Citrus Sinensis ID: 006645

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------
MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLISKHPETTEHLIATLKAEKEELESSLSKEKLQSIQLKQDLTEAESQNTDLYKELQSVRGQLAAEQSRCFKLEVDVAELRQKLQTMETLQKELELLQRQKAASEQAALNAKRQSSGGMWGWLAGAPPTQNAYDA
ccccccccccccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEEccccccEEccccccccccEEcccccccccccccccccccccccEEEEEEccEEEEcccccccccccccEEEcEEEEcccccccccccccccEEEEccEEEEEcccccccccccEEEEEccccEEEEEEEEEccccccccccccccccccEEEEEEccEEEEEEccccccccccEEEEEEccccEEEEEEEcccccccccccEEEEEccEEEEEccccccccccccEEEEEcccccEEEEcccccccccccccEEEEEcccEEEEEcccccccccccEEEEEccccEEEcccccccccccccccEEEEEccEEEEEEEccccccccccEEEEEcccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccccc
ccHHHHcccccccHHHHHHHHHHcccccccccHHHHHHHccHHHHHHHHHHHHHcccccccccccccccccEccccEcccHccccccHHHHHHHHHHHccccccccccccccccccEEEEEccccccccccccccccccccccEEEEEccEEEEEEcccccccccccccEcEEEEccccccccccccccEEEEEccEEEEEEccccccccccEEEEEccccEEEEccccccccccccccccccccccccEEEEEccEEEEEEccccccccccEEEEEEccccEEEEEcccccccccccccEEEEEccEEEEEEcccccccccccEEEEcccccEEEEccccccccccccccEEEEEcccEEEEEEccccccccccEEEEcccccEEEEccccccccccccccEEEEEccEEEEEEccccccccccEEEEEEccccccccccEEEEccccccccEcEEcccccccccHHHHHccccHccccHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccccccc
mamarassglaypeRFYAAAsyagfdgspnssakeltskfsnDSALLLYALYQQatvgpcnvpkpsswspveqskwkSWQGLGNMATTEAMRLFVKILeeedpgwysrasnsvaepivdvemnhdskTEAVKengnsfpetktistengnlmetqdkdvvseglgsvvvydqwiappisgqrpkaryehgaavvqdkmyiyggnhngrylsdmhiLDLRSWAWSKIQAKAVAestespspalltpcaghslipwENKLLSiaghtkdpseiIQVKVFdlqtcswstlktygkppvsrggqsvtLVGTSLVIfggedakrsllndlhildletmtwdeidavgvppsprsdhAAAVHAERYLLIfgggshaacfndlhvldlqtmewsrptqqgeiptpraghagvtiGENWFLGLSLVVSSYSGEDVIVAFGgyngrynnevhvlkpshkstlsskmietpvpdsvsavqnntnptrdleselevgqegkireivvdnvdsepliskhpetTEHLIATLKAEKEELESSLSKEKLQSIQLKQDLTEAESQNTDLYKELQSVRGQLAAEQSRCFKLEVDVAELRQKLQTMETLQKELELLQRQKAASEQAALNAKrqssggmwgwlagapptqnayda
mamarassglayPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEavkengnsfpetktistengnlmeTQDKDVVSEGLGSVVVYDQWIappisgqrpkaRYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWstlktygkppvsrggqsvTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIEtpvpdsvsavqnntnptrdleselevgqegkireivvdnvdsepliskhpettEHLIATLKAEKEELESSLSKEKLQSIQLKQDLTEAESQNTDLYKELQSVRGQLAAEQSRCFKLEVDVAELRQKLQTMETLQKELELLQRQKAASEQAALNakrqssggmwgwlagapptqnayda
MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSalllyalyqqaTVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFlglslvvssysgEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLISKHPETTEHLIATlkaekeelesslskeklqsiqlkqDLTEAESQNTDLYKELQSVRGQLAAEQSRCFKLEVDVAELRQKlqtmetlqkelellqRQKAASEQAALNAKRQSSGGMWGWLAGAPPTQNAYDA
*************ERFYAAASYA********************SALLLYALYQQATVGPCNVPK***W**VEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYS****************************************************VSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAV*********ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGV*******HAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSR**********RAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVL************************************************IV**************************************************************************SRCFKLEVDVAEL**************************************MWGWL************
*************ERFYAAASYA**********************LLLYAL**************************************AMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSK****************ISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAK***********ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQ*EIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTL*********************************QEGKIRE**********************************************************************************************************************************W*************
*********LAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNV*************WKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKI**************ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLISKHPETTEHLIATLKAE*************QSIQLKQDLTEAESQNTDLYKELQSVRGQLAAEQSRCFKLEVDVAELRQKLQTMETLQKELELLQR****************SGGMWGWLAGAPPTQNAYDA
*********LAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAV*******SPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLISKHPETTEHLIATLKAEKEELESSLSKEKLQSIQLKQDLTEAESQNTDLYKELQSVRGQLAAEQSRCFKLEVDVAELRQKLQTMETLQKELELLQRQKAAS************GGMWGWL*GAPP*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLISKHPETTEHLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLAAEQSRCFKLEVDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSSGGMWGWLAGAPPTQNAYDA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query637 2.2.26 [Sep-21-2011]
Q9MA55668 Acyl-CoA-binding domain-c yes no 0.976 0.931 0.727 0.0
Q8RWD9648 Acyl-CoA-binding domain-c no no 0.943 0.927 0.683 0.0
Q7M3S9 943 RING finger protein B OS= no no 0.357 0.241 0.3 5e-26
Q61191 2045 Host cell factor 1 OS=Mus yes no 0.335 0.104 0.279 3e-21
P51611 2090 Host cell factor 1 OS=Mes N/A no 0.335 0.102 0.279 3e-21
P51610 2035 Host cell factor 1 OS=Hom yes no 0.335 0.105 0.279 7e-21
Q5EA50372 Rab9 effector protein wit no no 0.364 0.623 0.280 9e-21
Q9V4C8 1500 Host cell factor OS=Droso no no 0.394 0.167 0.283 3e-20
Q7Z6M1372 Rab9 effector protein wit no no 0.361 0.618 0.266 3e-19
Q58CV6382 Kelch domain-containing p no no 0.397 0.662 0.275 4e-19
>sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 Back     alignment and function desciption
 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/667 (72%), Positives = 555/667 (83%), Gaps = 45/667 (6%)

Query: 1   MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPC 60
           MAM RA+SG AYPERFYAAASY G DGS +SSAK + SKF +D+ALLLYALYQQATVGPC
Sbjct: 1   MAMPRATSGPAYPERFYAAASYVGLDGS-DSSAKNVISKFPDDTALLLYALYQQATVGPC 59

Query: 61  NVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDV 120
           N PKPS+W PVEQSKWKSWQGLG M + EAMRLFVKILEE+DPGWYSRASN + +P+VDV
Sbjct: 60  NTPKPSAWRPVEQSKWKSWQGLGTMPSIEAMRLFVKILEEDDPGWYSRASNDIPDPVVDV 119

Query: 121 EMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISG 180
           ++N  +K E V ENG++F ETKTISTENG L ETQDKDVVSE   +V VY+QW AP  SG
Sbjct: 120 QINR-AKDEPVVENGSTFSETKTISTENGRLAETQDKDVVSEDSNTVSVYNQWTAPQTSG 178

Query: 181 QRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSP 240
           QRPKARYEHGAAV+QDKMYIYGGNHNGRYL D+H+LDL+SW WS+++ K   ES E+ +P
Sbjct: 179 QRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVATESQETSTP 238

Query: 241 ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQ 300
            LL PCAGHSLI W+NKLLSI GHTKDPSE +QVKVFD  T +WS LKTYGKPPVSRGGQ
Sbjct: 239 TLLAPCAGHSLIAWDNKLLSIGGHTKDPSESMQVKVFDPHTITWSMLKTYGKPPVSRGGQ 298

Query: 301 SVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERY 360
           SVT+VG +LVIFGG+DAKRSLLNDLHILDL+TMTWDEIDAVGV PSPRSDHAAAVHAER+
Sbjct: 299 SVTMVGKTLVIFGGQDAKRSLLNDLHILDLDTMTWDEIDAVGVSPSPRSDHAAAVHAERF 358

Query: 361 LLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFL------- 413
           LLIFGGGSHA CF+DLHVLDLQTMEWSRP QQG+ PTPRAGHAGVTIGENWF+       
Sbjct: 359 LLIFGGGSHATCFDDLHVLDLQTMEWSRPAQQGDAPTPRAGHAGVTIGENWFIVGGGDNK 418

Query: 414 -------------------------------GLSLVVSSYSGEDVIVAFGGYNGRYNNEV 442
                                          GLSLVVSSY+GEDV+VAFGGYNGRYNNE+
Sbjct: 419 SGASESVVLNMSTLAWSVVASVQGRVPLASEGLSLVVSSYNGEDVLVAFGGYNGRYNNEI 478

Query: 443 HVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSE 502
           ++LKPSHKSTL +K +E P+P S+SAV N T  TRD+ESE+EV QEG++REIV+DNV+  
Sbjct: 479 NLLKPSHKSTLQTKTLEAPLPGSLSAVNNAT--TRDIESEVEVSQEGRVREIVMDNVNPG 536

Query: 503 PLISKHPETTEHLIATLKAEKEELESSLSKEKLQSIQLKQDLTEAESQNTDLYKELQSVR 562
              SK    +E +IAT+K+EKEELE+SL+KE++Q++QL+Q+L EAE +NTDLYKELQSVR
Sbjct: 537 ---SKVEGNSERIIATIKSEKEELEASLNKERMQTLQLRQELGEAELRNTDLYKELQSVR 593

Query: 563 GQLAAEQSRCFKLEVDVAELRQKLQTMETLQKELELLQRQKAASEQAALNAKRQSSGGMW 622
           GQLAAEQSRCFKLEVDVAELRQKLQT+ETLQKELELLQRQKAASEQAA+NAKRQ SGG+W
Sbjct: 594 GQLAAEQSRCFKLEVDVAELRQKLQTLETLQKELELLQRQKAASEQAAMNAKRQGSGGVW 653

Query: 623 GWLAGAP 629
           GWLAG+P
Sbjct: 654 GWLAGSP 660
Binds medium- and long-chain acyl-CoA esters with very high affinity. Can interact in vitro with oleoyl-CoA, barely with palmitoyl-CoA, but not with arachidonyl-CoA. May function as an intracellular carrier of acyl-CoA esters. Plays a role in the biosynthesis of membrane lipids including galactolipids and phospholipids.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 Back     alignment and function description
>sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 Back     alignment and function description
>sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 Back     alignment and function description
>sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 Back     alignment and function description
>sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 Back     alignment and function description
>sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 Back     alignment and function description
>sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 Back     alignment and function description
>sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 Back     alignment and function description
>sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query637
255542698675 acyl-CoA binding protein, putative [Rici 0.987 0.931 0.784 0.0
225450825675 PREDICTED: acyl-CoA-binding domain-conta 0.995 0.939 0.778 0.0
296089677674 unnamed protein product [Vitis vinifera] 0.993 0.939 0.779 0.0
428754002669 acyl-CoA binding protein 4 [Vernicia for 0.990 0.943 0.765 0.0
224125222686 predicted protein [Populus trichocarpa] 0.998 0.927 0.759 0.0
449454077671 PREDICTED: acyl-CoA-binding domain-conta 0.987 0.937 0.741 0.0
224123550644 predicted protein [Populus trichocarpa] 0.951 0.940 0.747 0.0
297829060669 acyl-CoA binding protein 4, acyl-CoA-bin 0.978 0.931 0.725 0.0
42572263669 acyl-CoA binding protein 4 [Arabidopsis 0.978 0.931 0.727 0.0
42563520668 acyl-CoA binding protein 4 [Arabidopsis 0.976 0.931 0.727 0.0
>gi|255542698|ref|XP_002512412.1| acyl-CoA binding protein, putative [Ricinus communis] gi|223548373|gb|EEF49864.1| acyl-CoA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1097 bits (2836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/668 (78%), Positives = 585/668 (87%), Gaps = 39/668 (5%)

