Citrus Sinensis ID: 006751

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630--

MSPASKSKSKPSGKASKEQQKAPIKPSGSANAGNGVPASAYNPISGTFHTLDTSSVATSPPYHDNGRFRNIDDTDEHSSRPHGTVSEYDSVSNNGSCSGESEDPKEKFANSSRQDPIPGSDNDRREKIRLKNEKKHQRQREKRAQELHERCCGYLMSRKLEALSQQLVAMGFSSERATLALMLNEGRVEESVNWLFEVSEEEARNTDPKLESSGSLKIDISEELARISEIELRYKCSKQEVERAVVASEGDLDKAEDTIKVQKQELPATPPRPDDTADTKSMVRPQEKLLAPITIQQRRNERDFNYTKAAATVPITFTETGSRNLLSPVPNQSKLLADKRWAASGSSASASLTATAHMPLVSPSKVEVRQAVAGNEGKTIQQVREPVIVMQRPQSMNAKQIPASSAASSPQVTAGWYAKNVPAVENVRPNAKILQGTGTRGTENQSSELFYRQAPYKEIPYMHNPVESISAGLGSSWSSMGSSSPSLTAPSKSRGSWSTMGMSSPSLAVPSSLGLFASWGSAGTLGSSSHVDWNTGGLMPECDYTSIDWTLDTSTSLSSSPKPNGLWFGISSLLRNSPGMRMGGANGTCMSGLQDNGAVTEASSAGGLREWTSPFAEKDIFSVPRQFVTSPP

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHcccHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

cccccccccccHHHcccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHcccHHHccccccccccccccEEcHHHHHHHHHHHEEEccccHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccEEEEEEEcccHHHHHccccccEEEEEcccccccccccccccccccccccccccccccccccccccccEccccccccccccccHccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

mspaskskskpsgkaskeqqkapikpsgsanagngvpasaynpisgtfhtldtssvatsppyhdngrfrniddtdehssrphgtvseydsvsnngscsgesedpkekfanssrqdpipgsdndrrEKIRLKNEKKHQRQREKRAQELHERCCGYLMSRKLEALSQQLVAMGFSSERATLALMLNEGRVEESVNWLFEVseeearntdpklessgslkidISEELARISEIELRYKCSKQEVERAVVAsegdldkaEDTIKVQKqelpatpprpddtadtksmvrpqekllapitiqqrrnerdfnytkaaatvpitftetgsrnllspvpnqsklladkrwaasgssasasltatahmplvspskvEVRQAvagnegktiqqvrepvivmqrpqsmnakqipassaasspqvtagwyaknvpavenvrpnakilqgtgtrgtenqsselfyrqapykeipymhnpvesisaglgsswssmgssspsltapsksrgswstmgmsspslavpsslglfaswgsagtlgssshvdwntgglmpecdytsidwtldtstslssspkpnglwfGISSllrnspgmrmggangtcmsglqdngavteassagglrewtspfaekdifsvprqfvtspp

mspaskskskpsgkaskeqqkapikpsgsanagngVPASAYNPISGTFHTLDTSSVATSPPYHDNGRFRNIDDTDEHSSrphgtvseydsvsnNGSCSgesedpkekfanssrqdpipgsdndrrekirlknekkhqrqrekraqELHERCCGYLMSRKLEALSQQLVAMGFSSERATLALMLNEGRVEESVNWLFEVseeearntdpklessgslkidiseELARISEIELRYKCSKQEVERAVVasegdldkaedtikvqkqelpatpprpddtadtksmvrpqekllapitiqqrrnerdfnytkAAATVPItftetgsrnllspVPNQSKLLADKRWAASGSSASASLTATAHMPLVSPSKVEVRQAVagnegktiqqvrepVIVMQRPQSMNAKQIPASSAASSPQVTAGWYAKNvpavenvrpnakilqgtgtrgtenqsSELFYRQAPYKEIPYMHNPVESISAGLGSSWSSMGSSSPSLTAPSKSRGSWSTMGMSSPSLAVPSSLGLFASWGSAGTLGSSSHVDWNTGGLMPECDYTSIDWTLDTSTslssspkpngLWFGISSLLRNSPGMRMGGANGTCMSGLQDNGAVTEASSAGGlrewtspfaekdifsvprqfvtspp

MspaskskskpsgkaskEQQKAPIKPSGSANAGNGVPASAYNPISGTFHTLDTSSVATSPPYHDNGRFRNIDDTDEHSSRPHGTVSEYDSVSNNGSCSGESEDPKEKFANSSRQDPIPGSDNDRREKIRLKNEKKHQRQREKRAQELHERCCGYLMSRKLEALSQQLVAMGFSSERATLALMLNEGRVEESVNWLFEVSEEEARNTDPKLESSGSLKIDISEELARISEIELRYKCSKQEVERAVVASEGDLDKAEDTIKVQKQELpatpprpddtadtKSMVRPQEKLLAPITIQQRRNERDFNYTKAAATVPITFTETGSRNLLSPVPNQSKLLADKRWaasgssasasltataHMPLVSPSKVEVRQAVAGNEGKTIQQVREPVIVMQRPQSMNAKQIPassaassPQVTAGWYAKNVPAVENVRPNAKILQGTGTRGTENQSSELFYRQAPYKEIPYMHNPVEsisaglgsswssmgssspsltapsksRGSWSTMGMSSPSLAVPSSLGLFASWGSAGTLGSSSHVDWNTGGLMPECDYtsidwtldtstslsssPKPNGLWFGISSLLRNSPGMRMGGANGTCMSGLQDNGAVTEASSAGGLREWTSPFAEKDIFSVPRQFVTSPP

****************************************************************************************************************************************************ERCCGYLMSRKLEALSQQLVAMGFSSERATLALMLNEGRVEESVNWLFEV*************************LARISEIELRYKC******************************************************************DFNYTKAAATVPITFTE*********************************************************************************************TAGWYAKNVPAVENV**********************FYRQAPYKEIPYM**************************************************LGLFASWGSAGTLGSSSHVDWNTGGLMPECDYTSIDWTLDT***********GLWFGISSLL**********************************************************

***************************************AYNPISGTFHTLDT************************************************************************************************RCCGYLMSRKLEALSQQLVAMGFSSERATLALMLNEGRVEESVNWLFE********************IDISEELARISEIELRYKCSKQEVERAVVASEGDLDKA**********************************************************************************************************************************************************************************************************************************************************************************************CDYTSIDW****************************************************************PFAEKDIFSVPRQFV****

********************************GNGVPASAYNPISGTFHTLDTSSVATSPPYHDNGRFRNIDDT********************************************GSDNDRREKIRLKN**************LHERCCGYLMSRKLEALSQQLVAMGFSSERATLALMLNEGRVEESVNWLFEVS**************GSLKIDISEELARISEIELRYKCSKQEVERAVVASEGDLDKAEDTIKVQKQELPATPPRPDDTADTKSMVRPQEKLLAPITIQQRRNERDFNYTKAAATVPITFTETGSRNLLSPVPNQSKLLADK***********SLTATAHMPLVSPSKVEVRQAVAGNEGKTIQQVREPVIVMQRP*******************TAGWYAKNVPAVENVRPNAKILQGTGTRGTENQSSELFYRQAPYKEIPYMHNPVESISAGL*******************************PSLAVPSSLGLFASWGSAGTLGSSSHVDWNTGGLMPECDYTSIDWTLDT********KPNGLWFGISSLLRNSPGMRMGGANGTCMSGLQDNGAVTEASSAGGLREWTSPFAEKDIFSVPRQFVTSPP

****************************************YNPISGTFHTLDT*****************************************************************GSDNDRREKIRLKNEKKHQRQREKRAQELHERCCGYLMSRKLEALSQQLVAMGFSSERATLALMLNEGRVEESVNWLFEVSEE********L*SSGSLKIDISEELARISEIELRYKCSKQEVERAVVASEGDLDKAEDTIKVQK**************************************************************************************************SPSKVEVRQAVAGNEGKTIQQVREPVIVMQRPQSMNAKQIPASSA*****VTAGWYAKNVPAVENVRPNAKILQGTGTRGTENQSSELFYRQAPYKEIPYMHNPVESISAGLGSSW*********LTA*************************L**************HVDWNTGGLMPECDYTSIDWTLDTSTSLSSSPKPNGLWFGISSLLRNSPGMRMGGANGTCMS**************************KDIFSVP*QFVTS**

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSPASKSKSKPSGKASKEQQKAPIKPSGSANAGNGVPASAYNPISGTFHTLDTSSVATSPPYHDNGRFRNIDDTDEHSSRPHGTVSEYDSVSNNGSCSGESEDPKEKFANSSRQDPIPGSDNDRRExxxxxxxxxxxxxxxxxxxxxHERCCGYLMSRKLEALSQQLVAMGFSSERATLALMLNEGRVEESVNWLFEVSEEEARNTDPKLESSGSLKIDISEELARISEIELRYKCSxxxxxxxxxxxxxxxxxxxxxxxxxxxxLPATPPRPDDTADTKSMVRPQEKLLAPITIQQRRNERDFNYTKAAATVPITFTETGSRNLLSPVPNQSKLLADKRWAASGSSASASLTATAHMPLVSPSKVEVRQAVAGNEGKTIQQVREPVIVMQRPQSMNAKQIPASSAASSPQVTAGWYAKNVPAVENVRPNAKILQGTGTRGTENQSSELFYRQAPYKEIPYMHNPVESISAGLGSSWSSMGSSSPSLTAPSKSRGSWSTMGMSSPSLAVPSSLGLFASWGSAGTLGSSSHVDWNTGGLMPECDYTSIDWTLDTSTSLSSSPKPNGLWFGISSLLRNSPGMRMGGANGTCMSGLQDNGAVTEASSAGGLREWTSPFAEKDIFSVPRQFVTSPP

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		632
255569177		626	conserved hypothetical protein [Ricinus	0.944	0.953	0.666	0.0
356546305		636	PREDICTED: uncharacterized protein LOC10	0.969	0.963	0.529	1e-162
356501374		650	PREDICTED: uncharacterized protein LOC10	0.952	0.926	0.480	1e-148
225435919		655	PREDICTED: uncharacterized protein LOC10	0.955	0.922	0.488	1e-146
224104549		656	predicted protein [Populus trichocarpa]	0.922	0.888	0.493	1e-145
357515475		624	hypothetical protein MTR_8g041570 [Medic	0.962	0.974	0.496	1e-142
255564442		663	conserved hypothetical protein [Ricinus	0.939	0.895	0.476	1e-142
357493789		669	hypothetical protein MTR_5g088750 [Medic	0.928	0.877	0.464	1e-141
356577377		649	PREDICTED: uncharacterized protein LOC10	0.905	0.881	0.482	1e-141
224058920		652	predicted protein [Populus trichocarpa]	0.922	0.894	0.485	1e-140

>gi\|255569177\|ref\|XP_002525557.1\| conserved hypothetical protein [Ricinus communis] gi\|223535136\|gb\|EEF36816.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/621 (66%), Positives = 481/621 (77%), Gaps = 24/621 (3%)

Query: 18  EQQKAPIKPSGSANAGNGVPASAYNPISGTFHTLDTSSVATSPPYHDNGRFRNIDDTDEH 77
           EQQKA  K SGS N  +G PASAYNP+SGTFHTL+  S A+SPP+HDNGRFRNIDDTDEH
Sbjct: 21  EQQKASSKSSGSTNTVSGSPASAYNPLSGTFHTLEIPSAASSPPFHDNGRFRNIDDTDEH 80

Query: 78  SSRPHGTVSEYDSVSNNGSCSGESEDPKEKFANSSRQDPIPGSDNDRREKIRLKNEKKHQ 137
           SS PHGTVSEYDSVSNNGSCSGESEDPKEK     RQD +PG DNDRREKIRLKNEKKHQ
Sbjct: 81  SSSPHGTVSEYDSVSNNGSCSGESEDPKEKIF---RQDTVPGLDNDRREKIRLKNEKKHQ 137

Query: 138 RQREKRAQELHERCCGYLMSRKLEALSQQLVAMGFSSERATLALMLNEGRVEESVNWLFE 197
           RQRE+RAQELHERC G+LMSRKLE+LSQQLVAMGFS ERATLAL+LNEGRVE+SVNWLFE
Sbjct: 138 RQRERRAQELHERCSGFLMSRKLESLSQQLVAMGFSHERATLALVLNEGRVEQSVNWLFE 197

Query: 198 VSEEEARNTDPKLESSGSLKIDISEELARISEIELRYKCSKQEVERAVVASEGDLDKAED 257
            +EEEARN D K  SSG+LKIDIS+ELA++S +E+RYKCS+QEVERAVVA EGDL KAE+
Sbjct: 198 GNEEEARNKDTKRGSSGNLKIDISDELAQLSTLEVRYKCSRQEVERAVVACEGDLLKAEE 257

Query: 258 TIKVQKQELPATPPRPDDTADTKSMVRPQEKLL--APITIQQRRNERDFNYTKAAATVPI 315
            I+ QKQE PATPP+ ++T D  +M RPQEK +  A +TIQQ+RN+RDFNY+KAA +V  
Sbjct: 258 IIQAQKQEPPATPPQ-EETVDANNMKRPQEKPMSSASVTIQQKRNDRDFNYSKAAISVS- 315

Query: 316 TFTETGSRNLLSPVPNQSKLLADKRWAASGSSASASLTATAHMPLVSPS-KVEVRQAVAG 374
           T++E GSRNL S   NQ K LA++RW A GSS+S S +    M +  P+ K+EV   V+G
Sbjct: 316 TYSEPGSRNLQS--INQPKSLAERRWTA-GSSSSFSSSMVPPMQVQLPAGKLEV--GVSG 370

Query: 375 NEGKTIQQV-REPVIVMQRPQSMNAKQIPASSAASSPQVTAGWYAKNVPAVENVRPNAKI 433
           NEGK  QQ+ REPV+VMQRPQS+NAKQ    S  + P VTAGWY+  VP +ENVR N K+
Sbjct: 371 NEGKNHQQILREPVVVMQRPQSINAKQNEVPS-ITYPVVTAGWYSNIVPGIENVRSNGKL 429

Query: 434 L--QGTGTRGTENQSSELFYRQAPYKEIPYMHN-PVESISAGLGSSWSSMGSSSPSLTAP 490
           L  Q TG+ G  NQS+E FY  A YKE   + N PV+  SAGLG SWSSMG   PSL AP
Sbjct: 430 LSSQNTGSFGLVNQSAEQFYHPASYKESSLLLNGPVDPASAGLGGSWSSMG-KHPSLAAP 488

Query: 491 SKSRGSWSTMGMSSPSLAVPSSLGLFASWGSAGTLGSSSHVDWNTGGLMPECDYTSIDWT 550
              RGS+    +SSPSLA PSSLGLF   GS+GTLG +SHVDWN GG MPE DYTSIDWT
Sbjct: 489 YVPRGSYGIASVSSPSLAAPSSLGLFTGVGSSGTLG-TSHVDWNNGGSMPEFDYTSIDWT 547

Query: 551 LDTSTSLSSSPKPNGLWFGISSLLRNSPGMRMGGANGTCMSGLQDNGAVTEASSAGGLRE 610
           LD  T+LSSS +   L  G+SSLL +  G RM   N +C+SGL++ GA  E +S+ GLRE
Sbjct: 548 LD--TNLSSSKRGLWL--GLSSLLSDRSGARMNSMNSSCISGLREAGAAKEMASSVGLRE 603

Query: 611 WTSPFAEKDIFSVPRQFVTSP 631
           WTSPFA KDIFS+PRQFVTSP
Sbjct: 604 WTSPFAGKDIFSLPRQFVTSP 624

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356546305\|ref\|XP_003541569.1\| PREDICTED: uncharacterized protein LOC100814178 [Glycine max]	Back alignment and taxonomy information

>gi\|356501374\|ref\|XP_003519500.1\| PREDICTED: uncharacterized protein LOC100798094 [Glycine max]	Back alignment and taxonomy information

>gi\|225435919\|ref\|XP_002267190.1\| PREDICTED: uncharacterized protein LOC100249621 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224104549\|ref\|XP_002313475.1\| predicted protein [Populus trichocarpa] gi\|222849883\|gb\|EEE87430.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357515475\|ref\|XP_003628026.1\| hypothetical protein MTR_8g041570 [Medicago truncatula] gi\|355522048\|gb\|AET02502.1\| hypothetical protein MTR_8g041570 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|255564442\|ref\|XP_002523217.1\| conserved hypothetical protein [Ricinus communis] gi\|223537513\|gb\|EEF39138.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|357493789\|ref\|XP_003617183.1\| hypothetical protein MTR_5g088750 [Medicago truncatula] gi\|355518518\|gb\|AET00142.1\| hypothetical protein MTR_5g088750 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356577377\|ref\|XP_003556803.1\| PREDICTED: uncharacterized protein LOC100802602 [Glycine max]	Back alignment and taxonomy information

>gi\|224058920\|ref\|XP_002299651.1\| predicted protein [Populus trichocarpa] gi\|222846909\|gb\|EEE84456.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		632
TAIR\|locus:2039513		646	AT2G26920 "AT2G26920" [Arabido	0.917	0.897	0.380	1.3e-93
TAIR\|locus:2177043		619	AT5G12120 [Arabidopsis thalian	0.376	0.384	0.567	2.4e-85

TAIR\|locus:2039513 AT2G26920 "AT2G26920" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 932 (333.1 bits), Expect = 1.3e-93, P = 1.3e-93
 Identities = 250/657 (38%), Positives = 343/657 (52%)

Query:    18 EQQKAPIKPSGSANAGNGVPASAYNPISGTFHTLDTSSVATSPPYHDNGRFRNIDDTDEH 77
             E QKA  KPS S N  + + AS YNP+ GTF  LD+ S+A+  P   + RFR+ID+ D +
Sbjct:    22 EAQKASPKPSLSVNGNSSLAASGYNPLLGTFQALDSVSIASISPLQYS-RFRSIDEADVN 80

Query:    78 SSRPHGTVSEYDSVSNNGSCSGESEDPKEKFANSS-RQDPIPGSDNDRREKIRLKNEKKH 136
                      E DSVSNNGSCSGESED KEK  N   +Q+ IPG+DND+REK+R KNE+KH
Sbjct:    81 GI-------ESDSVSNNGSCSGESEDHKEKTTNLPLKQEVIPGADNDKREKVRQKNERKH 133

Query:   137 QRQREKRAQELHERCCGYLMSRKLEALSQQLVAMGFSSERATLALMLNEGRVEESVNWLF 196
             QRQ+E+RAQEL+E+C  YL+SRKLEA +QQ+VAMG S E AT ALM+N+G+VEESV+WLF
Sbjct:   134 QRQKERRAQELNEKCSTYLISRKLEARTQQIVAMGISQEHATTALMMNDGKVEESVHWLF 193

Query:   197 EVSEEEARNTDPKLESSGSLKIDISEELARISEIELRYKCSKQEVERAVVASEGDLDKAE 256
             +  EEE       ++S G+LKIDI+EELARI+++EL+ KC++QE+ERAVV +EGDLD+AE
Sbjct:   194 DRLEEEIEKQS--IQSPGNLKIDITEELARITKMELQLKCTRQEIERAVVQAEGDLDRAE 251

Query:   257 DTIK----------VQKQE----LXXXXXXXXXXXXXKSMVRPQEKLLAPITIQQRRNER 302
             + +K          V+++E    L             ++    + ++ +P  +   R+++
Sbjct:   252 EVLKGTKYEEFSVPVKQEECGDPLTPSNGKLIVGIGYQNSDVERSEIPSP-GLHPTRDDK 310

Query:   303 DFNYTKAAAT---VPITFTETGSRNLLS---PVPNQSKLLADKRWXXXXXXXXXXXXXXX 356
             +FNYTK+ +T   V     +   R  L    P P QS  LADKRW               
Sbjct:   311 NFNYTKSPSTTESVNKMLAQPMKRPELKLDWPKPQQSAALADKRWPPTTGQVPSASYSLP 370

Query:   357 HMPLVSPS---KVEVRQAVAGNEGKTIQQV------REPVIVM-QRPQSMNAKQIPXXXX 406
               P  SP    +VE R   +GNE K  QQ       RE V+VM QRPQ +    +P    
Sbjct:   371 SSPSPSPQPAVRVEARYLASGNEFKNFQQQQQQPANRESVMVMRQRPQVVITNPVPTSSM 430

Query:   407 XXXPQVTAGWYAKNVPAVENVRPNAKILQGTGTRGTENQSSELFYRQAPYKEIPYMHNPV 466
                P     W+     ++E ++ N   +Q        + S         Y+++ Y +   
Sbjct:   431 SAPP---TSWHP--AASIEIMKSNG-FMQTHNIPSARSPSPNHLNPNQVYQQLQYQNQK- 483

Query:   467 EXXXXXXXXXXXXXXXXXXXXXXXXXXRGSWSTMGMSSPSLAVPSSLGLFASWGSAGTLG 526
                                         G W+    SSP ++  SSLGLF++ GSAGT G
Sbjct:   484 ---------RFTNNNQVDPHGSMARGNGGQWTRNTASSPPISAASSLGLFSAVGSAGTSG 534

Query:   527 SSSHVDWNTGGLMPECDYXXXXXXXXXXXXXXXXPKPNGLWFGISSL------------L 574
             +SS +DW +GG +   DY                 + NG W G+ S             L
Sbjct:   535 ASSPIDWISGGSV---DYTNIDWSLDQSLSQNS--RVNGNWSGLKSSSQIYDENMNRYSL 589

Query:   575 RNSPGMRMGGANGTCMSGLQDNGAVTEASSAGGLREWTSPFAEKDIFSVPRQFVTSP 631
               S G R+  +NG  M      G + E   A    +WTSPF  KDIFS+ RQ+V SP
Sbjct:   590 NGSMGGRLNNSNGVSMEN-SGAGVIVETQQAATSPDWTSPFEGKDIFSLSRQYV-SP 644

GO:0003674 "molecular_function" evidence=ND

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA

TAIR\|locus:2177043 AT5G12120 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		632
cd00194		38	cd00194, UBA, Ubiquitin Associated domain	2e-06
pfam00627		37	pfam00627, UBA, UBA/TS-N domain	5e-06
smart00165		37	smart00165, UBA, Ubiquitin associated domain	6e-05

>gnl\|CDD\|238116 cd00194, UBA, Ubiquitin Associated domain	Back alignment and domain information

 Score = 44.4 bits (106), Expect = 2e-06
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 165 QQLVAMGFSSERATLALMLNEGRVEESVNWLFE 197
           +QL+ MGFS E A  AL      VE +V WL E
Sbjct: 6   EQLLEMGFSREEARKALRATNNNVERAVEWLLE 38

The UBA domain is a commonly occurring sequence motif in some members of the ubiquitination pathway, UV excision repair proteins, and certain protein kinases. Although its specific role is so far unknown, it has been suggested that UBA domains are involved in conferring protein target specificity. The domain, a compact three helix bundle, has a conserved GFP-loop and the proline is thought to be critical for binding. The UBA domain is distinct from the conserved three helical domain seen in the N-terminus of EF-TS and eukaryotic NAC proteins. Length = 38

>gnl\|CDD\|201355 pfam00627, UBA, UBA/TS-N domain	Back alignment and domain information

>gnl\|CDD\|197551 smart00165, UBA, Ubiquitin associated domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		632
KOG0944		763	consensus Ubiquitin-specific protease UBP14 [Postt	99.92
COG5207		749	UBP14 Isopeptidase T [Posttranslational modificati	99.88
PF00627		37	UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma	98.98
smart00165		37	UBA Ubiquitin associated domain. Present in Rad23,	98.93
cd00194		38	UBA Ubiquitin Associated domain. The UBA domain is	98.9
PF00627		37	UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma	98.74
smart00165		37	UBA Ubiquitin associated domain. Present in Rad23,	98.54
cd00194		38	UBA Ubiquitin Associated domain. The UBA domain is	98.54
TIGR00601		378	rad23 UV excision repair protein Rad23. All protei	98.43
KOG2561		568	consensus Adaptor protein NUB1, contains UBA domai	98.31
KOG0944		763	consensus Ubiquitin-specific protease UBP14 [Postt	98.12
KOG2561		568	consensus Adaptor protein NUB1, contains UBA domai	98.02
KOG0011		340	consensus Nucleotide excision repair factor NEF2,	97.27
COG5207		749	UBP14 Isopeptidase T [Posttranslational modificati	96.97
TIGR00601		378	rad23 UV excision repair protein Rad23. All protei	96.9
KOG2689		290	consensus Predicted ubiquitin regulatory protein [	96.8
PF14555		43	UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A	96.35
PRK06369		115	nac nascent polypeptide-associated complex protein	95.99
PRK12332		198	tsf elongation factor Ts; Reviewed	95.92
TIGR00116		290	tsf translation elongation factor Ts. This protein	95.85
KOG0011		340	consensus Nucleotide excision repair factor NEF2,	95.78
PRK09377		290	tsf elongation factor Ts; Provisional	95.76
TIGR00264		116	alpha-NAC-related protein. This hypothetical prote	95.68
CHL00098		200	tsf elongation factor Ts	95.36
PF02845		42	CUE: CUE domain; InterPro: IPR003892 This domain m	95.31
COG0264		296	Tsf Translation elongation factor Ts [Translation,	94.52
COG1308		122	EGD2 Transcription factor homologous to NACalpha-B	94.3
smart00546		43	CUE Domain that may be involved in binding ubiquit	94.01
PRK09377		290	tsf elongation factor Ts; Provisional	93.87
smart00546		43	CUE Domain that may be involved in binding ubiquit	93.82
TIGR00116		290	tsf translation elongation factor Ts. This protein	93.68
CHL00098		200	tsf elongation factor Ts	93.57
PRK12332		198	tsf elongation factor Ts; Reviewed	93.5
PF14555		43	UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A	93.34
PF02845		42	CUE: CUE domain; InterPro: IPR003892 This domain m	92.8
KOG0010		493	consensus Ubiquitin-like protein [Posttranslationa	88.29
KOG1071		340	consensus Mitochondrial translation elongation fac	84.99
KOG0010		493	consensus Ubiquitin-like protein [Posttranslationa	83.7
KOG2689		290	consensus Predicted ubiquitin regulatory protein [	82.81
COG0264		296	Tsf Translation elongation factor Ts [Translation,	81.55

>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=99.92  E-value=2.7e-25  Score=242.12  Aligned_cols=109  Identities=22%  Similarity=0.303  Sum_probs=94.5

Q ss_pred             hhHHHHHHHHhcCCCHHHHHHHHHHh-CCCHHHHHHHhhhcCCcccCCCCCcccCCCCCCC--CchHH-HHHHHHHHHhc
Q 006751          159 KLEALSQQLVAMGFSSERATLALMLN-EGRVEESVNWLFEVSEEEARNTDPKLESSGSLKI--DISEE-LARISEIELRY  234 (632)
Q Consensus       159 KlE~LVqQLvAMGFpe~RCkKALiat-NgDVEAAMnWLFEHMEDpDiD~P~~l~s~~~~~i--DIseE-La~L~eMevsy  234 (632)
                      .++.+|.||+.||||++.|+|||+.| |+++|+||||||+||||||||+|+.+.+....+.  .+++| ++.|.+|    
T Consensus       570 ~d~s~i~qL~~MGFp~eac~rAly~tgN~~aEaA~NWl~~HMdDpd~~~p~vvp~~~~~a~~~~~~e~~v~si~sm----  645 (763)
T KOG0944|consen  570 ADRSVISQLVEMGFPEEACRRALYYTGNSGAEAASNWLMEHMDDPDIDDPFVVPGNSPKADAREVDEESVASIVSM----  645 (763)
T ss_pred             hhHHHHHHHHHcCCCHHHHHHHHhhhcCccHHHHHHHHHHhccCcccCCceecCCCCCccccCCCChhHheeeeee----
Confidence            58899999999999999999999999 9999999999999999999999997744333222  35666 7777666    


Q ss_pred             CCCHHHHHHHHHHccCCHHHHHHHHhhcCCCCCCCCC
Q 006751          235 KCSKQEVERAVVASEGDLDKAEDTIKVQKQELPATPP  271 (632)
Q Consensus       235 GFs~~qAeKALkeTdGDVERAVEWLFSHpDD~~s~~~  271 (632)
                      ||+..||++||++++|||||||||+|+|+|+..--++
T Consensus       646 Gf~~~qa~~aL~~~n~nveravDWif~h~d~~~ed~~  682 (763)
T KOG0944|consen  646 GFSRNQAIKALKATNNNVERAVDWIFSHMDIPVEDAA  682 (763)
T ss_pred             cCcHHHHHHHHHhcCccHHHHHHHHHhcccccccccC
Confidence            9999999999999999999999999999996554443

>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases []	Back alignment and domain information

>smart00165 UBA Ubiquitin associated domain	Back alignment and domain information

>cd00194 UBA Ubiquitin Associated domain	Back alignment and domain information

>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases []	Back alignment and domain information

>smart00165 UBA Ubiquitin associated domain	Back alignment and domain information

>cd00194 UBA Ubiquitin Associated domain	Back alignment and domain information

>TIGR00601 rad23 UV excision repair protein Rad23	Back alignment and domain information

>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair]	Back alignment and domain information

>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00601 rad23 UV excision repair protein Rad23	Back alignment and domain information

>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A	Back alignment and domain information

>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed	Back alignment and domain information

>PRK12332 tsf elongation factor Ts; Reviewed	Back alignment and domain information

>TIGR00116 tsf translation elongation factor Ts	Back alignment and domain information

>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair]	Back alignment and domain information

>PRK09377 tsf elongation factor Ts; Provisional	Back alignment and domain information

>TIGR00264 alpha-NAC-related protein	Back alignment and domain information

>CHL00098 tsf elongation factor Ts	Back alignment and domain information

>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs)	Back alignment and domain information

>COG0264 Tsf Translation elongation factor Ts [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription]	Back alignment and domain information

>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs)	Back alignment and domain information

>PRK09377 tsf elongation factor Ts; Provisional	Back alignment and domain information

>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs)	Back alignment and domain information

>TIGR00116 tsf translation elongation factor Ts	Back alignment and domain information

>CHL00098 tsf elongation factor Ts	Back alignment and domain information

>PRK12332 tsf elongation factor Ts; Reviewed	Back alignment and domain information

>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A	Back alignment and domain information

>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs)	Back alignment and domain information

>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only]	Back alignment and domain information

>KOG1071 consensus Mitochondrial translation elongation factor EF-Tsmt, catalyzes nucleotide exchange on EF-Tumt [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only]	Back alignment and domain information

>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0264 Tsf Translation elongation factor Ts [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		632
2dai_A		83	Ubadc1, ubiquitin associated domain containing 1;	3e-08
2dak_A		63	Ubiquitin carboxyl-terminal hydrolase 5; isopeptid	1e-07
1wiv_A		73	UBP14, ubiquitin-specific protease 14; ubiquitin a	3e-07
1whc_A		64	RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain	9e-07
4ae4_A		118	Ubiquitin-associated protein 1; protein transport,	5e-06
2lbc_A		126	Ubiquitin carboxyl-terminal hydrolase 13; tandem U	1e-05
2lbc_A		126	Ubiquitin carboxyl-terminal hydrolase 13; tandem U	3e-05
1vek_A		84	UBP14, ubiquitin-specific protease 14, putative; U	2e-05
2crn_A		64	Ubash3A protein; compact three-helix bundle, struc	3e-05
2dag_A		74	Ubiquitin carboxyl-terminal hydrolase 5; isopeptid	3e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-04
3ihp_A		854	Ubiquitin carboxyl-terminal hydrolase 5; hydrolase	3e-04
3ihp_A		854	Ubiquitin carboxyl-terminal hydrolase 5; hydrolase	7e-04

>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83	Back alignment and structure

 Score = 50.2 bits (120), Expect = 3e-08
 Identities = 23/54 (42%), Positives = 30/54 (55%)

Query: 161 EALSQQLVAMGFSSERATLALMLNEGRVEESVNWLFEVSEEEARNTDPKLESSG 214
           EA  +QL  MGF   RAT AL LN   V +++ WL E +E+   +T     SSG
Sbjct: 30  EAALRQLTEMGFPENRATKALQLNHMSVPQAMEWLIEHAEDPTIDTPLSGPSSG 83

PyMOL of 2dai

>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63	Back alignment and structure

>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73	Back alignment and structure

>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Length = 64	Back alignment and structure

>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118	Back alignment and structure

>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126	Back alignment and structure

>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126	Back alignment and structure

>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 84	Back alignment and structure

>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 64	Back alignment and structure

>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854	Back alignment and structure

>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		632
2lbc_A		126	Ubiquitin carboxyl-terminal hydrolase 13; tandem U	99.93
4ae4_A		118	Ubiquitin-associated protein 1; protein transport,	99.92
1wiv_A		73	UBP14, ubiquitin-specific protease 14; ubiquitin a	99.84
3ihp_A		854	Ubiquitin carboxyl-terminal hydrolase 5; hydrolase	99.82
1oqy_A		368	HHR23A, UV excision repair protein RAD23 homolog A	99.73
2crn_A		64	Ubash3A protein; compact three-helix bundle, struc	99.69
2dag_A		74	Ubiquitin carboxyl-terminal hydrolase 5; isopeptid	99.59
1vek_A		84	UBP14, ubiquitin-specific protease 14, putative; U	99.58
2dai_A		83	Ubadc1, ubiquitin associated domain containing 1;	99.56
1whc_A		64	RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain	99.55
2dak_A		63	Ubiquitin carboxyl-terminal hydrolase 5; isopeptid	99.55
2cpw_A		64	CBL-interacting protein STS-1 variant; ubiquitin a	99.44
1wgn_A		63	UBAP1, ubiquitin associated protein; ubiquitin ass	99.36
1dv0_A		47	DNA repair protein HHR23A; helical bundle, DNA bin	99.32
1wji_A		63	Tudor domain containing protein 3; UBA domain, str	99.28
2dkl_A		85	Trinucleotide repeat containing 6C protein; TNRC6C	99.28
2lbc_A		126	Ubiquitin carboxyl-terminal hydrolase 13; tandem U	99.26
2g3q_A		43	Protein YBL047C; endocytosis, solution structure,	99.25
1wgn_A		63	UBAP1, ubiquitin associated protein; ubiquitin ass	99.23
2ekk_A		47	UBA domain from E3 ubiquitin-protein ligase HUWE1;	99.22
1wiv_A		73	UBP14, ubiquitin-specific protease 14; ubiquitin a	99.2
1ify_A		49	HHR23A, UV excision repair protein RAD23 homolog A	99.11
1wji_A		63	Tudor domain containing protein 3; UBA domain, str	99.11
2dak_A		63	Ubiquitin carboxyl-terminal hydrolase 5; isopeptid	99.1
2cpw_A		64	CBL-interacting protein STS-1 variant; ubiquitin a	99.05
2jy5_A		52	Ubiquilin-1; UBA, alternative splicing, cytoplasm,	99.04
2knz_A		53	Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc	99.03
1veg_A		83	NEDD8 ultimate buster-1; ubiquitin associated doma	99.03
2dag_A		74	Ubiquitin carboxyl-terminal hydrolase 5; isopeptid	99.01
2crn_A		64	Ubash3A protein; compact three-helix bundle, struc	99.01
1whc_A		64	RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain	99.0
1veg_A		83	NEDD8 ultimate buster-1; ubiquitin associated doma	98.99
1z96_A		40	DNA-damage, UBA-domain protein MUD1; ubiquitin, th	98.99
2dai_A		83	Ubadc1, ubiquitin associated domain containing 1;	98.97
2ekk_A		47	UBA domain from E3 ubiquitin-protein ligase HUWE1;	98.95
2g3q_A		43	Protein YBL047C; endocytosis, solution structure,	98.93
1vg5_A		73	RSGI RUH-014, rhomboid family protein; UBA domain,	98.91
2dah_A		54	Ubiquilin-3; UBA domain, structural genomics, NPPS	98.87
2dkl_A		85	Trinucleotide repeat containing 6C protein; TNRC6C	98.87
2dna_A		67	Unnamed protein product; ubiquitin associated doma	98.85
2jy5_A		52	Ubiquilin-1; UBA, alternative splicing, cytoplasm,	98.85
1dv0_A		47	DNA repair protein HHR23A; helical bundle, DNA bin	98.84
2dah_A		54	Ubiquilin-3; UBA domain, structural genomics, NPPS	98.84
1vek_A		84	UBP14, ubiquitin-specific protease 14, putative; U	98.83
1vej_A		74	Riken cDNA 4931431F19; UBA domain, three helix bun	98.82
1ify_A		49	HHR23A, UV excision repair protein RAD23 homolog A	98.82
2bwb_A		46	Ubiquitin-like protein DSK2; UBA, signaling protei	98.8
2dna_A		67	Unnamed protein product; ubiquitin associated doma	98.79
1vg5_A		73	RSGI RUH-014, rhomboid family protein; UBA domain,	98.78
2knz_A		53	Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc	98.78
1wr1_B		58	Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu	98.77
1vej_A		74	Riken cDNA 4931431F19; UBA domain, three helix bun	98.74
4ae4_A		118	Ubiquitin-associated protein 1; protein transport,	98.72
1wr1_B		58	Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu	98.72
2bwb_A		46	Ubiquitin-like protein DSK2; UBA, signaling protei	98.68
1z96_A		40	DNA-damage, UBA-domain protein MUD1; ubiquitin, th	98.67
2cwb_A		108	Chimera of immunoglobulin G binding protein G and	98.4
2cos_A		54	Serine/threonine protein kinase LATS2; UBA domain,	98.38
2cwb_A		108	Chimera of immunoglobulin G binding protein G and	98.25
1oqy_A		368	HHR23A, UV excision repair protein RAD23 homolog A	98.18
2ooa_A		52	E3 ubiquitin-protein ligase CBL-B; alpha-helical d	98.05
3k9o_A		201	Ubiquitin-conjugating enzyme E2 K; E2-25K, complex	97.93
3ihp_A		854	Ubiquitin carboxyl-terminal hydrolase 5; hydrolase	97.92
2d9s_A		53	CBL E3 ubiquitin protein ligase; UBA domain, dimer	97.91
2juj_A		56	E3 ubiquitin-protein ligase CBL; alpha helix, UBA	97.87
2qsf_X		171	RAD23, UV excision repair protein RAD23; alpha-bet	97.81
1wj7_A		104	Hypothetical protein (RSGI RUH-015); UBA domain, u	97.74
2cp8_A		54	NEXT to BRCA1 gene 1 protein; UBA domain, structur	97.74
2oo9_A		46	E3 ubiquitin-protein ligase CBL; alpha-helical dom	97.71
2d9s_A		53	CBL E3 ubiquitin protein ligase; UBA domain, dimer	97.63
2cp9_A		64	EF-TS, EF-TSMT, elongation factor TS, mitochondria	97.62
2ooa_A		52	E3 ubiquitin-protein ligase CBL-B; alpha-helical d	97.61
1wj7_A		104	Hypothetical protein (RSGI RUH-015); UBA domain, u	97.61
2cos_A		54	Serine/threonine protein kinase LATS2; UBA domain,	97.52
3k9o_A		201	Ubiquitin-conjugating enzyme E2 K; E2-25K, complex	97.48
2qsf_X		171	RAD23, UV excision repair protein RAD23; alpha-bet	97.23
2cp8_A		54	NEXT to BRCA1 gene 1 protein; UBA domain, structur	97.13
2oo9_A		46	E3 ubiquitin-protein ligase CBL; alpha-helical dom	97.0
2juj_A		56	E3 ubiquitin-protein ligase CBL; alpha helix, UBA	96.67
3e46_A		253	Ubiquitin-conjugating enzyme E2-25 kDa; huntington	96.59
1wgl_A		59	TOLL-interacting protein; CUE domain, structural g	96.44
2cp9_A		64	EF-TS, EF-TSMT, elongation factor TS, mitochondria	96.28
1otr_A		49	Protein CUE2; protein-protein complex, cell cycle;	96.14
1xb2_B		291	EF-TS, elongation factor TS, mitochondrial, EF-TSM	95.95
1aip_C		196	EF-TS, elongation factor TS; nucleotide exchange,	95.9
3e46_A		253	Ubiquitin-conjugating enzyme E2-25 kDa; huntington	95.61
1tr8_A		102	Conserved protein (MTH177); chaperones, nascent po	95.43
1wgl_A		59	TOLL-interacting protein; CUE domain, structural g	94.62
1xb2_B		291	EF-TS, elongation factor TS, mitochondrial, EF-TSM	93.87
1q02_A		52	Sequestosome 1; helical bundle, protein binding; N	93.64
1aip_C		196	EF-TS, elongation factor TS; nucleotide exchange,	93.35
2dal_A		62	Protein KIAA0794; FAS associted factor 1, UBA-like	93.03
1v92_A		46	NSFL1 cofactor P47; 3-helix bundle, recombination;	92.75
2dam_A		67	ETEA protein; KIAA0887, UBA-like domain, structura	92.61
4dbg_B		162	Ring finger protein 31; ubiquitin fold, ubiquitina	92.6
4dbg_B		162	Ring finger protein 31; ubiquitin fold, ubiquitina	92.49
2dhy_A		67	CUE domain-containing protein 1; structural genomi	92.43
2dhy_A		67	CUE domain-containing protein 1; structural genomi	92.26
2dzl_A		66	Protein FAM100B; UBA-like domain, structural genom	91.03
2pwq_A		216	Ubiquitin conjugating enzyme; structural genomics	90.63
2lva_A		129	Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubi	85.8
3avx_A		1289	Elongation factor TS, elongation factor TU, linke	85.6
1q02_A		52	Sequestosome 1; helical bundle, protein binding; N	85.34
1otr_A		49	Protein CUE2; protein-protein complex, cell cycle;	85.24
2di0_A		71	Activating signal cointegrator 1 complex subunit 2	83.49
1ufz_A		83	Hypothetical protein BAB28515; HBS1-like domain, s	80.01

>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens}	Back alignment and structure

Probab=99.93  E-value=5.8e-26  Score=200.94  Aligned_cols=104  Identities=24%  Similarity=0.282  Sum_probs=89.1

Q ss_pred             hHHHHHHHHhcCCCHHHHHHHHHHh-CCCHHHHHHHhhhcCCcccCCCCCcccCCCCC-------------CCCchHH-H
Q 006751          160 LEALSQQLVAMGFSSERATLALMLN-EGRVEESVNWLFEVSEEEARNTDPKLESSGSL-------------KIDISEE-L  224 (632)
Q Consensus       160 lE~LVqQLvAMGFpe~RCkKALiat-NgDVEAAMnWLFEHMEDpDiD~P~~l~s~~~~-------------~iDIseE-L  224 (632)
                      ++.+|+||++|||++.+|++||+.| |+++|+||+|||+|++|+++++|+.+......             ...+.++ |
T Consensus         3 d~~~l~~L~~MGF~~~~a~~AL~~t~n~~~e~A~~wL~~~~~d~di~epl~~~~~~s~~~~~~~~l~~~~~~~~~~e~~v   82 (126)
T 2lbc_A            3 DESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIV   82 (126)
T ss_dssp             CTHHHHHHHTTSSCCHHHHHHHHHHTSCCHHHHHHHHHHGGGCSSSSCTTCCSSCCSSSSSCCCCSTTSSCCCCCCHHHH
T ss_pred             CHHHHHHHHHcCCCHHHHHHHHHHcCCCCHHHHHHHHHHhcccccccccccccccccccccchhhhcccccccCcCHHHH
Confidence            5688999999999999999999999 56999999999999999999988755211110             1125666 9


Q ss_pred             HHHHHHHHhcCCCHHHHHHHHHHccCCHHHHHHHHhhcCC-CCC
Q 006751          225 ARISEIELRYKCSKQEVERAVVASEGDLDKAEDTIKVQKQ-ELP  267 (632)
Q Consensus       225 a~L~eMevsyGFs~~qAeKALkeTdGDVERAVEWLFSHpD-D~~  267 (632)
                      .+|.+|    ||+.++|++||+.|+||+++|++|||+|++ |++
T Consensus        83 ~~L~~M----GF~~~~a~~AL~~~~~~~e~A~e~L~~~~~~d~~  122 (126)
T 2lbc_A           83 AIITSM----GFQRNQAIQALRATNNNLERALDWIFSHPEFEED  122 (126)
T ss_dssp             HHHHHH----TSCHHHHHHHHHHHTSCHHHHHHHHHTCCSSCCC
T ss_pred             HHHHHc----CCCHHHHHHHHHHcCCCHHHHHHHHHhCCCCccC
Confidence            999888    999999999999999999999999999999 754

PyMOL of 2lbc

>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B*	Back alignment and structure

>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1	Back alignment and structure

>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens}	Back alignment and structure

>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A	Back alignment and structure

>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1	Back alignment and structure

>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A	Back alignment and structure

>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens}	Back alignment and structure

>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1	Back alignment and structure

>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1	Back alignment and structure

>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B	Back alignment and structure

>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus}	Back alignment and structure

>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1	Back alignment and structure

>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1	Back alignment and structure

>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1	Back alignment and structure

>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B	Back alignment and structure

>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A	Back alignment and structure

>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1	Back alignment and structure

>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A	Back alignment and structure

>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1	Back alignment and structure

>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus}	Back alignment and structure

>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1	Back alignment and structure

>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B*	Back alignment and structure

>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1	Back alignment and structure

>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A	Back alignment and structure

>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1	Back alignment and structure

>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A	Back alignment and structure

>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A	Back alignment and structure

>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A	Back alignment and structure

>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A	Back alignment and structure

>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A	Back alignment and structure

>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens}	Back alignment and structure

>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens}	Back alignment and structure

>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens}	Back alignment and structure

>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2	Back alignment and structure

>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A	Back alignment and structure

>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A	Back alignment and structure

>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens}	Back alignment and structure

>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens}	Back alignment and structure

>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A*	Back alignment and structure

>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4	Back alignment and structure

>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2	Back alignment and structure

>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4	Back alignment and structure

>1xb2_B EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} SCOP: a.5.2.2 d.43.1.1 d.43.1.1	Back alignment and structure

>1aip_C EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} SCOP: a.5.2.2 d.43.1.1	Back alignment and structure

>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A*	Back alignment and structure

>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis}	Back alignment and structure

>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4	Back alignment and structure

>1xb2_B EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} SCOP: a.5.2.2 d.43.1.1 d.43.1.1	Back alignment and structure

>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A	Back alignment and structure

>1aip_C EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} SCOP: a.5.2.2 d.43.1.1	Back alignment and structure

>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3	Back alignment and structure

>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens}	Back alignment and structure

>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens}	Back alignment and structure

>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii}	Back alignment and structure

>2lva_A Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubiquitin interacting motif, UBA domain, NESG, northeas structural genomics consortium, SGC; NMR {Homo sapiens}	Back alignment and structure

>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B	Back alignment and structure

>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A	Back alignment and structure

>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4	Back alignment and structure

>2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4	Back alignment and structure

>1ufz_A Hypothetical protein BAB28515; HBS1-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, translatio; NMR {Mus musculus} SCOP: a.5.9.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		632
d1wjia_		63	a.5.2.1 (A:) Tudor domain containing protein 3, TD	2e-08
d1whca_		64	a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus	9e-08
d2crna1		51	a.5.2.1 (A:8-58) Suppressor of T-cell receptor sig	1e-07
d1veka_		84	a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress	7e-07
d1wiva_		73	a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress	8e-06
d2cpwa1		51	a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1	1e-05
d1oqya1		41	a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum	1e-05
d1wgna_		63	a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1	3e-05

>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63	Back information, alignment and structure


class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: Tudor domain containing protein 3, TDRD3
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 49.0 bits (117), Expect = 2e-08
 Identities = 17/54 (31%), Positives = 27/54 (50%)

Query: 161 EALSQQLVAMGFSSERATLALMLNEGRVEESVNWLFEVSEEEARNTDPKLESSG 214
           E   + +  MGFS E +  ALM N   +E ++N L   ++++     P   SSG
Sbjct: 10  EKALKHITEMGFSKEASRQALMDNGNNLEAALNVLLTSNKQKPVMGPPSGPSSG 63

PyMOL of d1wjia_

>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 64	Back information, alignment and structure

>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 51	Back information, alignment and structure

>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84	Back information, alignment and structure

>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73	Back information, alignment and structure

>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 51	Back information, alignment and structure

>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41	Back information, alignment and structure

>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		632
d1wiva_		73	Ubiquitin isopeptidase T {Thale cress (Arabidopsis	99.78
d2crna1		51	Suppressor of T-cell receptor signaling 2 (STS-2)	99.71
d1veka_		84	Ubiquitin isopeptidase T {Thale cress (Arabidopsis	99.65
d1whca_		64	UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta	99.64
d1wjia_		63	Tudor domain containing protein 3, TDRD3 {Human (H	99.58
d2cpwa1		51	Cbl-interacting protein p70, STS1 {Human (Homo sap	99.42
d1wgna_		63	Ubiquitin-associated protein 1, UBAP1 {Human (Homo	99.27
d1wiva_		73	Ubiquitin isopeptidase T {Thale cress (Arabidopsis	99.26
d1wjia_		63	Tudor domain containing protein 3, TDRD3 {Human (H	99.22
d1whca_		64	UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta	99.16
d1vg5a_		73	Rhomboid family protein At3g58460 {Thale cress (Ar	99.1
d1oqya1		41	DNA repair protein Hhr23a {Human (Homo sapiens) [T	99.07
d2crna1		51	Suppressor of T-cell receptor signaling 2 (STS-2)	99.07
d2cpwa1		51	Cbl-interacting protein p70, STS1 {Human (Homo sap	98.99
d1wgna_		63	Ubiquitin-associated protein 1, UBAP1 {Human (Homo	98.97
d1vg5a_		73	Rhomboid family protein At3g58460 {Thale cress (Ar	98.94
d1veka_		84	Ubiquitin isopeptidase T {Thale cress (Arabidopsis	98.92
d1oqya1		41	DNA repair protein Hhr23a {Human (Homo sapiens) [T	98.84
d2g3qa1		43	Endocytic protein Ede1, YBL047C {Saccharomyces cer	98.62
d2bwba1		44	DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta	98.17
d1veja1		61	4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]	98.15
d2dnaa1		50	Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus	98.11
d2daha1		41	Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]}	97.82
d2g3qa1		43	Endocytic protein Ede1, YBL047C {Saccharomyces cer	97.75
d1efub3		54	Elongation factor Ts (EF-Ts), N-terminal domain {E	97.61
d1veja1		61	4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]	97.53
d2bwba1		44	DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta	97.48
d2dnaa1		50	Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus	97.41
d1xb2b1		56	Elongation factor Ts (EF-Ts), N-terminal domain {C	97.39
d1aipc1		52	Elongation factor Ts (EF-Ts), N-terminal domain {T	97.38
d2daha1		41	Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]}	97.34
d1z96a1		38	UBA-domain protein mud1 {Schizosaccharomyces pombe	96.96
d1oqya2		44	DNA repair protein Hhr23a {Human (Homo sapiens) [T	96.81
d1aipc1		52	Elongation factor Ts (EF-Ts), N-terminal domain {T	96.64
d1xb2b1		56	Elongation factor Ts (EF-Ts), N-terminal domain {C	96.51
d1efub3		54	Elongation factor Ts (EF-Ts), N-terminal domain {E	96.45
d1vega_		83	NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu	96.42
d1wj7a1		91	Ubiquitin-associated protein 2-like Ubap2l {Mouse	95.76
d1wj7a1		91	Ubiquitin-associated protein 2-like Ubap2l {Mouse	95.24
d1vega_		83	NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu	95.14
d1oqya2		44	DNA repair protein Hhr23a {Human (Homo sapiens) [T	94.45
d1z96a1		38	UBA-domain protein mud1 {Schizosaccharomyces pombe	94.4
d2cosa1		41	Serine/threonine protein kinase LATS2 {Mouse (Mus	93.82
d2dkla1		72	Trinucleotide repeat containing 6c protein, TNRC6C	92.6
d2cosa1		41	Serine/threonine protein kinase LATS2 {Mouse (Mus	90.86
d1v92a_		46	NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {	90.81
d1wgla_		59	Toll-interacting protein {Human (Homo sapiens) [Ta	89.44
d2cp8a1		41	Migration-inducing protein 19 NBR1 {Human (Homo sa	85.75
d3e46a1		42	Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal	83.45
d1wgla_		59	Toll-interacting protein {Human (Homo sapiens) [Ta	80.77

>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: Ubiquitin isopeptidase T
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.78  E-value=3.7e-20  Score=151.58  Aligned_cols=70  Identities=16%  Similarity=0.183  Sum_probs=60.6

Q ss_pred             HHHHHHhhhcCCcccCCCCCcccCCCCCCCCchHH-HHHHHHHHHhcCCCHHHHHHHHHHccCCHHHHHHHHhhcCCCCC
Q 006751          189 EESVNWLFEVSEEEARNTDPKLESSGSLKIDISEE-LARISEIELRYKCSKQEVERAVVASEGDLDKAEDTIKVQKQELP  267 (632)
Q Consensus       189 EAAMnWLFEHMEDpDiD~P~~l~s~~~~~iDIseE-La~L~eMevsyGFs~~qAeKALkeTdGDVERAVEWLFSHpDD~~  267 (632)
                      +.|++|||+||||||||.|+..     ....++++ |.+|.+|    ||++++|++||+.|+||+|+|++|||+|+.+.+
T Consensus         2 ~~~~~~l~~h~dDpdid~P~~~-----~~~~~d~~~i~~L~~M----GF~~~~a~~AL~~~~~n~e~Av~~Lls~~~~~d   72 (73)
T d1wiva_           2 SSGSSGLLSHMDDPDIDAPISH-----QTSDIDQSSVDTLLSF----GFAEDVARKALKASGGDIEKATDWVFNNSGPSS   72 (73)
T ss_dssp             CCCCCCCSSCCSCSCSSCCSCC-----SSCSSCHHHHHHHHHH----TCCHHHHHHHHHHTTSCHHHHHHHHHHSCCSSC
T ss_pred             chHHHHHHhcCCCCCCCCCccc-----cCCCCCHHHHHHHHhc----CCCHHHHHHHHHHcCCCHHHHHHHHHcCCCCCC
Confidence            4689999999999999998532     12346677 9999888    999999999999999999999999999988754

PyMOL of d1wiva_

>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]}	Back information, alignment and structure

>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]}	Back information, alignment and structure

>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}	Back information, alignment and structure

>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}	Back information, alignment and structure

>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure