Citrus Sinensis ID: 006702
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 634 | ||||||
| 356562922 | 633 | PREDICTED: S-acyltransferase TIP1-like [ | 0.976 | 0.977 | 0.811 | 0.0 | |
| 225446195 | 635 | PREDICTED: S-acyltransferase TIP1 [Vitis | 0.992 | 0.990 | 0.810 | 0.0 | |
| 449443019 | 632 | PREDICTED: S-acyltransferase TIP1-like [ | 0.996 | 1.0 | 0.829 | 0.0 | |
| 357478389 | 642 | S-acyltransferase TIP1 [Medicago truncat | 0.992 | 0.979 | 0.794 | 0.0 | |
| 224120466 | 608 | predicted protein [Populus trichocarpa] | 0.940 | 0.980 | 0.785 | 0.0 | |
| 79517230 | 620 | S-acyltransferase TIP1 [Arabidopsis thal | 0.973 | 0.995 | 0.773 | 0.0 | |
| 312282023 | 619 | unnamed protein product [Thellungiella h | 0.900 | 0.922 | 0.797 | 0.0 | |
| 357123214 | 638 | PREDICTED: S-acyltransferase TIP1-like [ | 0.981 | 0.974 | 0.676 | 0.0 | |
| 413954646 | 639 | hypothetical protein ZEAMMB73_866253 [Ze | 0.982 | 0.974 | 0.698 | 0.0 | |
| 242093712 | 640 | hypothetical protein SORBIDRAFT_10g02531 | 0.981 | 0.971 | 0.699 | 0.0 |
| >gi|356562922|ref|XP_003549717.1| PREDICTED: S-acyltransferase TIP1-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 1053 bits (2724), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 525/647 (81%), Positives = 570/647 (88%), Gaps = 28/647 (4%)
Query: 1 MSSEIEVVEEVGQSSQNHHNHDQSSPSNGVVVDEESLRNDVYTAAAYGDLEKLQRLVECE 60
MSSEIEVVEEV + D+ S + EESLRNDVYTAAAYGDLE+LQRLVE E
Sbjct: 1 MSSEIEVVEEV-------QSRDEQSGA------EESLRNDVYTAAAYGDLERLQRLVEQE 47
Query: 61 GCSVSEPDGLGYYALQWAALNNRTAAAQYIIEHGGDVNAADHTGQTALHWSAVRGAIQVA 120
GC VSEPDGLGYYALQWAALNNRTAAAQYIIEHGGDVNA DHTGQTALHWSAVRGAIQ A
Sbjct: 48 GCPVSEPDGLGYYALQWAALNNRTAAAQYIIEHGGDVNATDHTGQTALHWSAVRGAIQAA 107
Query: 121 ELLLREGARVNAADMYGYQTTHVAAQYGQTAFLYHIVSKWNADPDVPDNDGRSPLHWAAY 180
ELLL+EGARV+AADM GYQTTHVAAQYGQTAFLYHIVSKWNADPDVPDNDGRSPLHWAAY
Sbjct: 108 ELLLQEGARVSAADMNGYQTTHVAAQYGQTAFLYHIVSKWNADPDVPDNDGRSPLHWAAY 167
Query: 181 KGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGL 240
KGFAD IRLLLFLDA+RGRQD GCTPLHWAAIRGNLEACTVLVQAGKKEDLM+ DNTGL
Sbjct: 168 KGFADSIRLLLFLDAHRGRQDTGGCTPLHWAAIRGNLEACTVLVQAGKKEDLMLADNTGL 227
Query: 241 TPAQLASDKNHRQVAFFLGNARRLLDKRCDGNSPIGKISKLGLAPALWCVILLMLVTYMH 300
TPAQLASDKNHRQVAFFLGNARRLLDKRCDGNS +GKISKLGLAP LWC+IL++LVTY+H
Sbjct: 228 TPAQLASDKNHRQVAFFLGNARRLLDKRCDGNSRLGKISKLGLAPVLWCIILVLLVTYIH 287
Query: 301 SVIMASNLPKLTAGFGLLAWSGVFLATGGLVLFYRCSRKDPGYIRMNVHDPQNMKDDEPL 360
SVI+A+ +PKLTA GLLAW GVFLA+ GLV+FYRCS KDPGYIRMN+HD Q+ KDDEPL
Sbjct: 288 SVILATKMPKLTAAAGLLAWFGVFLASVGLVMFYRCSSKDPGYIRMNMHDNQDTKDDEPL 347
Query: 361 LKIEMNNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKW 420
LKIE+NNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKW
Sbjct: 348 LKIEINNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKW 407
Query: 421 DFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIADFSLFF 480
DFF+FLVLEV AMLVTG V + RV TDP+AP SFGAW+ Y + +HIGA+SFLIADF LFF
Sbjct: 408 DFFVFLVLEVLAMLVTGGVCLTRVLTDPLAPHSFGAWIQYVANNHIGAISFLIADFFLFF 467
Query: 481 GVAVLTAVQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKRNCSDFLINGFNE 540
GV LT VQASQISRNITTNEMANA+RY+YLRG GGRFRNPYDHG K+NCSDFLING+NE
Sbjct: 468 GVFTLTVVQASQISRNITTNEMANAMRYSYLRGPGGRFRNPYDHGIKKNCSDFLINGYNE 527
Query: 541 DVECVEDSAGT-EGIGMMHMSRNSNLQNGDGHIH----HANGNGHVAINV--NSNNTNS- 592
DVEC+E+ + EGIGMMHM+R+SNL NGD H H NGNGH AINV NSN+TNS
Sbjct: 528 DVECIEELGNSEEGIGMMHMARSSNLANGDSHTHTEYARGNGNGHHAINVDSNSNSTNSK 587
Query: 593 -HHGHL----HSSHCNHSNHGKSKTDSVPLGLGLGLGRSSARSVVAS 634
HHGH+ HSSHC+H+NHGK++ D+VPLGLGLGLGR+ RSV AS
Sbjct: 588 IHHGHINGHVHSSHCSHNNHGKTRNDNVPLGLGLGLGRN--RSVTAS 632
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225446195|ref|XP_002262878.1| PREDICTED: S-acyltransferase TIP1 [Vitis vinifera] gi|296084544|emb|CBI25565.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449443019|ref|XP_004139278.1| PREDICTED: S-acyltransferase TIP1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357478389|ref|XP_003609480.1| S-acyltransferase TIP1 [Medicago truncatula] gi|355510535|gb|AES91677.1| S-acyltransferase TIP1 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224120466|ref|XP_002331055.1| predicted protein [Populus trichocarpa] gi|222872985|gb|EEF10116.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|79517230|ref|NP_197535.2| S-acyltransferase TIP1 [Arabidopsis thaliana] gi|75282678|sp|Q52T38.1|ZDH22_ARATH RecName: Full=S-acyltransferase TIP1; AltName: Full=Ankyrin repeat-containing S-palmitoyltransferase; AltName: Full=Palmitoyltransferase TIP1; AltName: Full=Protein TIP GROWTH DEFECTIVE 1; AltName: Full=Zinc finger DHHC domain-containing protein TIP1 gi|62632827|gb|AAX89384.1| ankryin repeat S-palmitoyl transferase [Arabidopsis thaliana] gi|110737119|dbj|BAF00511.1| ankyrin-repeat protein [Arabidopsis thaliana] gi|332005451|gb|AED92834.1| S-acyltransferase TIP1 [Arabidopsis thaliana] gi|385137892|gb|AFI41207.1| ankyrin protein, partial [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|312282023|dbj|BAJ33877.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|357123214|ref|XP_003563307.1| PREDICTED: S-acyltransferase TIP1-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|413954646|gb|AFW87295.1| hypothetical protein ZEAMMB73_866253 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|242093712|ref|XP_002437346.1| hypothetical protein SORBIDRAFT_10g025310 [Sorghum bicolor] gi|241915569|gb|EER88713.1| hypothetical protein SORBIDRAFT_10g025310 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 634 | ||||||
| TAIR|locus:2149309 | 620 | TIP1 "TIP GROWTH DEFECTIVE 1" | 0.973 | 0.995 | 0.741 | 1.4e-259 | |
| TAIR|locus:1006230134 | 536 | AT2G14255 "AT2G14255" [Arabido | 0.799 | 0.945 | 0.521 | 2e-143 | |
| FB|FBgn0029137 | 585 | Patsas "Patsas" [Drosophila me | 0.738 | 0.8 | 0.313 | 7.8e-55 | |
| ZFIN|ZDB-GENE-070424-194 | 620 | zdhhc17 "zinc finger, DHHC-typ | 0.358 | 0.366 | 0.331 | 7e-49 | |
| UNIPROTKB|F1N9E7 | 601 | ZDHHC17 "Uncharacterized prote | 0.347 | 0.366 | 0.330 | 1.3e-48 | |
| UNIPROTKB|F1PRB8 | 604 | ZDHHC17 "Uncharacterized prote | 0.315 | 0.331 | 0.331 | 1.4e-47 | |
| UNIPROTKB|E1BJK1 | 634 | ZDHHC17 "Uncharacterized prote | 0.315 | 0.315 | 0.331 | 1.8e-47 | |
| MGI|MGI:2445110 | 632 | Zdhhc17 "zinc finger, DHHC dom | 0.315 | 0.316 | 0.331 | 3.9e-47 | |
| FB|FBgn0259824 | 637 | Hip14 "Huntingtin-interacting | 0.320 | 0.318 | 0.363 | 1.3e-45 | |
| UNIPROTKB|G4N0B3 | 729 | MGG_07382 "Palmitoyltransferas | 0.345 | 0.300 | 0.318 | 5.7e-43 |
| TAIR|locus:2149309 TIP1 "TIP GROWTH DEFECTIVE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2498 (884.4 bits), Expect = 1.4e-259, P = 1.4e-259
Identities = 471/635 (74%), Positives = 523/635 (82%)
Query: 1 MSSEIEVVEEVGXXXXXXXXXXXXXXXXGVVVDEESLRNDVYTAAAYGDLEKLQRLVECE 60
MSSEIEVVEE+ G+ +EESL+NDVYTAAAYGDLEKL RLVECE
Sbjct: 1 MSSEIEVVEEI----QSNPKENGESSSKGI--EEESLKNDVYTAAAYGDLEKLHRLVECE 54
Query: 61 GCSVSEPDGLGYYALQWAALNNRTAAAQYIIEHGGDVNAADHTGQTALHWSAVRGAIQVA 120
G SVSEPD LGYYALQW+ALNNR A AQY+IEHGGDVNA DHTGQTALHWSAVRGAIQVA
Sbjct: 55 GSSVSEPDALGYYALQWSALNNRVAVAQYLIEHGGDVNATDHTGQTALHWSAVRGAIQVA 114
Query: 121 ELLLREGARVNAADMYGYQTTHVAAQYGQTAFLYHIVSKWNADPDVPDNDGRSPLHWAAY 180
ELLL+EGARV+A DMYGYQ THVAAQYGQTAFL H+VSKWNADPDVPDNDGRSPLHWAAY
Sbjct: 115 ELLLQEGARVDATDMYGYQATHVAAQYGQTAFLCHVVSKWNADPDVPDNDGRSPLHWAAY 174
Query: 181 KGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGL 240
KGFAD IRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLM+TD TGL
Sbjct: 175 KGFADSIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMITDKTGL 234
Query: 241 TPAQLASDKNHRQVAFFLGNARRLLDKRCDGNSPIGKISKLGLAPALWCVILLMLVTYMH 300
TPAQLA++KNHRQV+FFLGNAR LL+KRCDG+SP+G++SKLGLAP LW +ILL+L+ Y +
Sbjct: 235 TPAQLAAEKNHRQVSFFLGNARSLLEKRCDGSSPLGRLSKLGLAPVLWIMILLLLLVYTN 294
Query: 301 SVIMASNLPKLTAGFGLLAWSGVFLATGGLVLFYRCSRKDPGYIRMNVHDPQNMKDDEPL 360
SV++ASNLPKLT G G LAW G LAT GL LFYRCSRKDPGYIRMN+HDPQ MKDDEPL