Query: 1   MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPC 60
           MAMARASSGLAYPERFYAAA+YAGFDGSP+S++  ++SKF +D+ALLLYALYQQAT+GPC
Sbjct: 1   MAMARASSGLAYPERFYAAATYAGFDGSPDSASSTVSSKFQSDTALLLYALYQQATIGPC 60

Query: 61  NVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDV 120
           + PKPS+W  VE SKWKSWQGLGNMA+TEAMRLFVKILEEEDPGWYSRASNSV EP+VD+
Sbjct: 61  SAPKPSTWKAVELSKWKSWQGLGNMASTEAMRLFVKILEEEDPGWYSRASNSVPEPVVDM 120

Query: 121 EMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISG 180
           ++NH+ K E++ ENGNS+PETKTIS+ENGN++ETQDKDVVSEGLGSV VYDQWI PPISG
Sbjct: 121 QLNHNPKVESIVENGNSYPETKTISSENGNVIETQDKDVVSEGLGSVAVYDQWITPPISG 180

Query: 181 QRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSP 240
           QRPKARYEHGAAVVQDKMYIYGGNHNGRYL+D+H+LDLRSW+WSK+ AK  AES ES S 
Sbjct: 181 QRPKARYEHGAAVVQDKMYIYGGNHNGRYLNDLHVLDLRSWSWSKVDAKVEAESNESKSS 240

Query: 241 ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQ 300
             LTPCAGHSLI WENKLLSIAGHTKDPSE +QVKVFDLQT +WSTLKTYGKPPVSRGGQ
Sbjct: 241 PTLTPCAGHSLISWENKLLSIAGHTKDPSEYMQVKVFDLQTRTWSTLKTYGKPPVSRGGQ 300

Query: 301 SVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERY 360
           SVTLVGTSLVIFGG+DAKRSLLNDLHILDLE+MTWDEIDAVGVPPSPRSDHAAAVHAERY
Sbjct: 301 SVTLVGTSLVIFGGQDAKRSLLNDLHILDLESMTWDEIDAVGVPPSPRSDHAAAVHAERY 360

Query: 361 LLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFL------- 413
           +LIFGGGSHA CFNDLHVLD + MEW+RPTQQG++P+PRAGHAGVT+GENWF+       
Sbjct: 361 ILIFGGGSHATCFNDLHVLDSKNMEWTRPTQQGKLPSPRAGHAGVTVGENWFIAGGGDNK 420

Query: 414 -------------------------------GLSLVVSSYSGEDVIVAFGGYNGRYNNEV 442
                                          GLSL+VSSY+GED++V+FGGYNGRY+N+V
Sbjct: 421 SGVSETIVLNMSTLVWSVVTSVEGRVPLASEGLSLMVSSYNGEDILVSFGGYNGRYSNDV 480

Query: 443 HVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSE 502
           +VLKPSHKSTL SK+IETPVPDSVSAV N TN TRDLESE E GQEGKIREIV+DNVD E
Sbjct: 481 NVLKPSHKSTLQSKIIETPVPDSVSAVHNATNATRDLESESEAGQEGKIREIVMDNVDPE 540

Query: 503 PLISKHPETTEHLIATLKAEKEELESSLSKEKLQSIQLKQDLTEAESQNTDLYKELQSVR 562
           P+ SK   ++EHL+ATLKAEKEELESSLSKEK Q++QLKQ+L EAE++NTDLYKELQSVR
Sbjct: 541 PMKSKGEVSSEHLLATLKAEKEELESSLSKEKFQTLQLKQELAEAETRNTDLYKELQSVR 600

Query: 563 GQLAAEQSRCFKLEVDVAELRQKLQTMETLQKELELLQRQKAASEQAALNAK-RQSSGGM 621
            QLAAEQSRCFKLEVDVAELRQKLQTMETLQKELELLQRQKAASEQAALNA+ RQ S G+
Sbjct: 601 SQLAAEQSRCFKLEVDVAELRQKLQTMETLQKELELLQRQKAASEQAALNARQRQGSSGV 660

Query: 622 WGWLAGAP 629
           WGWLAG P
Sbjct: 661 WGWLAGTP 668

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225450825|ref|XP_002284019.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089677|emb|CBI39496.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|428754002|gb|AFZ62126.1| acyl-CoA binding protein 4 [Vernicia fordii] Back     alignment and taxonomy information
>gi|224125222|ref|XP_002319530.1| predicted protein [Populus trichocarpa] gi|222857906|gb|EEE95453.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449454077|ref|XP_004144782.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] gi|449526493|ref|XP_004170248.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224123550|ref|XP_002330149.1| predicted protein [Populus trichocarpa] gi|222871605|gb|EEF08736.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297829060|ref|XP_002882412.1| acyl-CoA binding protein 4, acyl-CoA-binding domain 4 [Arabidopsis lyrata subsp. lyrata] gi|297328252|gb|EFH58671.1| acyl-CoA binding protein 4, acyl-CoA-binding domain 4 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42572263|ref|NP_974227.1| acyl-CoA binding protein 4 [Arabidopsis thaliana] gi|332640717|gb|AEE74238.1| acyl-CoA binding protein 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42563520|ref|NP_187193.3| acyl-CoA binding protein 4 [Arabidopsis thaliana] gi|75264903|sp|Q9MA55.1|ACBP4_ARATH RecName: Full=Acyl-CoA-binding domain-containing protein 4; Short=Acyl-CoA binding protein 4 gi|7596769|gb|AAF64540.1| unknown protein [Arabidopsis thaliana] gi|30102696|gb|AAP21266.1| At3g05420 [Arabidopsis thaliana] gi|110736070|dbj|BAF00008.1| hypothetical protein [Arabidopsis thaliana] gi|332640716|gb|AEE74237.1| acyl-CoA binding protein 4 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query637
TAIR|locus:2143676648 ACBP5 "acyl-CoA binding protei 0.982 0.966 0.590 1.1e-192
TAIR|locus:2184352514 AT5G04420 [Arabidopsis thalian 0.409 0.507 0.5 5.7e-84
TAIR|locus:2183008 708 AT5G18590 [Arabidopsis thalian 0.376 0.338 0.359 4.2e-50
DICTYBASE|DDB_G0270750485 DDB_G0270750 "Kelch repeat-con 0.340 0.447 0.330 1.8e-25
UNIPROTKB|F1SKQ3370 RABEPK "Uncharacterized protei 0.356 0.613 0.286 4.1e-23
DICTYBASE|DDB_G0268860 943 rngB "Kelch repeat-containing 0.353 0.238 0.307 1.9e-21
UNIPROTKB|Q5EA50372 RABEPK "Rab9 effector protein 0.362 0.620 0.281 2.4e-21
ZFIN|ZDB-GENE-070424-100411 zgc:163014 "zgc:163014" [Danio 0.339 0.525 0.319 6.7e-21
MGI|MGI:2139530380 Rabepk "Rab9 effector protein 0.356 0.597 0.298 7.9e-21
RGD|1310612372 Rabepk "Rab9 effector protein 0.356 0.610 0.290 9e-20
TAIR|locus:2143676 ACBP5 "acyl-CoA binding protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1867 (662.3 bits), Expect = 1.1e-192, P = 1.1e-192
 Identities = 380/644 (59%), Positives = 444/644 (68%)

Query:     3 MARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSXXXXXXXXXXXTVGPCNV 62
             M RASSGL+YPERFYAAASY G DGS  SS K+L+SKFSND+           T+GPC++
Sbjct:     4 MVRASSGLSYPERFYAAASYVGLDGS-QSSVKQLSSKFSNDTSLLLYTLHQQATLGPCSI 62

Query:    63 PKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEM 122
             PKPS+W+PVEQSKWKSWQGLG M + EAMRLFVKILEE DPGWY R SNSV +P V V++
Sbjct:    63 PKPSAWNPVEQSKWKSWQGLGTMPSIEAMRLFVKILEEADPGWYPRTSNSVLDPAVHVQI 122

Query:   123 NHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQR 182
             N  +K E   E+G SF ETKTI++E+G L ETQDKDVV E   +V VY+QW AP  SGQ 
Sbjct:   123 N-STKAEPSFESGASFGETKTITSEDGRLTETQDKDVVLEDPDTVSVYNQWTAPRTSGQP 181

Query:   183 PKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPAL 242
             PKARY+HGAAV+QDKMY+YGGNHNGRYL D+H+LDL++W WS+++ K V  S E+ SPA 
Sbjct:   182 PKARYQHGAAVIQDKMYMYGGNHNGRYLGDLHVLDLKNWTWSRVETKVVTGSQETSSPAK 241

Query:   243 LTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSV 302
             LT CAGHSLIPW+N+LLSI GHTKDPSE + V VFDL  CSWS LKTYGKPP+SRGGQSV
Sbjct:   242 LTHCAGHSLIPWDNQLLSIGGHTKDPSESMPVMVFDLHCCSWSILKTYGKPPISRGGQSV 301

Query:   303 TLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLL 362
             TLVG SLVIFGG+DAKRSLLNDLHILDL+TMTW+EIDAVG PP+PRSDHAAAVHAERYLL
Sbjct:   302 TLVGKSLVIFGGQDAKRSLLNDLHILDLDTMTWEEIDAVGSPPTPRSDHAAAVHAERYLL 361

Query:   363 IFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFXXXXXXXXXX 422
             IFGGGSHA CF+DLHVLDLQTMEWSR TQQG+ PTPRAGHAGVTIGENW+          
Sbjct:   362 IFGGGSHATCFDDLHVLDLQTMEWSRHTQQGDAPTPRAGHAGVTIGENWYIVGGGDNKSG 421

Query:   423 XXEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAV-------QNNTN- 474
               + V++            V    P     LS  +      D V A         N  N 
Sbjct:   422 ASKTVVLNMSTLAWSVVTSVQEHVPLASEGLSLVVSSYNGEDIVVAFGGYNGHYNNEVNV 481

Query:   475 --PTR--DLESELEVGQEGKIREIVVDNVDSEPLIS--KHPETTEHLIATXXXXXXXXXX 528
               P+    L+S++            V+N  +  + S  K     + +I T          
Sbjct:   482 LKPSHKSSLKSKIMGASAVPDSFSAVNNATTRDIESEIKVEGKADRIITTLKSEKEEVEA 541

