDSH 637 (638)
Q Consensus 612 g~TpL~~A~~~g~~d~eiv~lLle~g 637 (638)
|.||||+|+..|+ .+++++|++++
T Consensus 301 G~TpL~~A~~~g~--~~iv~lLl~~~ 324 (368)
T 3jue_A 301 GRDPLTIAMETAN--ADIVTLLRLAK 324 (368)
T ss_dssp SCCHHHHHHHTTC--HHHHHHHHHHH
T ss_pred CCCHHHHHHHCCC--HHHHHHHHHcC
Confidence 9999999999998 89999998764
|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A | Back alignment and structure |
|---|
| >2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} | Back alignment and structure |
|---|
| >2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} | Back alignment and structure |
|---|
| >2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A | Back alignment and structure |
|---|
| >3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A | Back alignment and structure |
|---|
| >1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 638 | ||||
| d1dcqa2 | 122 | g.45.1.1 (A:247-368) Pyk2-associated protein beta | 1e-39 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 9e-23 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-17 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-12 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-11 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 9e-11 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-10 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-09 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-07 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-06 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-06 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-04 | |
| d1btka_ | 169 | b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom | 2e-16 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 1e-15 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 2e-14 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-12 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 6e-11 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 1e-09 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 3e-08 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 3e-12 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 7e-09 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 3e-04 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 4e-12 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 2e-06 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 0.003 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 8e-12 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 1e-06 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 4e-06 | |
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 1e-11 | |
| d1plsa_ | 113 | b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta | 2e-11 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 6e-11 | |
| d1wi1a_ | 126 | b.55.1.1 (A:) Calcium-dependent activator protein | 7e-11 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 8e-11 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 8e-11 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 2e-10 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 8e-06 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 4e-05 | |
| d1upqa_ | 107 | b.55.1.1 (A:) Phosphoinositol 3-phosphate binding | 9e-11 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 2e-10 | |
| d1unqa_ | 118 | b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H | 6e-10 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 6e-10 | |
| d1v5pa_ | 126 | b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: | 9e-10 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 2e-09 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 3e-07 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 2e-04 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 0.002 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 0.003 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-09 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 1e-08 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 8e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 8e-05 | |
| d1qqga1 | 103 | b.55.1.2 (A:12-114) Insulin receptor substrate 1, | 2e-09 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 4e-09 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 6e-09 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 9e-09 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 2e-08 | |
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 2e-08 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 6e-08 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 3e-07 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 5e-07 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 0.001 | |
| d2coca1 | 99 | b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont | 2e-07 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 3e-07 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 4e-07 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 3e-05 | |
| d2dyna_ | 111 | b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId | 4e-07 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 4e-07 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 5e-07 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 5e-06 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 0.001 | |
| d2coaa1 | 112 | b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma | 4e-07 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 4e-07 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 1e-06 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 7e-04 | |
| d2fjla1 | 101 | b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph | 6e-07 | |
| d2elba1 | 268 | a.238.1.1 (A:6-273) DCC-interacting protein 13-alp | 1e-06 | |
| d2j59m1 | 133 | b.55.1.1 (M:931-1063) Rho GTPase-activating protei | 2e-06 | |
| d1omwa2 | 119 | b.55.1.1 (A:550-668) G-protein coupled receptor ki | 2e-06 | |
| d1v5ma_ | 136 | b.55.1.1 (A:) SH2 and PH domain-containing adapter | 9e-06 | |
| d1x1fa1 | 136 | b.55.1.1 (A:8-143) Signal-transducing adaptor prot | 1e-05 | |
| d2cofa1 | 95 | b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) | 3e-05 | |
| d1y2oa1 | 248 | a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain | 4e-05 | |
| d1wgqa_ | 109 | b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin | 6e-05 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 1e-04 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 1e-04 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 3e-04 | |
| d2elba2 | 101 | b.55.1.1 (A:274-374) DCC-interacting protein 13-al | 2e-04 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 2e-04 | |
| d1ki1b2 | 142 | b.55.1.1 (B:1439-1580) GEF of intersectin {Human ( | 3e-04 | |
| d1wg7a_ | 150 | b.55.1.1 (A:) Dedicator of cytokinesis protein 9, | 3e-04 | |
| d1zc3b1 | 109 | b.55.1.1 (B:171-279) Exocyst complex protein EXO84 | 4e-04 | |
| d1btna_ | 106 | b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), | 4e-04 | |
| d1urua_ | 217 | a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila | 5e-04 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 0.001 | |
| d1wjma_ | 123 | b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), | 0.003 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 0.004 |
| >d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 | Back information, alignment and structure |
|---|
class: Small proteins fold: ArfGap/RecO-like zinc finger superfamily: ArfGap/RecO-like zinc finger family: Pyk2-associated protein beta ARF-GAP domain domain: Pyk2-associated protein beta ARF-GAP domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 138 bits (350), Expect = 1e-39
Identities = 55/142 (38%), Positives = 79/142 (55%), Gaps = 23/142 (16%)
Query: 305 SEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLD 364
+++ I ++R+ GND C DCGAP+P W S NLG+L CIECSG+HR LGVH S+++SLTLD
Sbjct: 2 TKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLD 61
Query: 365 VKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHS 424
V S + L +++GNA N + E L S KP+
Sbjct: 62 --VLGTSELLLAKNIGNAGFNEIMECCLPSEDPV---------------------KPNPG 98
Query: 425 DSISVKEKFIHAKYAEKLFVRK 446
+ ++ +I AKY E+ + RK
Sbjct: 99 SDMIARKDYITAKYMERRYARK 120
|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 | Back information, alignment and structure |
|---|
| >d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 217 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 638 | |||
| d1dcqa2 | 122 | Pyk2-associated protein beta ARF-GAP domain {Mouse | 100.0 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.87 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.85 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.85 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.84 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.83 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.82 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.81 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.81 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.8 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.79 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.79 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.79 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.78 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.78 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 99.77 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 99.77 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.76 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.76 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.75 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 99.75 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.74 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 99.73 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.73 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.73 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 99.72 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.72 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.72 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.71 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.71 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.71 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 99.71 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.71 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 99.71 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.7 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 99.7 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.7 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.69 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 99.69 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 99.69 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 99.68 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.67 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 99.67 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.67 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.67 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.66 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.65 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.65 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.65 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.65 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 99.65 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.64 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 99.64 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.63 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.62 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 99.62 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.62 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.61 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.6 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.6 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 99.59 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.59 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.58 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 99.58 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.54 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.53 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.5 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 99.15 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 99.03 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 98.84 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 98.62 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 98.6 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 98.51 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 98.41 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 98.38 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 98.07 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 97.94 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 97.69 | |
| d2elba1 | 268 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 97.64 | |
| d2adza1 | 105 | Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 | 96.51 | |
| d2zkmx3 | 131 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 94.69 | |
| d1u5ka2 | 157 | Recombinational repair protein RecO, C-terminal do | 80.42 |
| >d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: ArfGap/RecO-like zinc finger superfamily: ArfGap/RecO-like zinc finger family: Pyk2-associated protein beta ARF-GAP domain domain: Pyk2-associated protein beta ARF-GAP domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=4.4e-39 Score=282.75 Aligned_cols=118 Identities=47% Similarity=0.825 Sum_probs=110.8
Q ss_pred chHHHHHHcccCCcccccCCCCCCCceecccceeEeccchhhhccCCCccceeEEeecCCCccCHHHHHHHHHhchHHHH
Q 006616 306 EKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFAN 385 (638)
Q Consensus 306 ~~~~~~~~~~~~n~~c~dC~~~~p~w~~~~~g~~~C~~Csg~hr~lg~~~skvrsl~ld~~~~~~~~~~~~~~~gN~~~n 385 (638)
+++++.|++.|||+.|||||+++|+|+|+|||||||++|||+||+||+|||+|||++|| .|+++++++|+.+||..+|
T Consensus 3 ~~~l~~l~~~p~N~~CaDC~~~~p~w~s~n~GvfvC~~CsgiHR~lg~~is~VkS~~ld--~w~~~~i~~~~~~GN~~~n 80 (122)
T d1dcqa2 3 KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLD--VLGTSELLLAKNIGNAGFN 80 (122)
T ss_dssp HHHHHHHHHSTTTTBCTTTCCBSCCEEETTTTEEECHHHHHHHHHHCTTTCCEEETTTS--CCCGGGGHHHHHSCHHHHH
T ss_pred HHHHHHHHhCCCCCccCCCCCCCCCeEEecCCEEEchhhhHHHhcCCCCceEeeecccC--CCCHHHHHHHHHHhHHHHH
Confidence 56788999999999999999999999999999999999999999999999999999999 7999999999999999999
Q ss_pred HHHHhhhccccccccCCCCCCCCCCCCccccccCCCCCCCCHHHHHHHHHHHHhhhhhccC
Q 006616 386 SVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHSDSISVKEKFIHAKYAEKLFVRK 446 (638)
Q Consensus 386 ~i~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kp~~~~~~~~re~fI~~KY~~k~fv~~ 446 (638)
++||+.+++.. ..||.++++...|++||++||++++|+.+
T Consensus 81 ~~~ea~~~~~~---------------------~~kp~~~~~~~~r~~fI~~KY~~k~f~~k 120 (122)
T d1dcqa2 81 EIMECCLPSED---------------------PVKPNPGSDMIARKDYITAKYMERRYARK 120 (122)
T ss_dssp HHHTTTCCSSS---------------------CCSCCTTCCHHHHHHHHHHHHTTCTTSCC
T ss_pred HHHHhhCCccc---------------------CcCCCCCccHHHHHHHHHHHHHhCccccc
Confidence 99999987621 35899999999999999999999999865
|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|