Sbjct: 295 SVVLASNLPKLTTGIGALAWLGFILATAGLFLFYRCSRKDPGYIRMNIHDPQTMKDDEPL 354
Query: 361 LKIEMNNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKW 420
LKIE+NNPALLAGNW+QLCATCKI+RPLRAKHCSTCDRCVEQFDHHCPWVSNC+GKKNKW
Sbjct: 355 LKIELNNPALLAGNWTQLCATCKIIRPLRAKHCSTCDRCVEQFDHHCPWVSNCVGKKNKW 414
Query: 421 DFFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIADFSLFF 480
+FFLFL+LEV AML+TG VT+ RV +DP APSSFGAWMS+ +++H+GALSFL+ +F LFF
Sbjct: 415 EFFLFLLLEVLAMLITGGVTLARVLSDPSAPSSFGAWMSHVASNHVGALSFLLVEFCLFF 474
Query: 481 GVAVLTAVQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKRNCSDFLINGFNE 540
VAVLT +QASQISRNITTNEMANALRY+YLRG GGRFRNPYD GC+RNCSDFL+ G+NE
Sbjct: 475 SVAVLTVIQASQISRNITTNEMANALRYSYLRGPGGRFRNPYDLGCRRNCSDFLVKGYNE 534
Query: 541 DVECVEDSAGT--EGIGMMHMSRNSNLQNGDGHIHHANGNGHVAIXXXXXXXXXXXXXXX 598
D+EC E+ A EGI MM M RN NLQNG NGHVAI
Sbjct: 535 DIECHEEDATQRPEGISMMQMQRNPNLQNG---------NGHVAIDVNPTHNSQSAHVHS 585
Query: 599 XXXXXXXXXGKSKTDSVPXXXXXXXXRSSARSVVA 633
KSK+D+VP R+ R VV+
Sbjct: 586 ANCSHSHNS-KSKSDNVPLGLGLGLSRNPTRPVVS 619
|
|
| TAIR|locus:1006230134 AT2G14255 "AT2G14255" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0029137 Patsas "Patsas" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070424-194 zdhhc17 "zinc finger, DHHC-type containing 17" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N9E7 ZDHHC17 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PRB8 ZDHHC17 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BJK1 ZDHHC17 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2445110 Zdhhc17 "zinc finger, DHHC domain containing 17" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0259824 Hip14 "Huntingtin-interacting protein 14" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4N0B3 MGG_07382 "Palmitoyltransferase AKR1" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 634 | |||
| pfam01529 | 167 | pfam01529, zf-DHHC, DHHC palmitoyltransferase | 1e-33 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 4e-32 | |
| COG5273 | 309 | COG5273, COG5273, Uncharacterized protein containi | 9e-30 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 8e-23 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 2e-17 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 1e-15 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 4e-14 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 8e-14 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 2e-13 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 5e-12 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 9e-12 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 2e-10 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 9e-10 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 1e-09 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 1e-08 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 2e-07 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 6e-07 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 7e-07 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 1e-06 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 1e-06 | |
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 2e-06 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 6e-06 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 9e-06 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 5e-05 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 7e-05 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 8e-05 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 1e-04 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 2e-04 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 2e-04 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 2e-04 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 3e-04 | |
| PHA02946 | 446 | PHA02946, PHA02946, ankyin-like protein; Provision | 3e-04 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 3e-04 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 6e-04 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 8e-04 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 9e-04 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 0.001 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 0.001 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 0.002 | |
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 0.002 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 0.002 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 0.003 | |
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 0.003 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 0.004 |
| >gnl|CDD|216554 pfam01529, zf-DHHC, DHHC palmitoyltransferase | Back alignment and domain information |
|---|
Score = 125 bits (316), Expect = 1e-33
Identities = 46/176 (26%), Positives = 82/176 (46%), Gaps = 12/176 (6%)
Query: 330 LVLFYRCSRKDPGYIRMNVHDPQNMKDDEPLLKIEMNNPALLAGNWSQLCATCKIVRPLR 389
L +++ DPGY+ P+N + E + + + + + C+TC I++P R
Sbjct: 1 LWSYFKTIFTDPGYV------PKNPTEKEQEKQPDEESEEGDEEDELKFCSTCNIIKPPR 54
Query: 390 AKHCSTCDRCVEQFDHHCPWVSNCIGKKN-KWDFFLFLVLEVSAMLVTGAVTVIRVFTDP 448
+ HC C+RCV +FDHHCPW++NCIG++N K+ F LFL+ +++ ++ +
Sbjct: 55 SHHCRVCNRCVLRFDHHCPWLNNCIGRRNHKY-FLLFLLYLTLYLILLLVLSFYYLVYLI 113
Query: 449 VAPSSFGAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQASQISRNITTNEMAN 504
F + ++ L+ ++ L I +NITT E
Sbjct: 114 RNIELFFFLILSL----FSSIILLVLSLFFLLFLSFLLFFHLYLILKNITTYEYIK 165
|
This family includes the well known DHHC zinc binding domain as well as three of the four conserved transmembrane regions found in this family of palmitoyltransferase enzymes. Length = 167 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227598 COG5273, COG5273, Uncharacterized protein containing DHHC-type Zn finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 634 | |||
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 100.0 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 100.0 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 100.0 | |
| KOG1314 | 414 | consensus DHHC-type Zn-finger protein [General fun | 100.0 | |
| KOG1311 | 299 | consensus DHHC-type Zn-finger proteins [General fu | 100.0 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 100.0 | |
| KOG1315 | 307 | consensus Predicted DHHC-type Zn-finger protein [G | 100.0 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 100.0 | |
| PF01529 | 174 | zf-DHHC: DHHC palmitoyltransferase; InterPro: IPR0 | 100.0 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 100.0 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 100.0 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 100.0 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 100.0 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 100.0 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 100.0 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 100.0 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.98 | |
| KOG1313 | 309 | consensus DHHC-type Zn-finger proteins [General fu | 99.98 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.97 | |
| COG5273 | 309 | Uncharacterized protein containing DHHC-type Zn fi | 99.97 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.97 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.97 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.97 | |
| KOG1312 | 341 | consensus DHHC-type Zn-finger proteins [General fu | 99.96 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.96 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.96 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.96 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.96 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.95 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.95 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.95 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.94 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.94 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.94 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.94 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.94 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.93 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.93 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.92 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.92 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.92 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.91 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.91 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.91 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.9 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.88 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.87 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.87 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.86 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.84 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.84 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.84 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.83 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.82 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.82 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.81 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.8 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.79 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.78 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.78 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.77 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.77 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.75 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.7 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.7 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.69 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.68 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.68 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.66 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.58 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.57 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.5 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.48 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.44 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.36 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.35 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.34 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.33 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.32 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.32 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.28 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.27 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.24 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.96 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.75 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.7 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.68 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.66 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.64 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.59 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.58 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.55 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.54 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 98.48 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.47 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.45 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.4 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.26 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.24 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.15 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 98.04 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 98.0 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 97.97 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.91 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 97.89 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.87 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.84 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.84 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.73 | |
| COG5273 | 309 | Uncharacterized protein containing DHHC-type Zn fi | 96.71 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 96.24 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.22 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.17 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 95.34 | |
| PF03158 | 192 | DUF249: Multigene family 530 protein; InterPro: IP | 94.26 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 93.78 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 93.54 | |
| PF01529 | 174 | zf-DHHC: DHHC palmitoyltransferase; InterPro: IPR0 | 91.68 | |
| PF03158 | 192 | DUF249: Multigene family 530 protein; InterPro: IP | 88.95 | |
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 88.47 | |
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 84.29 |
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.4e-75 Score=609.42 Aligned_cols=501 Identities=36% Similarity=0.559 Sum_probs=352.2
Q ss_pred CCCcchhhhhccccccCCCCCCCCCCCCCCcccccchhhHHHHHHHcCCHHHHHHHHhccCCCCcCCCCCCchHHHHHHH
Q 006702 1 MSSEIEVVEEVGQSSQNHHNHDQSSPSNGVVVDEESLRNDVYTAAAYGDLEKLQRLVECEGCSVSEPDGLGYYALQWAAL 80 (634)
Q Consensus 1 ~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~Aa~ 80 (634)
|+.++|+.+.... ........++.....+++.....++.|++.|+++.|+.|++.++.+++.+|.+|.|+|||||.
T Consensus 12 ~~~~~e~~~~~~~----~~~~~~~~~~~~~~~e~d~~~~~~v~A~q~G~l~~v~~lve~~g~~v~~~D~~g~tlLHWAAi 87 (600)
T KOG0509|consen 12 LSHEIEVVPLIMF----HLSPGVEGESSNLSFEEDSSLDDIVKATQYGELETVKELVESEGESVNNPDREGVTLLHWAAI 87 (600)
T ss_pred CCCCCcccccccc----ccCcccCCCCcccccccchhhhhhhhHhhcchHHHHHHHHhhcCcCCCCCCcCCccceeHHHH
Confidence 5666666666511 111122222333345788889999999999999999999997699999999999999999999
Q ss_pred cCCHHHHHHHHhcCCCCCCCC-CCCCcHHHHHHHhCCHHHHHHHHhcCCCCCccccCCChHHHHHHHhCCHHHHHHHHHc
Q 006702 81 NNRTAAAQYIIEHGGDVNAAD-HTGQTALHWSAVRGAIQVAELLLREGARVNAADMYGYQTTHVAAQYGQTAFLYHIVSK 159 (634)
Q Consensus 81 ~g~~~~v~~Ll~~gad~n~~~-~~g~tpLh~A~~~g~~~iv~~Ll~~gad~~~~d~~g~t~L~~Aa~~g~~~~v~~Ll~~ 159 (634)
+++.+++|+|+++|+|+|..+ .-+.||||||+++|+..+|++|+++|||++.+|.+|.+|+|+|++.|+..++.|||.+
T Consensus 88 NNrl~v~r~li~~gadvn~~gG~l~stPLHWAar~G~~~vv~lLlqhGAdpt~~D~~G~~~lHla~~~~~~~~vayll~~ 167 (600)
T KOG0509|consen 88 NNRLDVARYLISHGADVNAIGGVLGSTPLHWAARNGHISVVDLLLQHGADPTLKDKQGLTPLHLAAQFGHTALVAYLLSK 167 (600)
T ss_pred cCcHHHHHHHHHcCCCccccCCCCCCCcchHHHHcCcHHHHHHHHHcCCCCceecCCCCcHHHHHHHhCchHHHHHHHHh
Confidence 999999999999999999998 5789999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCCCCCCCCCChHHHHHHhcCCHHHHHHHhhcCCCCCCCC-CCCCcHHHHHHHcCCHHHHHHHHHcCCCCCccccCCC
Q 006702 160 WNADPDVPDNDGRSPLHWAAYKGFADCIRLLLFLDAYRGRQD-KEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNT 238 (634)
Q Consensus 160 ~~~~~~~~d~~g~t~Lh~A~~~g~~~~v~~Ll~~ga~~~~~d-~~g~TpLh~A~~~g~~~iv~~Ll~~g~~~d~~~~d~~ 238 (634)
++++|.+|.+|+||||||+++|+...++.|++.|+.+...| .+|+||||||+..||.+++++|++.| .+.+.+|.+
T Consensus 168 -~~d~d~~D~~grTpLmwAaykg~~~~v~~LL~f~a~~~~~d~~~g~TpLHwa~~~gN~~~v~Ll~~g~--~~~d~~~~~ 244 (600)
T KOG0509|consen 168 -GADIDLRDNNGRTPLMWAAYKGFALFVRRLLKFGASLLLTDDNHGNTPLHWAVVGGNLTAVKLLLEGG--ADLDKTNTN 244 (600)
T ss_pred -cccCCCcCCCCCCHHHHHHHhcccHHHHHHHHhcccccccccccCCchHHHHHhcCCcceEehhhhcC--CcccccccC
Confidence 79999999999999999999999988999999999999888 89999999999999999999666666 566788888
Q ss_pred CCCHHHHHHhcCcHHHHHHHHH-HHHHhcccCCCCCCcccccccCcchhHHHHHHHHHHHHHHh----------------
Q 006702 239 GLTPAQLASDKNHRQVAFFLGN-ARRLLDKRCDGNSPIGKISKLGLAPALWCVILLMLVTYMHS---------------- 301 (634)
Q Consensus 239 g~Tpl~~A~~~~~~~i~~~L~~-~~~l~~~~~~~~~~~~~~~~~g~~~l~~~~i~~~l~~y~~~---------------- 301 (634)
|+||+++|.++. ++..+.. ......+..+.... ........+.+ +++..|+..
T Consensus 245 g~tp~~LA~~~~---~~~~~~h~~~~~~~~~~~K~~~-----~~~~~~~~~f~--~~~~~~~~~~~~~g~i~~~~~~w~i 314 (600)
T KOG0509|consen 245 GKTPFDLAQERK---LVAALHHDVVERLGKVVKKWFL-----GSKLAALIFFI--FLGLFYFISSWLPGVIFLINSLWLI 314 (600)
T ss_pred CCCHHHHHHHhh---hHHHhhccHHHhhcccccchhh-----hhHHHHHHHHH--HHHHHHHHHhhccchhhhhhhHHHH
Confidence 999999998872 2222211 11111111000000 00111111111 111110000
Q ss_pred ---hhhhcc---------------CCccchhh--HHH-----HHH--------------HHHHHHHHHHHHHhhhccCCC
Q 006702 302 ---VIMASN---------------LPKLTAGF--GLL-----AWS--------------GVFLATGGLVLFYRCSRKDPG 342 (634)
Q Consensus 302 ---~i~~~~---------------~~~~~~~~--~~~-----~w~--------------~i~l~~~~l~~~~~~~~~dPG 342 (634)
.+...+ .+....+. ..+ .|+ .++..+..++.|.+...+|||
T Consensus 315 ~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fw~~~~w~~~i~~~~~~~~~~~~i~~~l~~~~~f~~~~rsDPg 394 (600)
T KOG0509|consen 315 KGLALGKLVLTCLCATRKIVGFLLRPPLLSGFFLSTLFWFYYFWFSKITPYTLFDFHYCFIISVLAYFITFGLFLRSDPG 394 (600)
T ss_pred hhhhhhhhhhheeccchhhccccccchhHHHHHHHHHHHHHHhhheeccchhhhhhHHHHHHHHHHHHHHHHHHhccCCC
Confidence 000000 00000000 011 111 112233445677788889999
Q ss_pred ccccCCCCCCCCCCchhhhhhhccCcchhccccc-ccccccccccCCCCCCCCcchhhhhccCCcCccccccccCCChHH
Q 006702 343 YIRMNVHDPQNMKDDEPLLKIEMNNPALLAGNWS-QLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGKKNKWD 421 (634)
Q Consensus 343 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~C~~C~~~kP~Rs~HC~~C~~CV~rfDHHCpwv~ncIG~~N~r~ 421 (634)
++|...... .+...... +..+.+.+ ++|.+|.++||.|||||++|||||.||||||||++||||.+|||+
T Consensus 395 ~i~~~~~~~-----~~tIs~l~----d~gkf~~en~FC~~clirKp~rSkhc~vcnrcVarfDHhCPwi~ncVG~kNh~~ 465 (600)
T KOG0509|consen 395 FIPTSTEVG-----RETISQLI----DFGKFDLENRFCLTCLIRKPLRSKHCSVCNRCVARFDHHCPWIGNCVGLKNHRL 465 (600)
T ss_pred CCCCchhhH-----HHHHHHhh----ccccccccccceeeeeeecCCccchhhhhHHHHhccccCCCccccccCccchHH
Confidence 998764322 11111110 11122234 699999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCCchhhhhhhccccchhhHHHHHHHH-------H------HHHHHH-HHH
Q 006702 422 FFLFLVLEVSAMLVTGAVTVIRVFTDPVAPSSFGAWMSYASTHHIGALSFLIADFS-------L------FFGVAV-LTA 487 (634)
Q Consensus 422 F~~fl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~------~~~~~~-l~~ 487 (634)
|+.|+++....+.++.+.+.+.+...... .. .|. ...+.+.++... + ..+... .-+
T Consensus 466 F~~Fl~~l~~~~~~~l~~~~~y~~~~~~~-~~--~~~-------~~l~~~~~~~~~~~~~~~~~~n~~~~~t~~~~~~~~ 535 (600)
T KOG0509|consen 466 FVFFLLTLLTVIVFYLYLCLYYIMNLENA-ST--IYV-------GFLIAVQAFRIPKPVTGNLLGNEDLNPTWGSTSTKC 535 (600)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHhhcchh-HH--HHH-------HHHHHHHHHhCCccceeeeeeccccccccccccccc
Confidence 99999887666655555554433221110 00 000 000000011000 0 011122 223
Q ss_pred HHHHHHhhcchhHHHHhhhhhhhhcCCCCCccCCCCHhHHhHHHHhcccC
Q 006702 488 VQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKRNCSDFLING 537 (634)
Q Consensus 488 ~~~~~i~~n~TT~E~~~~~r~~y~~~~~~~~~npyd~G~~~N~~~f~~~~ 537 (634)
.|...++.++||+|+++..||++++...+..++|++.|+.+|+.+||-..
T Consensus 536 ~~~~~~c~~~tt~e~~n~~r~~~~~~~~~~~~~~~s~g~~~Nl~df~~~~ 585 (600)
T KOG0509|consen 536 QHYNCACLHLTTNEQINVKRYEHLGIKRGPTRSPFSPGPIRNLVDFFLCS 585 (600)
T ss_pred cccceeeecccHHHHHHHHHhhccccccCcCCCCCCchhhhcchheeecc
Confidence 44456789999999999999999988888889999999999999999544
|
|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1314 consensus DHHC-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1311 consensus DHHC-type Zn-finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1315 consensus Predicted DHHC-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF01529 zf-DHHC: DHHC palmitoyltransferase; InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG1313 consensus DHHC-type Zn-finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >COG5273 Uncharacterized protein containing DHHC-type Zn finger [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1312 consensus DHHC-type Zn-finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG5273 Uncharacterized protein containing DHHC-type Zn finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >PF01529 zf-DHHC: DHHC palmitoyltransferase; InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 634 | ||||
| 3eu9_A | 240 | The Ankyrin Repeat Domain Of Huntingtin Interacting | 3e-23 | ||
| 3eu9_A | 240 | The Ankyrin Repeat Domain Of Huntingtin Interacting | 2e-07 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-21 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 4e-12 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 7e-21 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 7e-13 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-20 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 3e-16 | ||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 9e-20 | ||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 1e-10 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 5e-19 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 2e-11 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 7e-19 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 2e-11 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 9e-19 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 3e-17 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 9e-19 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 3e-12 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 3e-18 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 2e-17 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 2e-17 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 5e-12 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 7e-17 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 3e-07 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 8e-17 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 4e-12 | ||
| 1qym_A | 227 | X-Ray Structure Of Human Gankyrin Length = 227 | 9e-17 | ||
| 1qym_A | 227 | X-Ray Structure Of Human Gankyrin Length = 227 | 3e-07 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 1e-16 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 3e-15 | ||
| 3aji_A | 231 | Structure Of Gankyrin-S6atpase Photo-Cross-Linked S | 2e-16 | ||
| 3aji_A | 231 | Structure Of Gankyrin-S6atpase Photo-Cross-Linked S | 2e-06 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 2e-16 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 4e-13 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 3e-16 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 2e-06 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 5e-16 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 3e-13 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 1e-15 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 4e-11 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 1e-15 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 2e-10 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 1e-15 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 3e-12 | ||
| 1n11_A | 437 | D34 Region Of Human Ankyrin-R And Linker Length = 4 | 2e-15 | ||
| 1n11_A | 437 | D34 Region Of Human Ankyrin-R And Linker Length = 4 | 3e-15 | ||
| 3b7b_A | 237 | Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le | 3e-15 | ||
| 3b7b_A | 237 | Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le | 1e-12 | ||
| 3twq_A | 175 | Crystal Structure Of Arc4 From Human Tankyrase 2 (A | 5e-15 | ||
| 3twq_A | 175 | Crystal Structure Of Arc4 From Human Tankyrase 2 (A | 1e-06 | ||
| 3twr_A | 165 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 5e-15 | ||
| 3twr_A | 165 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 1e-06 | ||
| 3twu_A | 167 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 7e-15 | ||
| 3twu_A | 167 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 1e-06 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 7e-15 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 5e-13 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 7e-15 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 4e-12 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 2e-14 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 2e-11 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 3e-14 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 9e-12 | ||
| 1ot8_A | 239 | Structure Of The Ankyrin Domain Of The Drosophila N | 8e-14 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 9e-14 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 7e-13 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 1e-13 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 3e-13 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 1e-12 | ||
| 1s70_B | 299 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 1e-12 | ||
| 1yyh_A | 253 | Crystal Structure Of The Human Notch 1 Ankyrin Doma | 2e-11 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 2e-11 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 3e-11 | ||
| 3utm_A | 351 | Crystal Structure Of A Mouse Tankyrase-Axin Complex | 2e-11 | ||
| 3utm_A | 351 | Crystal Structure Of A Mouse Tankyrase-Axin Complex | 3e-05 | ||
| 2he0_A | 253 | Crystal Structure Of A Human Notch1 Ankyrin Domain | 2e-11 | ||
| 2f8x_K | 256 | Crystal Structure Of Activated Notch, Csl And Maml | 2e-11 | ||
| 2f8y_A | 223 | Crystal Structure Of Human Notch1 Ankyrin Repeats T | 3e-11 | ||
| 3hg0_D | 136 | Crystal Structure Of A Darpin In Complex With Orf49 | 6e-11 | ||
| 3hg0_D | 136 | Crystal Structure Of A Darpin In Complex With Orf49 | 3e-04 | ||
| 2qc9_A | 210 | Mouse Notch 1 Ankyrin Repeat Intracellular Domain L | 6e-11 | ||
| 1bi8_B | 166 | Mechanism Of G1 Cyclin Dependent Kinase Inhibition | 1e-10 | ||
| 1bi8_B | 166 | Mechanism Of G1 Cyclin Dependent Kinase Inhibition | 2e-10 | ||
| 1bd8_A | 156 | Structure Of Cdk Inhibitor P19ink4d Length = 156 | 1e-10 | ||
| 1bd8_A | 156 | Structure Of Cdk Inhibitor P19ink4d Length = 156 | 2e-10 | ||
| 1ap7_A | 168 | P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 | 6e-10 | ||
| 2rfa_A | 232 | Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat | 6e-10 | ||
| 1blx_B | 166 | P19ink4dCDK6 COMPLEX Length = 166 | 7e-10 | ||
| 2rfm_A | 192 | Structure Of A Thermophilic Ankyrin Repeat Protein | 7e-10 | ||
| 2rfm_A | 192 | Structure Of A Thermophilic Ankyrin Repeat Protein | 2e-04 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 1e-09 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 5e-07 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 2e-06 | ||
| 1wdy_A | 285 | Crystal Structure Of Ribonuclease Length = 285 | 2e-09 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 2e-09 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 1e-08 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 2e-09 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 4e-07 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 6e-06 | ||
| 4g8k_A | 337 | Intact Sensor Domain Of Human Rnase L In The Inacti | 2e-09 | ||
| 2xzd_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4 | 4e-09 | ||
| 2xzd_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4 | 5e-09 | ||
| 2xzd_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4 | 8e-06 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 7e-09 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 1e-08 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 6e-06 | ||
| 2jab_A | 136 | A Designed Ankyrin Repeat Protein Evolved To Picomo | 2e-08 | ||
| 2jab_A | 136 | A Designed Ankyrin Repeat Protein Evolved To Picomo | 6e-08 | ||
| 2jab_A | 136 | A Designed Ankyrin Repeat Protein Evolved To Picomo | 3e-04 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 6e-08 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 8e-07 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 6e-04 | ||
| 3v30_A | 172 | Crystal Structure Of The Peptide Bound Complex Of T | 6e-08 | ||
| 3c5r_A | 137 | Crystal Structure Of The Bard1 Ankyrin Repeat Domai | 8e-08 | ||
| 3c5r_A | 137 | Crystal Structure Of The Bard1 Ankyrin Repeat Domai | 3e-05 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 1e-07 | ||
| 3uxg_A | 172 | Crystal Structure Of Rfxank Length = 172 | 4e-07 | ||
| 2kbx_A | 171 | Solution Structure Of Ilk-Pinch Complex Length = 17 | 2e-06 | ||
| 3f6q_A | 179 | Crystal Structure Of Integrin-Linked Kinase Ankyrin | 2e-06 | ||
| 1mx4_A | 168 | Structure Of P18ink4c (F82q) Length = 168 | 3e-06 | ||
| 4b93_B | 269 | Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri | 3e-06 | ||
| 4b93_B | 269 | Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri | 2e-05 | ||
| 1mx2_A | 168 | Structure Of F71n Mutant Of P18ink4c Length = 168 | 5e-06 | ||
| 2xen_A | 91 | Structural Determinants For Improved Thermal Stabil | 6e-06 | ||
| 2xen_A | 91 | Structural Determinants For Improved Thermal Stabil | 1e-04 | ||
| 2dzn_A | 228 | Crystal Structure Analysis Of Yeast Nas6p Complexed | 7e-06 | ||
| 2dzn_A | 228 | Crystal Structure Analysis Of Yeast Nas6p Complexed | 9e-06 | ||
| 1ixv_A | 231 | Crystal Structure Analysis Of Homolog Of Oncoprotei | 7e-06 | ||
| 1ixv_A | 231 | Crystal Structure Analysis Of Homolog Of Oncoprotei | 9e-06 | ||
| 1wg0_A | 243 | Structural Comparison Of Nas6p Protein Structures I | 9e-06 | ||
| 1wg0_A | 243 | Structural Comparison Of Nas6p Protein Structures I | 1e-05 | ||
| 1bu9_A | 168 | Solution Structure Of P18-Ink4c, 21 Structures Leng | 1e-05 | ||
| 1ihb_A | 162 | Crystal Structure Of P18-Ink4c(Ink6) Length = 162 | 1e-05 | ||
| 4hbd_A | 276 | Crystal Structure Of Kank2 Ankyrin Repeats Length = | 1e-05 | ||
| 2fo1_E | 373 | Crystal Structure Of The Csl-Notch-Mastermind Terna | 2e-05 | ||
| 1awc_B | 153 | Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 | 2e-05 | ||
| 1awc_B | 153 | Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 | 8e-05 | ||
| 4a63_B | 239 | Crystal Structure Of The P73-Aspp2 Complex At 2.6a | 2e-05 | ||
| 4a63_B | 239 | Crystal Structure Of The P73-Aspp2 Complex At 2.6a | 9e-05 | ||
| 1ycs_B | 239 | P53-53bp2 Complex Length = 239 | 2e-05 | ||
| 1ycs_B | 239 | P53-53bp2 Complex Length = 239 | 1e-04 | ||
| 3so8_A | 162 | Crystal Structure Of Ankra Length = 162 | 3e-05 | ||
| 3so8_A | 162 | Crystal Structure Of Ankra Length = 162 | 8e-05 | ||
| 1mx6_A | 168 | Structure Of P18ink4c (F92n) Length = 168 | 3e-05 | ||
| 1mx6_A | 168 | Structure Of P18ink4c (F92n) Length = 168 | 3e-05 | ||
| 3v2o_A | 183 | Crystal Structure Of The Peptide Bound Complex Of T | 3e-05 | ||
| 3v2o_A | 183 | Crystal Structure Of The Peptide Bound Complex Of T | 6e-05 | ||
| 3v2x_A | 167 | Crystal Structure Of The Peptide Bound Complex Of T | 3e-05 | ||
| 3v2x_A | 167 | Crystal Structure Of The Peptide Bound Complex Of T | 8e-05 | ||
| 3hra_A | 201 | Crystal Structure Of Ef0377 An Ankyrin Repeat Prote | 5e-05 | ||
| 1k1b_A | 241 | Crystal Structure Of The Ankyrin Repeat Domain Of B | 6e-05 | ||
| 2zgg_A | 92 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 6e-05 | ||
| 2zgg_A | 92 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 4e-04 | ||
| 1d9s_A | 136 | Tumor Suppressor P15(Ink4b) Structure By Comparativ | 2e-04 | ||
| 1myo_A | 118 | Solution Structure Of Myotrophin, Nmr, 44 Structure | 2e-04 | ||
| 2zgd_A | 110 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 3e-04 | ||
| 3jue_A | 368 | Crystal Structure Of Arfgap And Ank Repeat Domain O | 3e-04 | ||
| 1bi7_B | 156 | Mechanism Of G1 Cyclin Dependent Kinase Inhibition | 4e-04 | ||
| 4f1p_A | 368 | Crystal Structure Of Mutant S554d For Arfgap And An | 4e-04 | ||
| 3t9k_A | 390 | Crystal Structure Of Acap1 C-portion Mutant S554d F | 4e-04 | ||
| 3aaa_C | 123 | Crystal Structure Of Actin Capping Protein In Compl | 6e-04 | ||
| 1nfi_E | 213 | I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 | 6e-04 |
| >pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 | Back alignment and structure |
|
| >pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 | Back alignment and structure |
| >pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 | Back alignment and structure |
| >pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 | Back alignment and structure |
| >pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 | Back alignment and structure |
| >pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 | Back alignment and structure |
| >pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 | Back alignment and structure |
| >pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 | Back alignment and structure |
| >pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 | Back alignment and structure |
| >pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 | Back alignment and structure |
| >pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 | Back alignment and structure |
| >pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 | Back alignment and structure |
| >pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 | Back alignment and structure |
| >pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 | Back alignment and structure |
| >pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 | Back alignment and structure |
| >pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 | Back alignment and structure |
| >pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 | Back alignment and structure |
| >pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 | Back alignment and structure |
| >pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 | Back alignment and structure |
| >pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 | Back alignment and structure |
| >pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 | Back alignment and structure |
| >pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 | Back alignment and structure |
| >pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 | Back alignment and structure |
| >pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 | Back alignment and structure |
| >pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 | Back alignment and structure |
| >pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 | Back alignment and structure |
| >pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 | Back alignment and structure |
| >pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 | Back alignment and structure |
| >pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 | Back alignment and structure |
| >pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 | Back alignment and structure |
| >pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 | Back alignment and structure |
| >pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 | Back alignment and structure |
| >pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 | Back alignment and structure |
| >pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 | Back alignment and structure |
| >pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 | Back alignment and structure |
| >pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 | Back alignment and structure |
| >pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 | Back alignment and structure |
| >pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 | Back alignment and structure |
| >pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 | Back alignment and structure |
| >pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 | Back alignment and structure |
| >pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 | Back alignment and structure |
| >pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 | Back alignment and structure |
| >pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 | Back alignment and structure |
| >pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 | Back alignment and structure |
| >pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 | Back alignment and structure |
| >pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 | Back alignment and structure |
| >pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 | Back alignment and structure |
| >pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 | Back alignment and structure |
| >pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 | Back alignment and structure |
| >pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 | Back alignment and structure |
| >pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 | Back alignment and structure |
| >pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 | Back alignment and structure |
| >pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 | Back alignment and structure |
| >pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 | Back alignment and structure |
| >pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 | Back alignment and structure |
| >pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 | Back alignment and structure |
| >pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 | Back alignment and structure |
| >pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 | Back alignment and structure |
| >pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 | Back alignment and structure |
| >pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 | Back alignment and structure |
| >pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 | Back alignment and structure |
| >pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 | Back alignment and structure |
| >pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 | Back alignment and structure |
| >pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 | Back alignment and structure |
| >pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 | Back alignment and structure |
| >pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 | Back alignment and structure |
| >pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 | Back alignment and structure |
| >pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 | Back alignment and structure |
| >pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 | Back alignment and structure |
| >pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 | Back alignment and structure |
| >pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 | Back alignment and structure |
| >pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 | Back alignment and structure |
| >pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 | Back alignment and structure |
| >pdb|1D9S|A Chain A, Tumor Suppressor P15(Ink4b) Structure By Comparative Modeling And Nmr Data Length = 136 | Back alignment and structure |
| >pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 | Back alignment and structure |
| >pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 | Back alignment and structure |
| >pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 | Back alignment and structure |
| >pdb|1BI7|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structure Of The Cdk6-P16ink4a Tumor Suppressor Complex Length = 156 | Back alignment and structure |
| >pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 | Back alignment and structure |
| >pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 | Back alignment and structure |
| >pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 | Back alignment and structure |
| >pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 634 | |||
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-50 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-40 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 1e-39 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 1e-13 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 8e-49 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-48 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 3e-43 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 6e-46 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 6e-43 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-40 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 5e-34 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-18 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 5e-15 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 3e-44 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 5e-40 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 1e-36 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 3e-30 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-29 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 1e-14 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 3e-44 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 5e-39 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-37 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 6e-28 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 4e-22 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 8e-15 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 9e-44 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 4e-42 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 3e-36 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 2e-28 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 1e-13 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-43 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 4e-38 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 4e-35 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 6e-22 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 6e-16 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 2e-43 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-42 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 9e-40 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 9e-35 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 8e-31 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 3e-30 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-42 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 7e-35 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 4e-34 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-24 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 1e-41 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 6e-34 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 3e-41 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 6e-39 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 2e-28 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 4e-41 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-40 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-36 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 8e-36 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-31 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-16 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 7e-41 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 4e-36 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 3e-31 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-25 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 1e-19 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-40 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-33 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 7e-33 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 5e-14 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 6e-07 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 2e-40 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 1e-36 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 1e-34 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 5e-28 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 4e-12 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 2e-40 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 1e-38 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 6e-30 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 5e-08 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 5e-40 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-35 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 4e-35 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 6e-35 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-29 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-28 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-23 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-22 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 6e-40 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 6e-38 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 8e-28 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 7e-13 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 4e-12 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 8e-40 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 4e-35 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-17 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 3e-16 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-39 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 5e-39 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-34 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 9e-29 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 3e-25 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 7e-25 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 5e-39 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 3e-38 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 3e-28 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 8e-07 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 2e-38 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 5e-35 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 1e-37 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-37 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 3e-34 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 4e-37 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 5e-33 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 5e-32 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 6e-23 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-16 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 8e-37 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 3e-34 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-24 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 9e-37 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 3e-32 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-18 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-09 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 5e-36 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 5e-24 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 6e-24 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 5e-15 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 9e-36 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 2e-29 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 5e-13 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 4e-35 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 5e-31 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 4e-35 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-34 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 8e-21 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 1e-34 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 3e-30 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 6e-15 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 1e-13 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 9e-34 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 2e-13 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 3e-33 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 4e-30 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 2e-16 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 4e-32 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 1e-31 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 4e-24 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 4e-32 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 4e-15 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 7e-32 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 2e-26 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-10 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 3e-05 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 2e-31 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 6e-27 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 3e-09 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 1e-05 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 7e-31 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 2e-24 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 3e-24 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 2e-16 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 6e-16 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 8e-30 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 1e-29 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 6e-22 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 4e-13 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 1e-09 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 7e-29 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 9e-22 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 3e-15 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 1e-28 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 6e-25 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 7e-22 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 9e-17 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-11 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 6e-09 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 3e-28 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 1e-19 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 2e-08 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 2e-27 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 6e-26 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 5e-14 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 2e-13 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 5e-25 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 1e-24 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 1e-22 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 7e-10 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 7e-25 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 1e-19 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 3e-17 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 6e-23 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 4e-17 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 6e-07 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 2e-22 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 3e-19 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 4e-17 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 4e-11 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 9e-22 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 5e-20 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 8e-17 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 3e-16 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 4e-11 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 4e-11 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 2e-10 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 6e-11 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 3e-10 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 9e-10 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 7e-11 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 7e-11 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 1e-10 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 1e-09 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 6e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 |
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
Score = 173 bits (442), Expect = 2e-50
Identities = 70/220 (31%), Positives = 108/220 (49%), Gaps = 7/220 (3%)
Query: 42 YTAAAYGDLEKLQRLVECEGCSVSEPDGLGYYALQWAALNNRTAAAQYIIEHGGDVNAAD 101
A YG E+ + LVE G V +PD L WAA+NNR +Y I G V+
Sbjct: 14 VKATQYGIYERCRELVEA-GYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLG 72
Query: 102 H-TGQTALHWSAVRGAIQVAELLLREGARVNAADMYGYQTTHVAAQYGQTAFLYHIVSKW 160
T LHW+ +G + + L++ GA + D G H+AAQ+G T+ + ++++K
Sbjct: 73 GDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAK- 131
Query: 161 NADPDVPDNDGRSPLHWAAYKGF-ADCIRLLLFLDAYRGRQDK-EGCTPLHWAAIRGNLE 218
D D+ D +G +PL WAAY+ D RLLL + DK T LHWA + GN
Sbjct: 132 GQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTT 191
Query: 219 ACTVLVQAGKKEDLMVTDNTGLTPAQLASDKNHRQVAFFL 258
++L++AG ++ + G + LA + + + L
Sbjct: 192 VISLLLEAGA--NVDAQNIKGESALDLAKQRKNVWMINHL 229
|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 634 | |||
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 100.0 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 100.0 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 100.0 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 100.0 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 100.0 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 100.0 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 100.0 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 100.0 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 100.0 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 100.0 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 100.0 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 100.0 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 100.0 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 100.0 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 100.0 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 100.0 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 100.0 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 100.0 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 100.0 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 100.0 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 100.0 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 100.0 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 100.0 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 100.0 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 100.0 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 100.0 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 100.0 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 100.0 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 100.0 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 100.0 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 100.0 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 100.0 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 100.0 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 100.0 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 100.0 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 100.0 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 100.0 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 100.0 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 100.0 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 100.0 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 100.0 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 100.0 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 100.0 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 100.0 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.98 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.98 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.97 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.97 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.97 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.97 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.97 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.97 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.97 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.97 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.97 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.96 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.96 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.96 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.96 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.96 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.96 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.96 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.96 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.96 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.96 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.96 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.96 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.95 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.95 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.95 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.95 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.95 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.95 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.94 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.93 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.93 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.93 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.93 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.93 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.92 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.92 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.91 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.91 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.9 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.9 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.9 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.89 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.89 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.89 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.88 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.88 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.88 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.87 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.87 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.87 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.87 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.86 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.86 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.83 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.83 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.83 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.82 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.82 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.81 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.81 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.79 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.78 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.77 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.7 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.67 |
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.5e-39 Score=325.38 Aligned_cols=228 Identities=28% Similarity=0.349 Sum_probs=185.7
Q ss_pred CcccccchhhHHHHHHHcC-------------CHHHHHHHHhccCCCCcC-CCCCCchHHHHHHHcCCHHHHHHHHhcCC
Q 006702 30 VVVDEESLRNDVYTAAAYG-------------DLEKLQRLVECEGCSVSE-PDGLGYYALQWAALNNRTAAAQYIIEHGG 95 (634)
Q Consensus 30 ~~~~~~~~~~~L~~Aa~~g-------------~~~~v~~Ll~~~~~~~~~-~d~~g~t~Lh~Aa~~g~~~~v~~Ll~~ga 95 (634)
++..++.+.||||.|+..| +.++++.|++ .|.+++. .|..|.||||+|+..|+.+++++|+++|+
T Consensus 3 vn~~d~~g~tpL~~A~~~g~~~~~~~~~~~~~~~~~v~~Ll~-~g~~~~~~~d~~g~t~L~~A~~~g~~~~v~~Ll~~g~ 81 (253)
T 1yyh_A 3 VNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIY-QGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASA 81 (253)
T ss_dssp --------------------------------------------------CCCTTSCCHHHHHHHTTCHHHHHHHHHTTC
T ss_pred CCCCCCCCCcHHHHHHhccccccccchhhcCCChHHHHHHHH-ccCCcccccCCCCCcHHHHHHHcCCHHHHHHHHHcCC
Confidence 3456788999999999987 8999999998 6777654 58999999999999999999999999999
Q ss_pred CCCCCCCCCCcHHHHHHHhCCHHHHHHHHhcCC-CCCccccCCChHHHHHHHhCCHHHHHHHHHccCCCCCCCCCCCChH
Q 006702 96 DVNAADHTGQTALHWSAVRGAIQVAELLLREGA-RVNAADMYGYQTTHVAAQYGQTAFLYHIVSKWNADPDVPDNDGRSP 174 (634)
Q Consensus 96 d~n~~~~~g~tpLh~A~~~g~~~iv~~Ll~~ga-d~~~~d~~g~t~L~~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~g~t~ 174 (634)
+++.+|..|.||||+|+..|+.+++++|+++|+ +++.++..|.||||+|+..|+.+++++|++. |++++.+|..|.||
T Consensus 82 ~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~-g~~~~~~d~~g~t~ 160 (253)
T 1yyh_A 82 DANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINS-HADVNAVDDLGKSA 160 (253)
T ss_dssp CTTCCCTTSCCHHHHHHHHTCHHHHHHHHHSTTSCTTCCCTTCCCHHHHHHHHTCSSHHHHHHHT-TCCTTCBCTTSCBH
T ss_pred CCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCccccCCCCCcHHHHHHHcChHHHHHHHHHc-CCCCCCcCCCCCCH
Confidence 999999999999999999999999999999998 8999999999999999999999999999997 99999999999999
Q ss_pred HHHHHhcCCHHHHHHHhhcCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCccccCCCCCCHHHHHHhcCcHHH
Q 006702 175 LHWAAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGLTPAQLASDKNHRQV 254 (634)
Q Consensus 175 Lh~A~~~g~~~~v~~Ll~~ga~~~~~d~~g~TpLh~A~~~g~~~iv~~Ll~~g~~~d~~~~d~~g~Tpl~~A~~~~~~~i 254 (634)
||+|+..|+.+++++|++.|++++.+|..|.||||+|+..|+.+++++|+++| ++++.+|..|+||+++|+++|+.++
T Consensus 161 L~~A~~~~~~~~v~~Ll~~ga~~~~~~~~g~tpL~~A~~~~~~~~v~~Ll~~g--a~~~~~d~~g~tpl~~A~~~g~~~i 238 (253)
T 1yyh_A 161 LHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHF--ANRDITDHMDRLPRDIAQERMHHDI 238 (253)
T ss_dssp HHHHHHHTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHHTCHHHHHHHHHTT--CCTTCCCTTCCCHHHHHHHTTCHHH
T ss_pred HHHHHHcCCHHHHHHHHHcCCCCCCcCCCCCCHHHHHHHCCCHHHHHHHHHcC--CCccccccCCCCHHHHHHHcCCHHH
Confidence 99999999999999999999999999999999999999999999999999999 6788999999999999999999999
Q ss_pred HHHHHHH
Q 006702 255 AFFLGNA 261 (634)
Q Consensus 255 ~~~L~~~ 261 (634)
+++|...
T Consensus 239 ~~~l~~~ 245 (253)
T 1yyh_A 239 VRLLDLE 245 (253)
T ss_dssp HHHHHC-
T ss_pred HHHHHHH
Confidence 9998643
|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 634 | ||||
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-31 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-25 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 9e-25 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-24 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 7e-20 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 7e-27 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 1e-22 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 5e-18 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 3e-16 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-12 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 7e-10 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 7e-07 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 7e-21 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 8e-18 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 1e-15 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 1e-09 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 2e-08 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 9e-21 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 3e-20 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 3e-13 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 2e-09 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 6e-20 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 1e-11 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 2e-06 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 9e-04 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-15 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 3e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 1e-14 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 5e-12 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 5e-10 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 8e-09 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 4e-07 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 3e-14 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 1e-11 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-13 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 7e-12 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 0.001 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 4e-13 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 7e-07 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 8e-07 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 5e-06 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 1e-04 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 7e-04 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 1e-12 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 6e-06 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 2e-04 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 0.002 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 1e-11 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 3e-09 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 4e-07 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 2e-10 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 2e-07 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 5e-10 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 6e-09 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 6e-08 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 7e-09 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 6e-04 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 3e-07 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 1e-05 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 8e-07 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 6e-06 | |
| d1myoa_ | 118 | d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) | 3e-04 | |
| d1myoa_ | 118 | d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) | 0.002 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Score = 123 bits (310), Expect = 4e-31
Identities = 60/215 (27%), Positives = 86/215 (40%), Gaps = 4/215 (1%)
Query: 44 AAAYGDLEKLQRLVECEGCSVSEPDGLGYYALQWAALNNRTAAAQYIIEHGGDVNAADHT 103
A+ G L ++ L++ G S + + L AA T A+Y++++ VNA
Sbjct: 7 ASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKD 65
Query: 104 GQTALHWSAVRGAIQVAELLLREGARVNAADMYGYQTTHVAAQYGQTAFLYHIVSKWNAD 163
QT LH +A G + +LLL A N T A + + A
Sbjct: 66 DQTPLHCAARIGHTNMVKLLLENNANPN-LATTAGHTPLHIAAREGHVETVLALLEKEAS 124
Query: 164 PDVPDNDGRSPLHWAAYKGFADCIRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVL 223
G +PLH AA G LLL DA+ K G TPLH A NL+ +L
Sbjct: 125 QACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL 184
Query: 224 VQAGKKEDLMVTDNTGLTPAQLASDKNHRQVAFFL 258
+ G G TP +A+ +N +VA L
Sbjct: 185 LPRGG--SPHSPAWNGYTPLHIAAKQNQVEVARSL 217
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 634 | |||
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 100.0 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 100.0 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 100.0 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.98 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.97 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.97 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.96 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.96 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.96 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.96 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.96 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.96 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.95 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.94 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.94 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.94 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.94 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.93 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.93 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.93 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.93 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.93 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.91 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.89 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.89 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.88 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.88 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.87 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.85 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.85 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.82 |
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=9.8e-37 Score=298.38 Aligned_cols=219 Identities=28% Similarity=0.390 Sum_probs=210.0
Q ss_pred hhHHHHHHHcCCHHHHHHHHhccCCCCcCCCCCCchHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCcHHHHHHHhCCH
Q 006702 38 RNDVYTAAAYGDLEKLQRLVECEGCSVSEPDGLGYYALQWAALNNRTAAAQYIIEHGGDVNAADHTGQTALHWSAVRGAI 117 (634)
Q Consensus 38 ~~~L~~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~Aa~~g~~~~v~~Ll~~gad~n~~~~~g~tpLh~A~~~g~~ 117 (634)
.+.|+.+|..|+++.++.+|+..+.+++.+|..|+||||+||..|+.+++++|++.+.+....+..+.++++.|+..|+.
T Consensus 4 ~~~~~~~a~~G~~~~v~~~l~~~~~~~~~~D~~G~TpLh~Aa~~g~~e~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~ 83 (223)
T d1uoha_ 4 NLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRD 83 (223)
T ss_dssp SSHHHHHHHTTCHHHHHHHHHHCGGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCSCCCCTTCCCHHHHHHHHTCH
T ss_pred HHHHHHHHHhCCHHHHHHHHHhCCCcCcCcCCCCCCHHHHHHHhhhhccccccccccccccccccccccccccccccccc
Confidence 56789999999999999999988899999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhcCCCCCccccCCChHHHHHHHhCCHHHHHHHHHccCCCCCCCCCCCChHHHHHHhcCCHHHHHHHhhcCCCC
Q 006702 118 QVAELLLREGARVNAADMYGYQTTHVAAQYGQTAFLYHIVSKWNADPDVPDNDGRSPLHWAAYKGFADCIRLLLFLDAYR 197 (634)
Q Consensus 118 ~iv~~Ll~~gad~~~~d~~g~t~L~~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~g~~~~v~~Ll~~ga~~ 197 (634)
+++++|+++|++++.+|..|.||||+|+..|+.+++++|++. |++++.+|..|.||||+|+..++.+++++|++.+.++
T Consensus 84 ~i~~~Ll~~~~d~~~~d~~g~tpL~~A~~~~~~e~~~~Ll~~-g~d~~~~~~~~~t~L~~a~~~~~~~~~~~L~~~~~~i 162 (223)
T d1uoha_ 84 EIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEG-GANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKAST 162 (223)
T ss_dssp HHHHHHHHTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHT-TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCS
T ss_pred chhHHHhccCceeEeeCCCCCchhhHHHHcCCHHHHHHHHHC-CCCCCCcCCCCCccchhhhhcCCcchhhhhcccccee
Confidence 999999999999999999999999999999999999999987 9999999999999999999999999999999999999
Q ss_pred CCCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCccccCCCCCCHHHHHHhcCcHHHHHHHHH
Q 006702 198 GRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTDNTGLTPAQLASDKNHRQVAFFLGN 260 (634)
Q Consensus 198 ~~~d~~g~TpLh~A~~~g~~~iv~~Ll~~g~~~d~~~~d~~g~Tpl~~A~~~~~~~i~~~L~~ 260 (634)
+.+|..|+||||+|+..|+.++|++|+++| +|++.+|.+|+||||+| ..++.+++++|.+
T Consensus 163 ~~~d~~g~TpL~~Aa~~g~~~~v~~LL~~G--ad~~~~d~~g~tpl~~A-~~~~~~i~~~Ll~ 222 (223)
T d1uoha_ 163 NIQDTEGNTPLHLACDEERVEEAKLLVSQG--ASIYIENKEEKTPLQVA-KGGLGLILKRMVE 222 (223)
T ss_dssp CCCCTTCCCHHHHHHHTTCHHHHHHHHHTT--CCSCCCCTTSCCHHHHC-CTTHHHHHHHHHC
T ss_pred eeccCCCCceeccccccCcHHHHHHHHHCC--CCCCCCCCCCCCHHHHH-HCCCHHHHhcccC
Confidence 999999999999999999999999999999 67889999999999998 5799999988753
|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|