Query:   529 XXXXXXXXXXXXXXDLTEAESQNTDLYKELQSVRGQLAAEQSRCFKLEVDVAELRQKXXX 588
                           +L E +++NT+LYKELQSVR QLAAEQSRCFKLEV+VAELRQK   
Sbjct:   542 SLNKEKIQTLQLKEELAEIDTRNTELYKELQSVRNQLAAEQSRCFKLEVEVAELRQKLQT 601

Query:   589 XXXXXXXXXXXXRQKA-ASEQAA-LNAKRQSSGGMWGWLAGAPP 630
                         RQ+A ASEQAA +NAKRQSSGG+WGWLAG PP
Sbjct:   602 METLQKELELLQRQRAVASEQAATMNAKRQSSGGVWGWLAGTPP 645
GO:0000062 "fatty-acyl-CoA binding" evidence=IEA;ISS;IDA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006869 "lipid transport" evidence=RCA;IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009416 "response to light stimulus" evidence=TAS
GO:0006306 "DNA methylation" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0031047 "gene silencing by RNA" evidence=RCA
GO:0031048 "chromatin silencing by small RNA" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
TAIR|locus:2184352 AT5G04420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2183008 AT5G18590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKQ3 RABEPK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268860 rngB "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EA50 RABEPK "Rab9 effector protein with kelch motifs" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070424-100 zgc:163014 "zgc:163014" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2139530 Rabepk "Rab9 effector protein with kelch motifs" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310612 Rabepk "Rab9 effector protein with kelch motifs" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9MA55ACBP4_ARATHNo assigned EC number0.72710.97640.9311yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00022741001
SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (673 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query637
pfam0088787 pfam00887, ACBP, Acyl CoA binding protein 8e-22
cd0043585 cd00435, ACBP, Acyl CoA binding protein (ACBP) bin 1e-18
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 9e-11
PTZ0045890 PTZ00458, PTZ00458, acyl CoA binding protein; Prov 3e-10
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 5e-09
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 9e-09
COG428187 COG4281, ACB, Acyl-CoA-binding protein [Lipid meta 1e-08
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 3e-08
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 4e-08
pfam1385442 pfam13854, Kelch_5, Kelch motif 5e-08
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 1e-07
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 9e-07
pfam12795239 pfam12795, MscS_porin, Mechanosensitive ion channe 1e-06
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-06
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 8e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 8e-06
pfam0764648 pfam07646, Kelch_2, Kelch motif 2e-05
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-05
pfam1385442 pfam13854, Kelch_5, Kelch motif 4e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-05
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-05
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 8e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-04
pfam0764648 pfam07646, Kelch_2, Kelch motif 2e-04
pfam01920106 pfam01920, Prefoldin_2, Prefoldin subunit 2e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 3e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 3e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-04
pfam10473140 pfam10473, Cenp-F_leu_zip, Leucine-rich repeats of 3e-04
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 4e-04
pfam05557 722 pfam05557, MAD, Mitotic checkpoint protein 5e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-04
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 9e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
pfam1396450 pfam13964, Kelch_6, Kelch motif 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
pfam0134446 pfam01344, Kelch_1, Kelch motif 0.002
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
PRK11281 1113 PRK11281, PRK11281, hypothetical protein; Provisio 0.002
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 0.002
pfam1385442 pfam13854, Kelch_5, Kelch motif 0.003
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.003
pfam13166 713 pfam13166, AAA_13, AAA domain 0.003
TIGR03007498 TIGR03007, pepcterm_ChnLen, polysaccharide chain l 0.003
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 0.003
pfam11068131 pfam11068, DUF2869, Protein of unknown function (D 0.003
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.004
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.004
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.004
TIGR03185 650 TIGR03185, DNA_S_dndD, DNA sulfur modification pro 0.004
>gnl|CDD|216174 pfam00887, ACBP, Acyl CoA binding protein Back     alignment and domain information 
 Score = 89.6 bits (223), Expect = 8e-22
 Identities = 32/89 (35%), Positives = 49/89 (55%), Gaps = 12/89 (13%)

Query: 14  ERFYAAASYAGFDGSPNSSAKELTSKF--SNDSALLLYALYQQATVGPCNVPKPSSWSPV 71
           E F AA  +           K+L      SN+  L LYALY+QAT G  N P+P  +  +
Sbjct: 3   EEFEAAVKFV----------KKLPKDGRPSNEEKLKLYALYKQATEGDVNTPRPGMFDVI 52

Query: 72  EQSKWKSWQGLGNMATTEAMRLFVKILEE 100
            ++KW +W+ L  M+  EAM+ +V+++EE
Sbjct: 53  GKAKWDAWKKLKGMSKEEAMKKYVELVEE 81

Length = 87
>gnl|CDD|238248 cd00435, ACBP, Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|185637 PTZ00458, PTZ00458, acyl CoA binding protein; Provisional Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|226731 COG4281, ACB, Acyl-CoA-binding protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|221776 pfam12795, MscS_porin, Mechanosensitive ion channel porin domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|202045 pfam01920, Prefoldin_2, Prefoldin subunit Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|151039 pfam10473, Cenp-F_leu_zip, Leucine-rich repeats of kinetochore protein Cenp-F/LEK1 Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|234084 TIGR03007, pepcterm_ChnLen, polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|220964 pfam11068, DUF2869, Protein of unknown function (DUF2869) Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 637
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 99.98
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.98
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.97
PHA02790480 Kelch-like protein; Provisional 99.97
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.97
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.97
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.97
PHA02713557 hypothetical protein; Provisional 99.97
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.96
KOG1230521 consensus Protein containing repeated kelch motifs 99.96
PHA03098534 kelch-like protein; Provisional 99.96
PTZ0045890 acyl CoA binding protein; Provisional 99.96
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.96
cd0043585 ACBP Acyl CoA binding protein (ACBP) binds thiol e 99.95
PHA02790480 Kelch-like protein; Provisional 99.95
PF0088787 ACBP: Acyl CoA binding protein; InterPro: IPR00058 99.94
KOG0817142 consensus Acyl-CoA-binding protein [Lipid transpor 99.93
COG428187 ACB Acyl-CoA-binding protein [Lipid metabolism] 99.91
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.73
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.61
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.58
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.45
KOG3878469 consensus Protein involved in maintenance of Golgi 99.19
PLN02772398 guanylate kinase 99.09
PF1396450 Kelch_6: Kelch motif 99.03
PF1396450 Kelch_6: Kelch motif 99.02
PLN02772398 guanylate kinase 98.98
PF1341549 Kelch_3: Galactose oxidase, central domain 98.86
PF1341549 Kelch_3: Galactose oxidase, central domain 98.82
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.81
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.8
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.78
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.72
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.63
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.63
PF1385442 Kelch_5: Kelch motif 98.63
PF1385442 Kelch_5: Kelch motif 98.51
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.41
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.41
smart0061247 Kelch Kelch domain. 98.31
smart0061247 Kelch Kelch domain. 98.28
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.08
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.79
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 97.61
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.5
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.1
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.75
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.58
COG4372 499 Uncharacterized protein conserved in bacteria with 96.55
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.51
PRK11637 428 AmiB activator; Provisional 96.48
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 96.39
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.36
PF12768281 Rax2: Cortical protein marker for cell polarity 96.34
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.32
PRK11637 428 AmiB activator; Provisional 96.29
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.15
PF12768281 Rax2: Cortical protein marker for cell polarity 96.09
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.08
PRK09039 343 hypothetical protein; Validated 96.06
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 95.91
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.89
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 95.88
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 95.83
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 95.73
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 95.71
PRK12704 520 phosphodiesterase; Provisional 95.71
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 95.66
COG2433 652 Uncharacterized conserved protein [Function unknow 95.63
KOG0646476 consensus WD40 repeat protein [General function pr 95.62
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 95.61
PRK09039 343 hypothetical protein; Validated 95.56
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 95.5
COG4372 499 Uncharacterized protein conserved in bacteria with 95.49
COG307479 Uncharacterized protein conserved in bacteria [Fun 95.49
PF13851201 GAS: Growth-arrest specific micro-tubule binding 95.38
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.37
PTZ00421493 coronin; Provisional 95.34
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.26
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 95.25
PRK10884206 SH3 domain-containing protein; Provisional 95.22
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.22
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 95.14
smart00295207 B41 Band 4.1 homologues. Also known as ezrin/radix 95.11
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 95.03
PF10186 302 Atg14: UV radiation resistance protein and autopha 94.93
KOG2055514 consensus WD40 repeat protein [General function pr 94.87
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 94.86
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 94.85
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 94.83
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 94.79
PF00373126 FERM_M: FERM central domain; InterPro: IPR019748 T 94.79
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.78
PRK04863 1486 mukB cell division protein MukB; Provisional 94.73
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 94.72
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 94.72
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 94.7
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 94.69
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 94.6
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.57
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 94.53
COG4942 420 Membrane-bound metallopeptidase [Cell division and 94.53
COG2433 652 Uncharacterized conserved protein [Function unknow 94.49
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 94.42
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 94.4
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 94.4
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 94.36
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 94.3
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 94.29
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 94.27
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 94.2
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.17
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 94.16
PRK00409 782 recombination and DNA strand exchange inhibitor pr 94.05
PF13851201 GAS: Growth-arrest specific micro-tubule binding 94.02
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 94.0
KOG2055514 consensus WD40 repeat protein [General function pr 93.93
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 93.86
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 93.84
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 93.84
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 93.83
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 93.71
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 93.59
PF05335188 DUF745: Protein of unknown function (DUF745); Inte 93.59
PRK10361 475 DNA recombination protein RmuC; Provisional 93.57
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 93.54
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 93.53
PRK09343121 prefoldin subunit beta; Provisional 93.49
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 93.46
PF10186 302 Atg14: UV radiation resistance protein and autopha 93.45
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 93.45
PRK04863 1486 mukB cell division protein MukB; Provisional 93.4
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 93.39
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 93.36
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 93.35
PRK1542279 septal ring assembly protein ZapB; Provisional 93.32
PHA02562 562 46 endonuclease subunit; Provisional 93.28
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 93.24
COG4026290 Uncharacterized protein containing TOPRIM domain, 93.16
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 93.13
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 93.11
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 93.05
KOG3850455 consensus Predicted membrane protein [Function unk 93.01
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 93.0
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 92.94
PF06637442 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th 92.93
PRK00178430 tolB translocation protein TolB; Provisional 92.9
KOG0971 1243 consensus Microtubule-associated protein dynactin 92.89
PRK04792448 tolB translocation protein TolB; Provisional 92.88
KOG2129 552 consensus Uncharacterized conserved protein H4 [Fu 92.88
PRK04922433 tolB translocation protein TolB; Provisional 92.87
COG4942 420 Membrane-bound metallopeptidase [Cell division and 92.83
COG1322 448 Predicted nuclease of restriction endonuclease-lik 92.77
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 92.73
PRK00409 782 recombination and DNA strand exchange inhibitor pr 92.58
PF00038312 Filament: Intermediate filament protein; InterPro: 92.53
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 92.5
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 92.49
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 92.47
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 92.46
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 92.41
PF06409265 NPIP: Nuclear pore complex interacting protein (NP 92.39
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 92.36
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 92.29
KOG1853 333 consensus LIS1-interacting protein NUDE [Cytoskele 92.12
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 92.08
PRK13684334 Ycf48-like protein; Provisional 92.05
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 92.01
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 91.91
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 91.88
KOG4403 575 consensus Cell surface glycoprotein STIM, contains 91.88
PF09755 310 DUF2046: Uncharacterized conserved protein H4 (DUF 91.8
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 91.78
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 91.73
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 91.72
KOG2991330 consensus Splicing regulator [RNA processing and m 91.66
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 91.65
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 91.63
PF05667 594 DUF812: Protein of unknown function (DUF812); Inte 91.63
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 91.62
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 91.55
CHL00118156 atpG ATP synthase CF0 B' subunit; Validated 91.51
PRK09174204 F0F1 ATP synthase subunit B'; Validated 91.5
KOG3859406 consensus Septins (P-loop GTPases) [Cell cycle con 91.48
PF12217367 End_beta_propel: Catalytic beta propeller domain o 91.46
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.32
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 91.3
PF15290 305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 91.25
PRK10698222 phage shock protein PspA; Provisional 91.22
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 91.22
PF14662193 CCDC155: Coiled-coil region of CCDC155 91.19
KOG3091508 consensus Nuclear pore complex, p54 component (sc 91.13
KOG4360 596 consensus Uncharacterized coiled coil protein [Fun 90.99
PRK04792448 tolB translocation protein TolB; Provisional 90.99
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 90.94
PRK03947140 prefoldin subunit alpha; Reviewed 90.86
PF02050123 FliJ: Flagellar FliJ protein; InterPro: IPR012823 90.85
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 90.81
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 90.79
KOG3647 338 consensus Predicted coiled-coil protein [General f 90.77
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 90.7
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 90.66
PRK07720146 fliJ flagellar biosynthesis chaperone; Validated 90.63
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 90.57
TIGR03007 498 pepcterm_ChnLen polysaccharide chain length determ 90.5
PRK05137435 tolB translocation protein TolB; Provisional 90.48
KOG0971 1243 consensus Microtubule-associated protein dynactin 90.48
PF03938158 OmpH: Outer membrane protein (OmpH-like); InterPro 90.4
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 90.38
PRK11519 719 tyrosine kinase; Provisional 90.33
PF15066527 CAGE1: Cancer-associated gene protein 1 family 90.3
KOG0646476 consensus WD40 repeat protein [General function pr 90.28
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 90.16
PF14723179 SSFA2_C: Sperm-specific antigen 2 C-terminus 90.11
KOG1003205 consensus Actin filament-coating protein tropomyos 90.09
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 90.06
PRK05689147 fliJ flagellar biosynthesis chaperone; Validated 90.05
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 90.02
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 89.91
PRK11028330 6-phosphogluconolactonase; Provisional 89.88
PF14662193 CCDC155: Coiled-coil region of CCDC155 89.87
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 89.87
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 89.82
PRK04778 569 septation ring formation regulator EzrA; Provision 89.69
PF05335188 DUF745: Protein of unknown function (DUF745); Inte 89.67
PRK11519 719 tyrosine kinase; Provisional 89.66
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 89.62
COG5185 622 HEC1 Protein involved in chromosome segregation, i 89.59
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 89.52
smart00502127 BBC B-Box C-terminal domain. Coiled coil region C- 89.44
KOG0288 459 consensus WD40 repeat protein TipD [General functi 89.37
KOG2321 703 consensus WD40 repeat protein [General function pr 89.36
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 89.34
COG4026290 Uncharacterized protein containing TOPRIM domain, 89.34
KOG0933 1174 consensus Structural maintenance of chromosome pro 89.32
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 89.31
PRK13454181 F0F1 ATP synthase subunit B'; Provisional 89.26
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 89.21
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 89.14
PF07058 351 Myosin_HC-like: Myosin II heavy chain-like; InterP 89.13
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 89.1
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 89.08
PF14073178 Cep57_CLD: Centrosome localisation domain of Cep57 89.05
PLN00033398 photosystem II stability/assembly factor; Provisio 88.94
PHA02562 562 46 endonuclease subunit; Provisional 88.83
PRK06568154 F0F1 ATP synthase subunit B; Validated 88.77
PF15290 305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 88.73
PRK04922433 tolB translocation protein TolB; Provisional 88.7
PRK14011144 prefoldin subunit alpha; Provisional 88.69
TIGR00634 563 recN DNA repair protein RecN. All proteins in this 88.68
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 88.66
PRK13453173 F0F1 ATP synthase subunit B; Provisional 88.65
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 88.59
PF10267395 Tmemb_cc2: Predicted transmembrane and coiled-coil 88.55
PRK11028330 6-phosphogluconolactonase; Provisional 88.54
PRK11546143 zraP zinc resistance protein; Provisional 88.52
PRK14472175 F0F1 ATP synthase subunit B; Provisional 88.49
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 88.39
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 88.33
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 88.29
KOG0996 1293 consensus Structural maintenance of chromosome pro 88.29
PF09738 302 DUF2051: Double stranded RNA binding protein (DUF2 88.28
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 88.2
PF14988206 DUF4515: Domain of unknown function (DUF4515) 88.2
PRK06231205 F0F1 ATP synthase subunit B; Validated 88.16
PF04799171 Fzo_mitofusin: fzo-like conserved region; InterPro 88.16
TIGR02473141 flagell_FliJ flagellar export protein FliJ. Member 88.15
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 88.12
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 88.11
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 88.11
PRK00178430 tolB translocation protein TolB; Provisional 88.11
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 88.1
PF06637442 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th 88.08
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 88.01
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 87.96
PF13088275 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 87.94
KOG4657246 consensus Uncharacterized conserved protein [Funct 87.88
PF00038312 Filament: Intermediate filament protein; InterPro: 87.84
PRK11281 1113 hypothetical protein; Provisional 87.83
PRK13460173 F0F1 ATP synthase subunit B; Provisional 87.77
CHL00019184 atpF ATP synthase CF0 B subunit 87.68
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 87.62
KOG0240607 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] 87.61
PF12761195 End3: Actin cytoskeleton-regulatory complex protei 87.61
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 87.56
TIGR02977219 phageshock_pspA phage shock protein A. Members of 87.52
PF05911769 DUF869: Plant protein of unknown function (DUF869) 87.5
PF06476115 DUF1090: Protein of unknown function (DUF1090); In 87.5
COG1730145 GIM5 Predicted prefoldin, molecular chaperone impl 87.49
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 87.41
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 87.35
PF10267395 Tmemb_cc2: Predicted transmembrane and coiled-coil 87.26
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 87.25
PF12777 344 MT: Microtubule-binding stalk of dynein motor; Int 87.22
PRK08475167 F0F1 ATP synthase subunit B; Validated 87.21
PRK12705 508 hypothetical protein; Provisional 87.21
PRK07352174 F0F1 ATP synthase subunit B; Validated 87.2
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 87.08
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 86.98
PF07058 351 Myosin_HC-like: Myosin II heavy chain-like; InterP 86.95
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 86.94
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 86.91
PF14988206 DUF4515: Domain of unknown function (DUF4515) 86.88
KOG0310487 consensus Conserved WD40 repeat-containing protein 86.85
PF10205102 KLRAQ: Predicted coiled-coil domain-containing pro 86.78
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 86.75
TIGR02977219 phageshock_pspA phage shock protein A. Members of 86.73
PF13863126 DUF4200: Domain of unknown function (DUF4200) 86.68
PF14362301 DUF4407: Domain of unknown function (DUF4407) 86.67
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 86.6
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 86.58
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 86.56
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 86.5
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 86.48
PRK05759156 F0F1 ATP synthase subunit B; Validated 86.37
PRK07353140 F0F1 ATP synthase subunit B'; Validated 86.25
KOG4807593 consensus F-actin binding protein, regulates actin 86.2
PRK15178434 Vi polysaccharide export inner membrane protein Ve 86.12
PRK14474250 F0F1 ATP synthase subunit B; Provisional 86.12
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 86.1
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 86.08
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 86.0
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 85.92
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 85.75
PRK03947140 prefoldin subunit alpha; Reviewed 85.63
PRK03629429 tolB translocation protein TolB; Provisional 85.53
KOG2264 907 consensus Exostosin EXT1L [Signal transduction mec 85.52
KOG35982220 consensus Thyroid hormone receptor-associated prot 85.51
PRK13455184 F0F1 ATP synthase subunit B; Provisional 85.48
PF05010207 TACC: Transforming acidic coiled-coil-containing p 85.46
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 85.42
PRK10803 263 tol-pal system protein YbgF; Provisional 85.37
PF02090147 SPAM: Salmonella surface presentation of antigen g 85.35
TIGR02231 525 conserved hypothetical protein. This family consis 85.29
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 85.24
PRK10476 346 multidrug resistance protein MdtN; Provisional 85.16
smart00502127 BBC B-Box C-terminal domain. Coiled coil region C- 85.05
COG3206458 GumC Uncharacterized protein involved in exopolysa 84.98
PRK10803 263 tol-pal system protein YbgF; Provisional 84.96
PRK06975 656 bifunctional uroporphyrinogen-III synthetase/uropo 84.88
PRK04043419 tolB translocation protein TolB; Provisional 84.83
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 84.67
PF14282106 FlxA: FlxA-like protein 84.65
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 84.6
PRK10929 1109 putative mechanosensitive channel protein; Provisi 84.59
KOG0310487 consensus Conserved WD40 repeat-containing protein 84.57
PRK14475167 F0F1 ATP synthase subunit B; Provisional 84.53
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 84.48
TIGR03321246 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. 84.47
KOG0979 1072 consensus Structural maintenance of chromosome pro 84.43
KOG1003205 consensus Actin filament-coating protein tropomyos 84.42
KOG4673 961 consensus Transcription factor TMF, TATA element m 84.41
KOG2991330 consensus Splicing regulator [RNA processing and m 84.38
KOG3647 338 consensus Predicted coiled-coil protein [General f 84.35
PF05911769 DUF869: Plant protein of unknown function (DUF869) 84.31
KOG0018 1141 consensus Structural maintenance of chromosome pro 84.08
PTZ00420568 coronin; Provisional 83.94
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 83.91
TIGR00998 334 8a0101 efflux pump membrane protein (multidrug res 83.87
KOG0249 916 consensus LAR-interacting protein and related prot 83.84
KOG2129 552 consensus Uncharacterized conserved protein H4 [Fu 83.79
PRK0211973 hypothetical protein; Provisional 83.79
KOG0964 1200 consensus Structural maintenance of chromosome pro 83.77
PF14817 632 HAUS5: HAUS augmin-like complex subunit 5 83.75
PRK02889427 tolB translocation protein TolB; Provisional 83.73
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 83.71
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 83.63
KOG2077 832 consensus JNK/SAPK-associated protein-1 [Signal tr 83.6
KOG0240607 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] 83.56
PF02646 304 RmuC: RmuC family; InterPro: IPR003798 This protei 83.49
COG3206458 GumC Uncharacterized protein involved in exopolysa 83.46
TIGR03495135 phage_LysB phage lysis regulatory protein, LysB fa 83.31
PF14817 632 HAUS5: HAUS augmin-like complex subunit 5 83.26
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 83.22
PF13514 1111 AAA_27: AAA domain 83.21
PRK13684334 Ycf48-like protein; Provisional 83.2
PF04201162 TPD52: Tumour protein D52 family; InterPro: IPR007 83.16
PF06632342 XRCC4: DNA double-strand break repair and V(D)J re 83.13
KOG0288 459 consensus WD40 repeat protein TipD [General functi 83.05
KOG0979 1072 consensus Structural maintenance of chromosome pro 82.99
PRK14473164 F0F1 ATP synthase subunit B; Provisional 82.93
PF10226195 DUF2216: Uncharacterized conserved proteins (DUF22 82.89
PRK00286438 xseA exodeoxyribonuclease VII large subunit; Revie 82.87
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 82.8
PF10205102 KLRAQ: Predicted coiled-coil domain-containing pro 82.72
KOG4603201 consensus TBP-1 interacting protein [Signal transd 82.71
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 82.52
PF05546207 She9_MDM33: She9 / Mdm33 family; InterPro: IPR0088 82.51
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 82.42
PRK09343121 prefoldin subunit beta; Provisional 82.24
COG0711161 AtpF F0F1-type ATP synthase, subunit b [Energy pro 82.2
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 82.18
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 82.18
PF13863126 DUF4200: Domain of unknown function (DUF4200) 82.08
PRK14471164 F0F1 ATP synthase subunit B; Provisional 82.03
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 81.97
KOG0933 1174 consensus Structural maintenance of chromosome pro 81.95
PF1162949 Mst1_SARAH: C terminal SARAH domain of Mst1; Inter 81.92
PRK05137435 tolB translocation protein TolB; Provisional 81.9
PF09789 319 DUF2353: Uncharacterized coiled-coil protein (DUF2 81.55
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 81.54
PRK13428 445 F0F1 ATP synthase subunit delta; Provisional 81.53
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 81.51
PF12217367 End_beta_propel: Catalytic beta propeller domain o 81.35
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 81.35
TIGR02231 525 conserved hypothetical protein. This family consis 81.32
PF11068131 YlqD: YlqD protein; InterPro: IPR021297 This bacte 81.23
COG3524372 KpsE Capsule polysaccharide export protein [Cell e 81.21
PRK07720146 fliJ flagellar biosynthesis chaperone; Validated 81.14
PF13870177 DUF4201: Domain of unknown function (DUF4201) 81.06
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 81.03
PRK03629429 tolB translocation protein TolB; Provisional 80.99
PRK01156 895 chromosome segregation protein; Provisional 80.86
PF09910339 DUF2139: Uncharacterized protein conserved in arch 80.75
PRK03598 331 putative efflux pump membrane fusion protein; Prov 80.71
KOG4403 575 consensus Cell surface glycoprotein STIM, contains 80.62
PLN00181793 protein SPA1-RELATED; Provisional 80.56
PRK05689147 fliJ flagellar biosynthesis chaperone; Validated 80.5
PRK0029568 hypothetical protein; Provisional 80.44
PLN029191057 haloacid dehalogenase-like hydrolase family protei 80.43
PF12004495 DUF3498: Domain of unknown function (DUF3498); Int 80.42
PRK10698222 phage shock protein PspA; Provisional 80.33
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 80.33
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 80.27
PF15397258 DUF4618: Domain of unknown function (DUF4618) 80.25
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 80.21
PF14992280 TMCO5: TMCO5 family 80.18
COG0497 557 RecN ATPase involved in DNA repair [DNA replicatio 80.06
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-38  Score=298.45  Aligned_cols=256  Identities=29%  Similarity=0.527  Sum_probs=225.9

Q ss_pred             CCCcceeEEEECCEEEEEcccCCCcc-----cCcEEEEEccCCeEEEeeecccccCCCCCCCCCCCCcccceEEEeCCEE
Q 006645          184 KARYEHGAAVVQDKMYIYGGNHNGRY-----LSDMHILDLRSWAWSKIQAKAVAESTESPSPALLTPCAGHSLIPWENKL  258 (637)
Q Consensus       184 ~~R~~~a~~~~~~~lyv~GG~~~~~~-----~~~v~~yd~~t~~W~~~~~~~~~~~~~~~~~~~p~~r~~hs~v~~~~~l  258 (637)
                      +.|..|+++.+|++||-|||++.+..     .-|+++++..+.+|.++++......-.++-|..|..|+||+.+.+++++
T Consensus        12 PrRVNHAavaVG~riYSFGGYCsGedy~~~~piDVH~lNa~~~RWtk~pp~~~ka~i~~~yp~VPyqRYGHtvV~y~d~~   91 (392)
T KOG4693|consen   12 PRRVNHAAVAVGSRIYSFGGYCSGEDYDAKDPIDVHVLNAENYRWTKMPPGITKATIESPYPAVPYQRYGHTVVEYQDKA   91 (392)
T ss_pred             cccccceeeeecceEEecCCcccccccccCCcceeEEeeccceeEEecCcccccccccCCCCccchhhcCceEEEEcceE
Confidence            46899999999999999999875532     2379999999999999987544344445567788999999999999999


Q ss_pred             EEEEccCCCCCcceeEEEEECCCCceEeeccCCCCCCCCCceEEEEECCEEEEEeCCCC-CCCCCCceEEEECCCCceEE
Q 006645          259 LSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDA-KRSLLNDLHILDLETMTWDE  337 (637)
Q Consensus       259 yv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~g~~p~~r~~~~~~~~~~~lyv~GG~~~-~~~~~n~i~~yd~~t~~W~~  337 (637)
                      ||+||++.+...+|.+++||+.++.|.++...|-.|.+|.+|++|++++.+|||||+.. ..+++++++.+|+.|.+|+.
T Consensus        92 yvWGGRND~egaCN~Ly~fDp~t~~W~~p~v~G~vPgaRDGHsAcV~gn~MyiFGGye~~a~~FS~d~h~ld~~TmtWr~  171 (392)
T KOG4693|consen   92 YVWGGRNDDEGACNLLYEFDPETNVWKKPEVEGFVPGARDGHSACVWGNQMYIFGGYEEDAQRFSQDTHVLDFATMTWRE  171 (392)
T ss_pred             EEEcCccCcccccceeeeeccccccccccceeeecCCccCCceeeEECcEEEEecChHHHHHhhhccceeEeccceeeee
Confidence            99999998878899999999999999999999999999999999999999999999854 34578999999999999999


Q ss_pred             ecCCCCCCCcccccEEEEEcCCEEEEEeCCCC---------CCCcCcEEEEECCCCeeEecccCCCCCCCCcccEEEEEC
Q 006645          338 IDAVGVPPSPRSDHAAAVHAERYLLIFGGGSH---------AACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIG  408 (637)
Q Consensus       338 ~~~~~~~p~~r~~h~~~~~~~~~l~v~GG~~~---------~~~~~dl~~~d~~t~~W~~l~~~~~~p~~R~~hs~~~~~  408 (637)
                      +.+.|.+|.-|.+|+++++ ++.+|||||.+.         ..+.+.|-.+|+.|..|...+..+..|.+|..|++.+.+
T Consensus       172 ~~Tkg~PprwRDFH~a~~~-~~~MYiFGGR~D~~gpfHs~~e~Yc~~i~~ld~~T~aW~r~p~~~~~P~GRRSHS~fvYn  250 (392)
T KOG4693|consen  172 MHTKGDPPRWRDFHTASVI-DGMMYIFGGRSDESGPFHSIHEQYCDTIMALDLATGAWTRTPENTMKPGGRRSHSTFVYN  250 (392)
T ss_pred             hhccCCCchhhhhhhhhhc-cceEEEeccccccCCCccchhhhhcceeEEEeccccccccCCCCCcCCCcccccceEEEc
Confidence            9999999999999999998 578999999653         245678999999999999998878889999999999987


Q ss_pred             CccccceeeeeeccCCCCEEEEEcCCCCC---CcccEEEEeCCCCccccccc
Q 006645          409 ENWFLGLSLVVSSYSGEDVIVAFGGYNGR---YNNEVHVLKPSHKSTLSSKM  457 (637)
Q Consensus       409 ~~~yiG~s~~~~~~~g~~~l~v~GG~~~~---~~~~v~~~d~~~~~~~~~~~  457 (637)
                      +                 .||+|||+++.   .+||+|+|||.+..|.....
T Consensus       251 g-----------------~~Y~FGGYng~ln~HfndLy~FdP~t~~W~~I~~  285 (392)
T KOG4693|consen  251 G-----------------KMYMFGGYNGTLNVHFNDLYCFDPKTSMWSVISV  285 (392)
T ss_pred             c-----------------eEEEecccchhhhhhhcceeecccccchheeeec
Confidence            6                 89999999985   68999999999998876543

>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PTZ00458 acyl CoA binding protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>cd00435 ACBP Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF00887 ACBP: Acyl CoA binding protein; InterPro: IPR000582 Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters [] Back     alignment and domain information
>KOG0817 consensus Acyl-CoA-binding protein [Lipid transport and metabolism] Back     alignment and domain information
>COG4281 ACB Acyl-CoA-binding protein [Lipid metabolism] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG3878 consensus Protein involved in maintenance of Golgi structure and ER-Golgi transport [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG3850 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1322 Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PF06409 NPIP: Nuclear pore complex interacting protein (NPIP); InterPro: IPR009443 This family consists of a series of primate specific nuclear pore complex interacting protein (NPIP) sequences Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>KOG2991 consensus Splicing regulator [RNA processing and modification] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated Back     alignment and domain information
>PRK09174 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PRK03947 prefoldin subunit alpha; Reviewed Back     alignment and domain information
>PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>KOG3647 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PRK07720 fliJ flagellar biosynthesis chaperone; Validated Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF03938 OmpH: Outer membrane protein (OmpH-like); InterPro: IPR005632 This entry includes outer membrane proteins such as OmpH (Skp) among others Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PF14723 SSFA2_C: Sperm-specific antigen 2 C-terminus Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK05689 fliJ flagellar biosynthesis chaperone; Validated Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>smart00502 BBC B-Box C-terminal domain Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK13454 F0F1 ATP synthase subunit B'; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK06568 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK14011 prefoldin subunit alpha; Provisional Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PRK13453 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11546 zraP zinc resistance protein; Provisional Back     alignment and domain information
>PRK14472 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF14988 DUF4515: Domain of unknown function (DUF4515) Back     alignment and domain information
>PRK06231 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PF04799 Fzo_mitofusin: fzo-like conserved region; InterPro: IPR006884 This entry represents the heptad repeat domain which is conserved at the C terminus of Fzo/mitofusion family of GTPases Back     alignment and domain information
>TIGR02473 flagell_FliJ flagellar export protein FliJ Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF13088 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 1VCU_B 2F25_B 1SO7_A 2F29_A 1SNT_A 2F13_A 2F28_A 2F27_A Back     alignment and domain information
>KOG4657 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PRK13460 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>CHL00019 atpF ATP synthase CF0 B subunit Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] Back     alignment and domain information
>PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF06476 DUF1090: Protein of unknown function (DUF1090); InterPro: IPR009468 This family consists of several bacterial proteins of unknown function and is known as YqjC in Escherichia coli Back     alignment and domain information
>COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PRK08475 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PRK07352 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF14988 DUF4515: Domain of unknown function (DUF4515) Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PF13863 DUF4200: Domain of unknown function (DUF4200) Back     alignment and domain information
>PF14362 DUF4407: Domain of unknown function (DUF4407) Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PRK05759 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK07353 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional Back     alignment and domain information
>PRK14474 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK03947 prefoldin subunit alpha; Reviewed Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] Back     alignment and domain information
>KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription] Back     alignment and domain information
>PRK13455 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF02090 SPAM: Salmonella surface presentation of antigen gene type M protein; InterPro: IPR002954 The Salmonella typhimurium Surface Presentation of Antigens M gene (SpaM) is one of 12 that form a cluster responsible for invasion properties [] Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>smart00502 BBC B-Box C-terminal domain Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK06975 bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF14282 FlxA: FlxA-like protein Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK14475 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>KOG2991 consensus Splicing regulator [RNA processing and modification] Back     alignment and domain information
>KOG3647 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14817 HAUS5: HAUS augmin-like complex subunit 5 Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>KOG2077 consensus JNK/SAPK-associated protein-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] Back     alignment and domain information
>PF02646 RmuC: RmuC family; InterPro: IPR003798 This protein contains several bacterial RmuC DNA recombination proteins Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03495 phage_LysB phage lysis regulatory protein, LysB family Back     alignment and domain information
>PF14817 HAUS5: HAUS augmin-like complex subunit 5 Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF04201 TPD52: Tumour protein D52 family; InterPro: IPR007327 The hD52 gene was originally identified through its elevated expression level in human breast carcinoma Back     alignment and domain information
>PF06632 XRCC4: DNA double-strand break repair and V(D)J recombination protein XRCC4; InterPro: IPR010585 This entry represents the DNA double-strand break repair and V(D)J recombination protein XRCC4, which is found in certain Metazoans, fungi and plants Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK14473 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif Back     alignment and domain information
>KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF05546 She9_MDM33: She9 / Mdm33 family; InterPro: IPR008839 Members of this family are mitochondrial inner membrane proteins with a role in inner mitochondrial membrane organisation and biogenesis [] Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>COG0711 AtpF F0F1-type ATP synthase, subunit b [Energy production and conversion] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF13863 DUF4200: Domain of unknown function (DUF4200) Back     alignment and domain information
>PRK14471 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11629 Mst1_SARAH: C terminal SARAH domain of Mst1; InterPro: IPR024205 The SARAH (Sav/Rassf/Hpo) domain is found at the C terminus in three classes of eukaryotic tumour suppressors that give the domain its name Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK13428 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF11068 YlqD: YlqD protein; InterPro: IPR021297 This bacterial family of proteins has no known function Back     alignment and domain information
>COG3524 KpsE Capsule polysaccharide export protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07720 fliJ flagellar biosynthesis chaperone; Validated Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK05689 fliJ flagellar biosynthesis chaperone; Validated Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF12004 DUF3498: Domain of unknown function (DUF3498); InterPro: IPR021887 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14992 TMCO5: TMCO5 family Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query637
2lbb_A96 Solution Structure Of Acyl Coa Binding Protein From 1e-06
2cop_A109 Solution Structure Of Rsgi Ruh-040, An Acbp Domain 2e-06
2wh5_A106 Crystal Structure Of Human Acyl-Coa Binding Domain 4e-06
3flv_A119 The Crystal Structure Of Human Acyl-Coenzymea Bindi 6e-05
>pdb|2LBB|A Chain A, Solution Structure Of Acyl Coa Binding Protein From Babesia Bovis T2bo Length = 96 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 36/81 (44%)
Query: 25  FDGSPNSSAKELTSKFSNDSXXXXXXXXXXXTVGPCNVPKPSSWSPVEQSKWKSWQGLGN 84
           FD +    +   T   SND            TVG CN PKP      E+ KW++W  L  
Sbjct: 14  FDAAVKYVSNTTTMMASNDDKLCFYKYYKQATVGDCNKPKPGMLQLQEKYKWEAWNALRG 73
Query: 85  MATTEAMRLFVKILEEEDPGW 105
           M+T  A   +VK+L+   P W
Sbjct: 74  MSTESAKEAYVKLLDTLAPSW 94
>pdb|2COP|A Chain A, Solution Structure Of Rsgi Ruh-040, An Acbp Domain From Human Cdna Length = 109 Back     alignment and structure
>pdb|2WH5|A Chain A, Crystal Structure Of Human Acyl-Coa Binding Domain 4 Complexed With Stearoyl-Coa Length = 106 Back     alignment and structure
>pdb|3FLV|A Chain A, The Crystal Structure Of Human Acyl-Coenzymea Binding Domain Containing 5 Length = 119 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query637
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-36
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 8e-34
2cqu_A116 Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi 7e-28
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-25
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 7e-10
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 4e-24
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-21
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-04
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-21
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-13
2lbb_A96 Acyl COA binding protein; protein binding, structu 3e-23
1st7_A86 ACBP, acyl-COA-binding protein; four helix bundle, 3e-23
2cb8_A87 Acyl-COA-binding protein; acyl-coenzyme A binding 4e-23
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-23
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 5e-19
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 5e-18
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-11
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 7e-23
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-21
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 9e-23
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-22
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-06
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-04
1hbk_A89 ACBP, acyl-COA binding protein; fatty acid metabol 2e-22
3fp5_A106 Acyl-COA binding protein; ACBP, cacao disease, fat 3e-22
2cop_A109 Acyl-coenzyme A binding domain containing 6; acyl 4e-22
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-21
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-18
3flv_A119 Acyl-COA-binding domain-containing protein 5; lipi 4e-21
2wh5_A106 Acyl-COA-binding domain-containing protein 4; alte 8e-21
3epy_A89 Acyl-COA-binding domain-containing protein 7; acyl 1e-20
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 3e-07
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 7e-07
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 7e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 1e-04
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1c1g_A 284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 5e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 7e-04
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-04
3bas_A89 Myosin heavy chain, striated muscle/general contro 4e-05
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 1e-04
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 1e-04
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 2e-04
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 3e-04
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 8e-04
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 6e-04
3na7_A 256 HP0958; flagellar biogenesis, flagellum export, C4 6e-04
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
 Score =  144 bits (364), Expect = 2e-36
 Identities = 49/299 (16%), Positives = 92/299 (30%), Gaps = 55/299 (18%)

Query: 170 YDQWIAPPISGQRPKARYEHGAAVV--QDKMYIYGG-NHNGRYLSDMHILDLRSWAWSKI 226
            D       S + P AR  H    +   +++ + GG     + LSD  I D+++  WS I
Sbjct: 424 IDMKNIEVSSSEVPVARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNWIFDMKTREWSMI 483

Query: 227 QAKAVAESTESPSPALLTPCAGHSLIPW-ENKLLSIAGHTKDPSEIIQVKVFDLQTCSWS 285
           +                     HS     +  +L + G T+ P+    + ++++    + 
Sbjct: 484 K----------SLS---HTRFRHSACSLPDGNVLILGGVTEGPA----MLLYNVTEEIFK 526

Query: 286 TLKTYGKPPVSRGGQSVTLVGT----SLVIFGGEDAKRSLLNDLHILDLE----TMTWDE 337
            +    +   +    +           +++ GG   + ++ +   I   +    T     
Sbjct: 527 DVTPKDEFFQNSLVSAGLEFDPVSKQGIILGGGFMDQTTVSDKAIIFKYDAENATEPITV 586

Query: 338 IDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACF---NDLHVLDLQTMEWSRPTQQGE 394
           I  +  P   R          R LLI GG S +  F   N +  LD  +   +       
Sbjct: 587 IKKLQHPLFQRYGSQIKYITPRKLLIVGGTSPSGLFDRTNSIISLDPLSETLTSIPISRR 646

Query: 395 IPTP----RAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYN----GRYNNEVHVL 445
           I        AG + V+                    + +  GG      G   N    L
Sbjct: 647 IWEDHSLMLAGFSLVSTSMG---------------TIHIIGGGATCYGFGSVTNVGLKL 690
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Length = 96 Back     alignment and structure
>1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} Length = 86 Back     alignment and structure
>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Length = 87 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 Length = 89 Back     alignment and structure
>3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} Length = 106 Back     alignment and structure
>2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} Length = 119 Back     alignment and structure
>2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} Length = 106 Back     alignment and structure
>3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Length = 89 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Length = 120 Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Length = 111 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query637
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1hbk_A89 ACBP, acyl-COA binding protein; fatty acid metabol 99.97
2cop_A109 Acyl-coenzyme A binding domain containing 6; acyl 99.96
3epy_A89 Acyl-COA-binding domain-containing protein 7; acyl 99.96
1st7_A86 ACBP, acyl-COA-binding protein; four helix bundle, 99.96
2cqu_A116 Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi 99.96
2lbb_A96 Acyl COA binding protein; protein binding, structu 99.96
2cb8_A87 Acyl-COA-binding protein; acyl-coenzyme A binding 99.96
3fp5_A106 Acyl-COA binding protein; ACBP, cacao disease, fat 99.95
2wh5_A106 Acyl-COA-binding domain-containing protein 4; alte 99.95
3flv_A119 Acyl-COA-binding domain-containing protein 5; lipi 99.95
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.95
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.94
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.16
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.98
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.82
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.71
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 97.69
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.62
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.46
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.07
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.96
2v4h_A110 NF-kappa-B essential modulator; transcription, met 96.78
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 96.71
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.59
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.49
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.34
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 96.3
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 96.24
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.18
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.1
3jrp_A379 Fusion protein of protein transport protein SEC13 96.05
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.02
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.99
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.99
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.97
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.95
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 95.95
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 95.93
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 95.92
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.84
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 95.82
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 95.78
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 95.77
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 95.76
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 95.76
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 95.72
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.69
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.67
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 95.66
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.66
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.59
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.59
3v9f_A781 Two-component system sensor histidine kinase/RESP 95.48
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 95.41
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 95.4
3jrp_A379 Fusion protein of protein transport protein SEC13 95.31
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 95.3
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.29
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.29
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.28
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.22
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.21
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 95.17
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 95.17
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 94.98
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 94.93
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.93
3cve_A72 Homer protein homolog 1; coiled coil, alternative 94.88
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 94.8
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 94.75
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 94.74
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.71
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 94.7
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 94.66
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.66
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 94.61
4h22_A103 Leucine-rich repeat flightless-interacting protei; 94.51
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.42
3jro_A 753 Fusion protein of protein transport protein SEC13 94.36
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 94.34
3ow8_A321 WD repeat-containing protein 61; structural genomi 94.33
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.31
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 94.26
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 94.25
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 94.24
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 94.24
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 94.01
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 93.96
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 93.92
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 93.9
3bas_A89 Myosin heavy chain, striated muscle/general contro 93.9
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 93.84
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 93.81
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 93.8
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 93.79
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 93.77
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 93.7
3jro_A 753 Fusion protein of protein transport protein SEC13 93.69
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 93.67
3ow8_A321 WD repeat-containing protein 61; structural genomi 93.65
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 93.55
2v4h_A110 NF-kappa-B essential modulator; transcription, met 93.54
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 93.53
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 93.5
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 93.46
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 93.45
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.45
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 93.43
4a2l_A795 BT_4663, two-component system sensor histidine kin 93.41
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 93.29
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 93.29
4g56_B357 MGC81050 protein; protein arginine methyltransfera 93.22
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 93.2
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 93.17
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 93.11
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 93.09
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 93.03
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.01
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 93.0
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 92.92
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 92.9
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 92.87
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 92.83
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 92.74
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 92.7
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 92.64
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 92.57
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 92.56
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 92.53
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 92.47
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.47
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 92.41
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 92.37
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 92.37
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 92.22
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.19
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 92.12
2oto_A155 M protein; helical coiled coil, fibrinogen-binding 92.03
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 92.02
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 91.98
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 91.91
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 91.9
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 91.86
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 91.8
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.8
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 91.79
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 91.79
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 91.76
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 91.41
4e54_B435 DNA damage-binding protein 2; beta barrel, double 91.38
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 91.35
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 91.35
4e54_B435 DNA damage-binding protein 2; beta barrel, double 91.32
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 91.22
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 91.21
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 91.16
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 91.14
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 91.14
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 91.12
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 91.11
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 91.07
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 91.02
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 90.98
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 90.96
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 90.96
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 90.84
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 90.83
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 90.76
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 90.7
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 90.66
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 90.64
4g56_B357 MGC81050 protein; protein arginine methyltransfera 90.63
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 90.51
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 90.5
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 90.41
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 90.41
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 90.32
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 90.29
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 90.26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 90.24
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 90.22
3bas_A89 Myosin heavy chain, striated muscle/general contro 90.2
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 90.17
3ni0_A99 Bone marrow stromal antigen 2; coiled-coil, antivi 90.14
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 90.13
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 89.98
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 89.86
4a2l_A795 BT_4663, two-component system sensor histidine kin 89.76
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 89.74
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 89.68
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 89.67
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 89.63
3cve_A72 Homer protein homolog 1; coiled coil, alternative 89.54
2k48_A107 Nucleoprotein; viral protein; NMR {Andes virus} 89.41
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 89.38
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 89.36
2k48_A107 Nucleoprotein; viral protein; NMR {Andes virus} 89.2
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 89.11
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 89.08
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 89.02
1t3j_A96 Mitofusin 1; coiled coil antiparallel, dimer, memb 89.01
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 88.94
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 88.72
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 88.64
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 88.56
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 88.32
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 88.29
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 88.26
4emc_A190 Monopolin complex subunit CSM1; RWD domain, kineto 88.18
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 88.17
2fp8_A322 Strictosidine synthase; six bladed beta propeller 88.14
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 88.14
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 88.12
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 88.08
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 88.04
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 87.93
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 87.87
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 87.86
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 87.79
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 87.78
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 87.77
2pm7_B297 Protein transport protein SEC13, protein transport 87.75
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 87.56
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 87.49
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 87.47
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 87.45
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 87.39
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 87.33
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 87.31
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 87.29
2xyi_A430 Probable histone-binding protein CAF1; transcripti 87.22
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 87.09
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 87.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 86.86
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 86.74
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 86.69
4dci_A150 Uncharacterized protein; PSI-biology, midwest cent 86.67
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 86.64
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 86.61
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 86.47
3s84_A 273 Apolipoprotein A-IV; four helix bundle, transport 86.43
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 86.32
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich 86.31
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 86.3
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 86.29
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 86.26
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 86.23
1ik9_A213 DNA repair protein XRCC4; DNA END joining, double- 85.96
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 85.92
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 85.79
3v9f_A781 Two-component system sensor histidine kinase/RESP 85.69
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 85.55
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 85.5
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 85.43
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 85.36
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 85.33
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 85.33
2ece_A462 462AA long hypothetical selenium-binding protein; 85.33
3k29_A169 Putative uncharacterized protein; YSCO, type III s 85.28
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 85.27
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 85.25
2xyi_A430 Probable histone-binding protein CAF1; transcripti 85.14
1gk4_A84 Vimentin; intermediate filament, dimer, parallel c 85.12
3ajw_A150 Flagellar FLIJ protein; flagellum, type III secret 85.02
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 84.95
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 84.95
1ik9_A213 DNA repair protein XRCC4; DNA END joining, double- 84.89
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 84.88
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 84.87
3au4_A555 Myosin-X; protein-protein complex, motor protein c 84.84
2ic9_A96 Nucleocapsid protein; hantavirus, bunyaviridae, ss 84.8
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 84.78
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 84.52
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 84.44
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 84.31
3ju4_A670 Endo-N-acetylneuraminidase; endonf, polysia, high- 84.3
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 84.24
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 84.23
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 84.21
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 84.16
3ott_A758 Two-component system sensor histidine kinase; beta 84.03
2ic6_A78 Nucleocapsid protein; hantavirus, bunyaviridae, ss 83.98
3fx0_A96 NF-kappa-B essential modulator; coiled-coil, coile 83.9
4fi5_A113 Nucleoprotein; structural genomics, niaid, nationa 83.87
1m1j_A 491 Fibrinogen alpha subunit; coiled coils, disulfide 83.84
1itv_A195 MMP9; adaptive molecular recognition, beta propell 83.84
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 83.75
4b6x_A90 AVRRPS4, avirulence protein; toxin, type 3 secrete 83.56
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 83.48
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 83.47
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 82.75
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 82.74
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 82.71
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 82.57
3lay_A175 Zinc resistance-associated protein; salmonella typ 82.45
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 82.33
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 82.26
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 82.17
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 82.16
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 82.13
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 82.07
3lay_A175 Zinc resistance-associated protein; salmonella typ 82.03
4h22_A103 Leucine-rich repeat flightless-interacting protei; 81.89
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 81.87
3ott_A758 Two-component system sensor histidine kinase; beta 81.67
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 81.63
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 81.49
2q6q_A74 Spindle POLE BODY component SPC42; SPC42P, budding 81.49
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 81.08
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 81.0
4emc_A190 Monopolin complex subunit CSM1; RWD domain, kineto 80.79
1x8y_A86 Lamin A/C; structural protein, intermediate filame 80.55
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 80.42
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 80.33
3ibp_A 302 Chromosome partition protein MUKB; structural main 80.28
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 80.15
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 80.07
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 80.03
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.5e-38  Score=328.55  Aligned_cols=260  Identities=17%  Similarity=0.286  Sum_probs=225.8

Q ss_pred             Cccccccc----eEEecccCCCCCCCCcceeEEEECCEEEEEcccCCCcccCcEEEEEccCCeEEEeeecccccCCCCCC
Q 006645          164 LGSVVVYD----QWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPS  239 (637)
Q Consensus       164 ~~~~~~~~----~W~~~~~~g~~p~~R~~~a~~~~~~~lyv~GG~~~~~~~~~v~~yd~~t~~W~~~~~~~~~~~~~~~~  239 (637)
                      .+.++.||    +|..++.   +|.+|.+|++++++++|||+||.. ...++++++||+.+++|..+.+           
T Consensus        23 ~~~~~~~d~~~~~W~~~~~---~p~~r~~~~~~~~~~~lyv~GG~~-~~~~~~~~~~d~~~~~W~~~~~-----------   87 (306)
T 3ii7_A           23 PQSCRYFNPKDYSWTDIRC---PFEKRRDAACVFWDNVVYILGGSQ-LFPIKRMDCYNVVKDSWYSKLG-----------   87 (306)
T ss_dssp             TTSEEEEETTTTEEEECCC---CSCCCBSCEEEEETTEEEEECCBS-SSBCCEEEEEETTTTEEEEEEC-----------
T ss_pred             CceEEEecCCCCCEecCCC---CCcccceeEEEEECCEEEEEeCCC-CCCcceEEEEeCCCCeEEECCC-----------
Confidence            34556664    9999874   899999999999999999999977 6778999999999999999854           


Q ss_pred             CCCCCCcccceEEEeCCEEEEEEccCCCCCcceeEEEEECCCCceEeeccCCCCCCCCCceEEEEECCEEEEEeCCCCCC
Q 006645          240 PALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKR  319 (637)
Q Consensus       240 ~~~p~~r~~hs~v~~~~~lyv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~g~~p~~r~~~~~~~~~~~lyv~GG~~~~~  319 (637)
                        +|.+|.+|+++.++++|||+||.+.....++++++||+.+++|+.+++   +|.+|.+|+++.++++||+|||.+...
T Consensus        88 --~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~d~~~~~W~~~~~---~p~~r~~~~~~~~~~~iyv~GG~~~~~  162 (306)
T 3ii7_A           88 --PPTPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKPS---MLTQRCSHGMVEANGLIYVCGGSLGNN  162 (306)
T ss_dssp             --CSSCCBSCEEEEETTEEEEECCBBTTBSCCCCEEEEETTTTEEEEECC---CSSCCBSCEEEEETTEEEEECCEESCT
T ss_pred             --CCccccceeEEEECCEEEEECCCCCCCcEeeeEEEEeCCCCceEeCCC---CcCCcceeEEEEECCEEEEECCCCCCC
Confidence              478999999999999999999997555678999999999999999965   899999999999999999999986654


Q ss_pred             C---CCCceEEEECCCCceEEecCCCCCCCcccccEEEEEcCCEEEEEeCCCCCCCcCcEEEEECCCCeeEecccCCCCC
Q 006645          320 S---LLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIP  396 (637)
Q Consensus       320 ~---~~n~i~~yd~~t~~W~~~~~~~~~p~~r~~h~~~~~~~~~l~v~GG~~~~~~~~dl~~~d~~t~~W~~l~~~~~~p  396 (637)
                      .   .++++++||+.+++|+.+..   +|.+|..|+++++ +++|||+||.+....++++++||+.+++|+.+.   .+|
T Consensus       163 ~~~~~~~~~~~yd~~~~~W~~~~~---~p~~r~~~~~~~~-~~~i~v~GG~~~~~~~~~~~~yd~~~~~W~~~~---~~p  235 (306)
T 3ii7_A          163 VSGRVLNSCEVYDPATETWTELCP---MIEARKNHGLVFV-KDKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVS---PMP  235 (306)
T ss_dssp             TTCEECCCEEEEETTTTEEEEECC---CSSCCBSCEEEEE-TTEEEEECCEETTEEBCCEEEEETTTTEEEECC---CCS
T ss_pred             CcccccceEEEeCCCCCeEEECCC---ccchhhcceEEEE-CCEEEEEeCCCCCCCCceEEEeeCCCCcEEECC---CCC
Confidence            3   28999999999999999974   5889999999998 677999999887777899999999999999985   788


Q ss_pred             CCCcccEEEEECCccccceeeeeeccCCCCEEEEEcCCCCC-CcccEEEEeCCCCccccc-ccCCCCCCCCcc
Q 006645          397 TPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGR-YNNEVHVLKPSHKSTLSS-KMIETPVPDSVS  467 (637)
Q Consensus       397 ~~R~~hs~~~~~~~~yiG~s~~~~~~~g~~~l~v~GG~~~~-~~~~v~~~d~~~~~~~~~-~~~~~~~~~~~~  467 (637)
                      .+|..|+++++++                 +|||+||+++. ..+++++||+.++.|... .++..+......
T Consensus       236 ~~r~~~~~~~~~~-----------------~i~v~GG~~~~~~~~~~~~yd~~~~~W~~~~~~~~~r~~~~~~  291 (306)
T 3ii7_A          236 WKGVTVKCAAVGS-----------------IVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLI  291 (306)
T ss_dssp             CCBSCCEEEEETT-----------------EEEEEECBCSSSBCCEEEEEETTTTEEEEEEEEECCSCTTCEE
T ss_pred             CCccceeEEEECC-----------------EEEEEeCcCCCeeeeeEEEEcCCCCeEEeCCCcccccceeEEE
Confidence            9999999999866                 89999999875 789999999999977654 444444444433
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 Back     alignment and structure
>2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} SCOP: a.11.1.1 Back     alignment and structure
>1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Back     alignment and structure
>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Back     alignment and structure
>3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} SCOP: a.11.1.0 Back     alignment and structure
>2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} Back     alignment and structure
>3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3ni0_A Bone marrow stromal antigen 2; coiled-coil, antiviral defense, immune system, GPI anchor; 1.60A {Mus musculus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>2k48_A Nucleoprotein; viral protein; NMR {Andes virus} Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>2k48_A Nucleoprotein; viral protein; NMR {Andes virus} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1t3j_A Mitofusin 1; coiled coil antiparallel, dimer, membrane protein; 2.50A {Mus musculus} SCOP: h.4.16.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4dci_A Uncharacterized protein; PSI-biology, midwest center for structural genomics, MCSG, S genomics, unknown function; 2.82A {Synechococcus SP} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1ik9_A DNA repair protein XRCC4; DNA END joining, double-strand break repair, V(D)J recombination, protein-protein complex, coiled coil; HET: DNA; 2.30A {Homo sapiens} SCOP: b.59.1.1 h.1.11.1 PDB: 3ii6_A* 1fu1_A* 3rwr_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3k29_A Putative uncharacterized protein; YSCO, type III secretion apparatus, S genomics, csgid; HET: MSE; 2.00A {Chlamydia trachomatis} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 Back     alignment and structure
>3ajw_A Flagellar FLIJ protein; flagellum, type III secretion, coiled-coil, protein transpor; 2.10A {Salmonella typhimurium} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1ik9_A DNA repair protein XRCC4; DNA END joining, double-strand break repair, V(D)J recombination, protein-protein complex, coiled coil; HET: DNA; 2.30A {Homo sapiens} SCOP: b.59.1.1 h.1.11.1 PDB: 3ii6_A* 1fu1_A* 3rwr_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure
>2ic9_A Nucleocapsid protein; hantavirus, bunyaviridae, ssRNA negative- strand viruses, antiparallel coiled coil, viral protein; 2.00A {Sin nombre virus} Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2ic6_A Nucleocapsid protein; hantavirus, bunyaviridae, ssRNA negative- strand viruses, antiparallel coiled coil, viral protein; 1.15A {Sin nombre virus} Back     alignment and structure
>3fx0_A NF-kappa-B essential modulator; coiled-coil, coiled coil, cytoplasm, disease mutation, ectodermal dysplasia, HOST-virus interaction; 3.20A {Homo sapiens} Back     alignment and structure
>4fi5_A Nucleoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.20A {Hantaan virus} Back     alignment and structure
>1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>4b6x_A AVRRPS4, avirulence protein; toxin, type 3 secreted effector; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2q6q_A Spindle POLE BODY component SPC42; SPC42P, budding yeast, cell cycle; 1.97A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure
>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 637
d1hbka_89 a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium 1e-24
d1hb6a_86 a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos t 2e-21
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-12
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-07
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 6e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-05
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-05
>d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} Length = 89 Back     information, alignment and structure

class: All alpha proteins
fold: Acyl-CoA binding protein-like
superfamily: Acyl-CoA binding protein
family: Acyl-CoA binding protein
domain: Acyl-CoA binding protein
species: Plasmodium falciparum [TaxId: 5833]

 Score = 96.0 bits (239), Expect = 1e-24
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 8/92 (8%)

Query: 14  ERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQ 73
           + F    S+       N   +  T    N+  L LY  Y+Q+T+G CN+ +PS+   +++
Sbjct: 4   QVFEECVSFI------NGLPR--TINLPNELKLDLYKYYKQSTIGNCNIKEPSAHKYIDR 55

Query: 74  SKWKSWQGLGNMATTEAMRLFVKILEEEDPGW 105
            K+++W+ + N+   +A + +V I+ E  P W
Sbjct: 56  KKYEAWKSVENLNREDAQKRYVDIVSEIFPYW 87
>d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Length = 86 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query637
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.96
d1hbka_89 Acyl-CoA binding protein {Plasmodium falciparum [T 99.96
d1hb6a_86 Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 99.95
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.94
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.79
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.74
d1mixa1114 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 96.67
d1h4ra1111 Merlin {Human (Homo sapiens) [TaxId: 9606]} 96.66
d1gg3a1106 Erythroid membrane protein 4.1R {Human (Homo sapie 96.55
d1ef1a1111 Moesin {Human (Homo sapiens) [TaxId: 9606]} 96.52
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.68
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.37
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 94.98
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 94.74
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.72
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 93.76
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 93.71
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.59
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 93.38
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 93.27
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 93.24
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 93.05
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 91.95
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 91.48
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.47
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 91.38
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 91.27
d2al6a1123 Focal adhesion kinase 1 {Chicken (Gallus gallus) [ 90.54
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 90.32
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 90.0
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 89.39
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 89.21
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 89.15
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 88.64
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 88.04
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 87.24
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 86.54
d1tbga_340 beta1-subunit of the signal-transducing G protein 86.17
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 85.75
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 85.58
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 85.2
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 84.69
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 83.91
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 83.42
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 83.33
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 83.15
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 82.73
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 82.47
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 82.24
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 82.08
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 81.87
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 81.46
d1lrza165 Methicillin resistance protein FemA probable tRNA- 80.93
d1gs9a_144 Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 80.37
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 80.21
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=7e-33  Score=280.17  Aligned_cols=257  Identities=18%  Similarity=0.265  Sum_probs=221.0

Q ss_pred             cCccccccc----eEEecccCCCCCCCCcceeEEEECCEEEEEcccC----CCcccCcEEEEEccCCeEEEeeecccccC
Q 006645          163 GLGSVVVYD----QWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNH----NGRYLSDMHILDLRSWAWSKIQAKAVAES  234 (637)
Q Consensus       163 ~~~~~~~~~----~W~~~~~~g~~p~~R~~~a~~~~~~~lyv~GG~~----~~~~~~~v~~yd~~t~~W~~~~~~~~~~~  234 (637)
                      .++.+++||    +|..+++   +|.+|.+|++++++++|||+||..    +...++++++||+.+++|..+++      
T Consensus        17 ~~~~~~~yd~~t~~W~~~~~---~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~~------   87 (288)
T d1zgka1          17 SLSYLEAYNPSNGTWLRLAD---LQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAP------   87 (288)
T ss_dssp             BCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCC------
T ss_pred             CCceEEEEECCCCeEEECCC---CCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhccccccccccccc------
Confidence            345666775    8999874   899999999999999999999953    23567899999999999999854      


Q ss_pred             CCCCCCCCCCCcccceEEEeCCEEEEEEccCCCCCcceeEEEEECCCCceEeeccCCCCCCCCCceEEEEECCEEEEEeC
Q 006645          235 TESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGG  314 (637)
Q Consensus       235 ~~~~~~~~p~~r~~hs~v~~~~~lyv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~g~~p~~r~~~~~~~~~~~lyv~GG  314 (637)
                             +|.+|.+|+++.++++||++||.... ...+.++.||+.+..|.....   +|.+|.+|+++.+.+.+|++||
T Consensus        88 -------~p~~r~~~~~~~~~~~i~~~gg~~~~-~~~~~~~~~~~~~~~~~~~~~---~~~~r~~~~~~~~~~~~~~~GG  156 (288)
T d1zgka1          88 -------MSVPRNRIGVGVIDGHIYAVGGSHGC-IHHNSVERYEPERDEWHLVAP---MLTRRIGVGVAVLNRLLYAVGG  156 (288)
T ss_dssp             -------CSSCCBTCEEEEETTEEEEECCEETT-EECCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECC
T ss_pred             -------ccceecceeccccceeeEEecceecc-cccceeeeeccccCccccccc---cccccccceeeeeeecceEecC
Confidence                   47899999999999999999998765 567889999999999998866   7888999999999999999999


Q ss_pred             CCCCCCCCCceEEEECCCCceEEecCCCCCCCcccccEEEEEcCCEEEEEeCCCCCCCcCcEEEEECCCCeeEecccCCC
Q 006645          315 EDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGE  394 (637)
Q Consensus       315 ~~~~~~~~n~i~~yd~~t~~W~~~~~~~~~p~~r~~h~~~~~~~~~l~v~GG~~~~~~~~dl~~~d~~t~~W~~l~~~~~  394 (637)
                      .+... ..++++.||+.+++|.....   .+.++..|+++++ ++.|+++||.+....+++++.||+.+++|..+.   .
T Consensus       157 ~~~~~-~~~~~~~~d~~~~~~~~~~~---~~~~~~~~~~~~~-~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~---~  228 (288)
T d1zgka1         157 FDGTN-RLNSAECYYPERNEWRMITA---MNTIRSGAGVCVL-HNCIYAAGGYDGQDQLNSVERYDVETETWTFVA---P  228 (288)
T ss_dssp             BCSSC-BCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEE-TTEEEEECCBCSSSBCCCEEEEETTTTEEEECC---C
T ss_pred             ccccc-ccceEEEeeccccccccccc---cccccccccccce-eeeEEEecCccccccccceeeeeecceeeeccc---C
Confidence            87654 47899999999999998864   4678888888887 567999999988888999999999999999985   6


Q ss_pred             CCCCCcccEEEEECCccccceeeeeeccCCCCEEEEEcCCCCC-CcccEEEEeCCCCccccc-ccCCCCCCC
Q 006645          395 IPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGR-YNNEVHVLKPSHKSTLSS-KMIETPVPD  464 (637)
Q Consensus       395 ~p~~R~~hs~~~~~~~~yiG~s~~~~~~~g~~~l~v~GG~~~~-~~~~v~~~d~~~~~~~~~-~~~~~~~~~  464 (637)
                      .|.+|..|+++++++                 +||||||.++. ..+++++||+.++.|... .++..+..+
T Consensus       229 ~p~~r~~~~~~~~~~-----------------~l~v~GG~~~~~~~~~v~~yd~~~~~W~~~~~~p~~R~~~  283 (288)
T d1zgka1         229 MKHRRSALGITVHQG-----------------RIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGV  283 (288)
T ss_dssp             CSSCCBSCEEEEETT-----------------EEEEECCBCSSCBCCEEEEEETTTTEEEEEEECSSCCBSC
T ss_pred             ccCcccceEEEEECC-----------------EEEEEecCCCCeecceEEEEECCCCEEEECCCCCCCcEeE
Confidence            789999999999876                 89999999875 789999999999987765 455555444
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1lrza1 a.2.7.4 (A:245-309) Methicillin resistance protein FemA probable tRNA-binding arm {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure