Citrus Sinensis ID: 006787

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-
MMMMMITCMASSLSKKLTALLLILTVVFSSSVSARFVVEKSSIRVLHPQSLRSKHDSAIGNFGIPDYGGFMVGSVIYPDKGASGCQPFEGDKPFKSKFPRPTVLLLDRGECYFALKVWHGQQAGAAAVLVADSVDEPLITMDSPEESTDANGYVEKIGIPSALIDRAFGLSLKEALKKGEEVVIKLDWTESMPHPDQRVEYELWTNSNDECGIRCDEQMNFVKNFKGHAQILERGGYTLFTPHYITWYCPRAFILSSQCKSQCINHGRYCAPDPEQDFGEGYQGKDVVFENLRQLCVHRVANESNRSWVWWDYVTDFHIRCSMKEKRYSKECAEEVMKSLDLPIEKIRKCIGDPEADVENEVLKTEQEFQVGRGSRGDVTILPTLVINDVQYRGKLERTAVLRAICAGFKEATEPQICLTGDLETNECLERNGGCWQDTQANITACKDTFRGRLCECPIVKGVQYRGDGYISCQAYGPARCSINNGGCWSDTKNGLTFSACSESQITGCHCPKGFRGDGHKCEDINECKERSACQCDGCSCQNTWGGFECKCKGNLLFIKEQDACIERNGSRFGWFFTFLVLAVVVGAGVAGYSYMDSEIMAIMSQYMPLDNNHNNDVPNEAQPLRHGSSV
cEEEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEEEccEEEEcccccccccccccccccccccccEEEEEEEEEcccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccccccEEEEEcHHHHHHHHHHHcccEEEEEEEEEEccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEccEEEEEEccccccccHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccEEEcccHHHHHHcccccHHHHHHHccccccccccccccHHHHHHcccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccEEEcccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHccccEEccccccHHHHHHHHHccccccccccccccccccccccccc
ccEEEEcccccccccHHHHHHHHHHHHHHHHHcccEEEEEccEEEEccHHHcccccEHHHcccccccccEEEEEEEEccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccEEEcEEEEEccHHHHHHHHHHcccEEEEEEEcHHccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHccccEEEccEEEEEEccccccccHHHHHHccccccEcccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHccccHHHHHHHHHHccccHHHHHHHccccccccccHHHHHHHHHHHcccccccEEEEEEEEEEccEEcccccHHHHHHHHHHcccccccccccccccccccHHcccccccccccccccEEEEccccccEEEccccccEEEcccccEEEEcccccccEccccccccccccccEEEEEEccccEEEEccccccccccEEcccHHHcccccccccccEEEcccccEEEEccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHccccc
MMMMMITCMASSLSKKLTALLLILTVVFSSsvsarfvvekssirvlhpqslrskhdsaignfgipdyggfmvgsviypdkgasgcqpfegdkpfkskfprptvllldrgECYFALKVWHGQQAGAAAVLVAdsvdeplitmdspeestdangyvekigipsALIDRAFGLSLKEALKKGEEVVIKldwtesmphpdqrveyelwtnsndecgircdEQMNFVKNFKGHAQILerggytlftphyitwycprafilssqcksqcinhgrycapdpeqdfgegyqgkdvVFENLRQLCVHRVAnesnrswvwWDYVTDFHIRCSMKEKRYSKECAEEVMKSLDLPIEKIRKcigdpeadvENEVLKTEQEfqvgrgsrgdvtilptlvindvqyrgKLERTAVLRAICAGfkeatepqicltgdletneclernggcwqdtqaNITACKdtfrgrlcecpivkgvqyrgdgyiscqaygparcsinnggcwsdtkngltfsacsesqitgchcpkgfrgdghkcedineckersacqcdgcscqntwggfeckckgnllfikEQDAcierngsrfgwFFTFLVLAVVVGAGVAGYSYMDSEIMAIMSQympldnnhnndvpneaqplrhgssv
MMMMMITCMASSLSKKLTALLLILTVVFSSSVSARFVVEkssirvlhpqslrskhdsaIGNFGIPDYGGFMVGSVIYPDKGASGCQPfegdkpfkskfPRPTVLLLDRGECYFALKVWHGQQAGAAAVLVADSVDEPLITMdspeestdangyVEKIGIPSALIDRAFGLSLKEALKKGEEVVIKldwtesmphpdqRVEYELWTNSNDECGIRCDEQMNFVKNFKGHAQILERGGYTLFTPHYITWYCPRAFILSSQCKSQCINHGRYCAPDPEQDFGEGYQGKDVVFENLRQLCVHRvanesnrswvwwDYVTDFHIRCSMKEKRYSKECAEEVMksldlpieKIRKCIGDPEADVENEVLKTeqefqvgrgsrgdvtilptlvindvqyrgKLERTAVLRAICAGFKEATEPQICLTGDLETNECLERNGGCWQDTQANITACKDTFRGRLCECPIVKGVQYRGDGYISCQAYGPARCSINNGGCWSDTKNGLTFSACSESQITGCHCPKGFRGDGHKCEDINECKERSACQCDGCSCQNTWGGFECKCKGNLLFIKEQDACIERNGSRFGWFFTFLVLAVVVGAGVAGYSYMDSEIMAIMSQYMPLDNNHNNDVPneaqplrhgssv
mmmmmITCMasslskkltallliltvvfsssvsarfvvEKSSIRVLHPQSLRSKHDSAIGNFGIPDYGGFMVGSVIYPDKGASGCQPFEGDKPFKSKFPRPTVLLLDRGECYFALKVWHgqqagaaavlvaDSVDEPLITMDSPEESTDANGYVEKIGIPSALIDRAFGLSLKEALKKGEEVVIKLDWTESMPHPDQRVEYELWTNSNDECGIRCDEQMNFVKNFKGHAQILERGGYTLFTPHYITWYCPRAFILSSQCKSQCINHGRYCAPDPEQDFGEGYQGKDVVFENLRQLCVHRVANESNRSWVWWDYVTDFHIRCSMKEKRYSKECAEEVMKSLDLPIEKIRKCIGDPEADVENEVLKTEQEFQVGRGSRGDVTILPTLVINDVQYRGKLERTAVLRAICAGFKEATEPQICLTGDLETNECLERNGGCWQDTQANITACKDTFRGRLCECPIVKGVQYRGDGYISCQAYGPARCSINNGGCWSDTKNGLTFSACSESQITGCHCPKGFRGDGHKCEDINECKERSACQCDGCSCQNTWGGFECKCKGNLLFIKEQDACIERNGSRFGWFFTFlvlavvvgagvagYSYMDSEIMAIMSQYMPLDNNHNNDVPNEAQPLRHGSSV
****MITCMASSLSKKLTALLLILTVVFSSSVSARFVVEKSSIRVLHPQSLR*KHDSAIGNFGIPDYGGFMVGSVIYPDKGASGCQPFE****FKSKFPRPTVLLLDRGECYFALKVWHGQQAGAAAVLVADSVDEPLI***********NGYVEKIGIPSALIDRAFGLSLKEALKKGEEVVIKLDWTESMPHPDQRVEYELWTNSNDECGIRCDEQMNFVKNFKGHAQILERGGYTLFTPHYITWYCPRAFILSSQCKSQCINHGRYCAPDPEQDFGEGYQGKDVVFENLRQLCVHRVANESNRSWVWWDYVTDFHIRCSMKEKRYSKECAEEVMKSLDLPIEKIRKCIGDPEADVENEVLKTEQEFQVGRGSRGDVTILPTLVINDVQYRGKLERTAVLRAICAGFKEATEPQICLTGDLETNECLERNGGCWQDTQANITACKDTFRGRLCECPIVKGVQYRGDGYISCQAYGPARCSINNGGCWSDTKNGLTFSACSESQITGCHCPKGFRGDGHKCEDINECKERSACQCDGCSCQNTWGGFECKCKGNLLFIKEQDACIERNGSRFGWFFTFLVLAVVVGAGVAGYSYMDSEIMAIMSQYM***********************
*MMMMI*CMASSLSKKLTALLLILTVVFSSSVSARFVVEKSSIRVLHPQSLRSKHDSAIGNFGIPDYGGFMVGSVIYPDKGASGCQPFEGDKPFKSKFPRPTVLLLDRGECYFALKVWHGQQAGAAAVLVADSVDEPLITMDSPE******GYVEKIGIPSALIDRAFGLSLKEALKKGEEVVIKLDWTESMPHPDQRVEYELWTNSNDECGIRCDEQMNFVKNFKGHAQILERGGYTLFTPHYITWYCPRAFILSSQCKSQCINHGRYCAPDPEQDFGEGYQGKDVVFENLRQLCVHRVANESNRSWVWWDYVTDFHIRCSMKEKRYSKECAEEVMKSLDLPIEKIRKCIGDPEADVENEVLKTEQEFQVGRGSRGDVTILPTLVINDVQYRGKLERTAVLRAICAGFKEATEPQICLTGDLETNECLERNGGCWQDTQANITACKDTFRGRLCECPIVKGVQYRGDGYISCQAYGPARCSINNGGCWSDTKNGLTFSACSESQITGCHCPKGFRGDGHKCEDINECKERSACQCDGCSCQNTWGGFECKCKGNLLFIKEQDACIERNGSRFGWFFTFLVLAVVVGAGVAGYSYMDSEIMAIMSQYM***********************
MMMMMITCMASSLSKKLTALLLILTVVFSSSVSARFVVEKSSIRVLHPQSLRSKHDSAIGNFGIPDYGGFMVGSVIYPDKGASGCQPFEGDKPFKSKFPRPTVLLLDRGECYFALKVWHGQQAGAAAVLVADSVDEPLITMDSPEESTDANGYVEKIGIPSALIDRAFGLSLKEALKKGEEVVIKLDWTESMPHPDQRVEYELWTNSNDECGIRCDEQMNFVKNFKGHAQILERGGYTLFTPHYITWYCPRAFILSSQCKSQCINHGRYCAPDPEQDFGEGYQGKDVVFENLRQLCVHRVANESNRSWVWWDYVTDFHIRCSMKEKRYSKECAEEVMKSLDLPIEKIRKCIGDPEADVENEVLKTEQEFQVGRGSRGDVTILPTLVINDVQYRGKLERTAVLRAICAGFKEATEPQICLTGDLETNECLERNGGCWQDTQANITACKDTFRGRLCECPIVKGVQYRGDGYISCQAYGPARCSINNGGCWSDTKNGLTFSACSESQITGCHCPKGFRGDGHKCEDINECKERSACQCDGCSCQNTWGGFECKCKGNLLFIKEQDACIERNGSRFGWFFTFLVLAVVVGAGVAGYSYMDSEIMAIMSQYMPLDNNHNNDVPNEA*********
*MMMMITCMASSLSKKLTALLLILTVVFSSSVSARFVVEKSSIRVLHPQSLRSKHDSAIGNFGIPDYGGFMVGSVIYPDKGASGCQPFEGDKPFKSKFPRPTVLLLDRGECYFALKVWHGQQAGAAAVLVADSVDEPLITMDSPEESTDANGYVEKIGIPSALIDRAFGLSLKEALKKGEEVVIKLDWTESMPHPDQRVEYELWTNSNDECGIRCDEQMNFVKNFKGHAQILERGGYTLFTPHYITWYCPRAFILSSQCKSQCINHGRYCAPDPEQDFGEGYQGKDVVFENLRQLCVHRVANESNRSWVWWDYVTDFHIRCSMKEKRYSKECAEEVMKSLDLPIEKIRKCIGDPEADVENEVLKTEQEFQVGRGSRGDVTILPTLVINDVQYRGKLERTAVLRAICAGFKEATEPQICLTGDLETNECLERNGGCWQDTQANITACKDTFRGRLCECPIVKGVQYRGDGYISCQAYGPARCSINNGGCWSDTKNGLTFSACSESQITGCHCPKGFRGDGHKCEDINECKERSACQCDGCSCQNTWGGFECKCKGNLLFIKEQDACIERNGSRFGWFFTFLVLAVVVGAGVAGYSYMDSEIMAIMSQYMPLD********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMMMMITCMASSLSKKLTALLLILTVVFSSSVSARFVVEKSSIRVLHPQSLRSKHDSAIGNFGIPDYGGFMVGSVIYPDKGASGCQPFEGDKPFKSKFPRPTVLLLDRGECYFALKVWHGQQAGAAAVLVADSVDEPLITMDSPEESTDANGYVEKIGIPSALIDRAFGLSLKEALKKGEEVVIKLDWTESMPHPDQRVEYELWTNSNDECGIRCDEQMNFVKNFKGHAQILERGGYTLFTPHYITWYCPRAFILSSQCKSQCINHGRYCAPDPEQDFGEGYQGKDVVFENLRQLCVHRVANESNRSWVWWDYVTDFHIRCSMKEKRYSKECAEEVMKSLDLPIEKIRKCIGDPEADVENEVLKTEQEFQVGRGSRGDVTILPTLVINDVQYRGKLERTAVLRAICAGFKEATEPQICLTGDLETNECLERNGGCWQDTQANITACKDTFRGRLCECPIVKGVQYRGDGYISCQAYGPARCSINNGGCWSDTKNGLTFSACSESQITGCHCPKGFRGDGHKCEDINECKERSACQCDGCSCQNTWGGFECKCKGNLLFIKEQDACIERNGSRFGWFFTFLVLAVVVGAGVAGYSYMDSEIMAIMSQYMPLDNNHNNDVPNEAQPLRHGSSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query631 2.2.26 [Sep-21-2011]
Q9FYH7631 Vacuolar-sorting receptor yes no 0.944 0.944 0.729 0.0
Q8L7E3625 Vacuolar-sorting receptor no no 0.960 0.969 0.726 0.0
O64758618 Vacuolar-sorting receptor no no 0.957 0.977 0.636 0.0
P93484623 Vacuolar-sorting receptor N/A no 0.960 0.972 0.614 0.0
O80977628 Vacuolar-sorting receptor no no 0.925 0.929 0.624 0.0
Q56ZQ3628 Vacuolar-sorting receptor no no 0.925 0.929 0.621 0.0
P93026623 Vacuolar-sorting receptor no no 0.939 0.951 0.607 0.0
O22925625 Vacuolar-sorting receptor no no 0.957 0.966 0.571 0.0
Q9JJS0 997 Signal peptide, CUB and E no no 0.115 0.073 0.370 5e-06
Q8IWY4 988 Signal peptide, CUB and E yes no 0.182 0.116 0.324 6e-06
>sp|Q9FYH7|VSR6_ARATH Vacuolar-sorting receptor 6 OS=Arabidopsis thaliana GN=VSR6 PE=2 SV=3 Back     alignment and function desciption
 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/607 (72%), Positives = 529/607 (87%), Gaps = 11/607 (1%)

Query: 19  ALLLILTVVFSSSVSARFVVEKSSIRVLHPQSLRSKHDSAIGNFGIPDYGGFMVGSVIYP 78
           AL L LT+V +  V  RF+VEKSS+ +L+P ++RSKHD+AI NFG+P+YGG+M+GSV+Y 
Sbjct: 11  ALFLALTMVVNG-VFGRFIVEKSSVTILNPLAMRSKHDAAIANFGVPNYGGYMIGSVVYA 69

Query: 79  DKGASGCQPFEGDKPFKSKFPRPTVLLLDRGECYFALKVWHGQQAGAAAVLVADSVDEPL 138
            +GA GC  F  DK FK KFPRPT+L++DRGECYFALKVW+GQQ+G AAVLVAD+VDEPL
Sbjct: 70  GQGAYGCDSF--DKTFKPKFPRPTILIIDRGECYFALKVWNGQQSGVAAVLVADNVDEPL 127

Query: 139 ITMDSPEESTDANGYVEKIGIPSALIDRAFGLSLKEALKKGEEVVIKLDWTESMPHPDQR 198
           ITMDSPEES +A+ ++EK+ IPSALID +F  +LK+ALKKGEEVV+K+DW+ES+PHPD+R
Sbjct: 128 ITMDSPEESKEADDFIEKLNIPSALIDFSFANTLKQALKKGEEVVLKIDWSESLPHPDER 187

Query: 199 VEYELWTNSNDECGIRCDEQMNFVKNFKGHAQILERGGYTLFTPHYITWYCPRAFILSSQ 258
           VEYELWTN+NDECG RCDEQMNFVKNFKGHAQILE+GGY+LFTPHYITW+CP+ ++ S+Q
Sbjct: 188 VEYELWTNTNDECGARCDEQMNFVKNFKGHAQILEKGGYSLFTPHYITWFCPKDYVSSNQ 247

Query: 259 CKSQCINHGRYCAPDPEQDFGEGYQGKDVVFENLRQLCVHRVANESNRSWVWWDYVTDFH 318
           CKSQCIN GRYCAPDPEQDFG+GY GKD+VFENLRQLCVH+VA E+NRSWVWWDYVTDFH
Sbjct: 248 CKSQCINQGRYCAPDPEQDFGDGYDGKDIVFENLRQLCVHKVAKENNRSWVWWDYVTDFH 307

Query: 319 IRCSMKEKRYSKECAEEVMKSLDLPIEKIRKCIGDPEADVENEVLKTEQEFQVGRGSRGD 378
           IRCSMKEK+YSKECAE V++SL LP++KI+KCIGDP+A+VENEVLK EQ  QVG+G RGD
Sbjct: 308 IRCSMKEKKYSKECAERVVESLGLPLDKIKKCIGDPDANVENEVLKAEQALQVGQGDRGD 367

Query: 379 VTILPTLVINDVQYRGKLERTAVLRAICAGFKEATEPQICLTGDLETNECLERNGGCWQD 438
           VTILPTL++N+ QYRGKLER AVL+AIC+GFKE TEP ICL+GD+ETNECLE NGGCW+D
Sbjct: 368 VTILPTLIVNNAQYRGKLERNAVLKAICSGFKERTEPGICLSGDIETNECLEANGGCWED 427

Query: 439 TQANITACKDTFRGRLCECPIVKGVQYRGDGYISCQAYGPARCSINNGGCWSDTKNGLTF 498
            ++N+TACKDTFRGR+CECP+V GVQY+GDGY SC+ YGPARCSIN GGCWS+TK GLTF
Sbjct: 428 KKSNVTACKDTFRGRVCECPVVNGVQYKGDGYTSCEPYGPARCSINQGGCWSETKKGLTF 487

Query: 499 SACSESQITGCHCPKGFRGDGHKCEDINECKERSACQCDGCSCQNTWGGFECKCKGNLLF 558
           SACS  + +GC CP GF+GDG KCEDI+ECKE+SACQCDGC+C+N WGGFECKC GN L+
Sbjct: 488 SACSNLETSGCRCPPGFKGDGLKCEDIDECKEQSACQCDGCNCKNKWGGFECKCSGNRLY 547

Query: 559 IKEQDACIERNGSRFGWFFTFLVLAVVVGAGVAGY--------SYMDSEIMAIMSQYMPL 610
           +KEQD CIER+GSR GWF TF++LA V    V GY        SYMDSEIMAIMSQYMPL
Sbjct: 548 MKEQDTCIERSGSRIGWFPTFVILAAVASICVGGYVFYKYRLRSYMDSEIMAIMSQYMPL 607

Query: 611 DNNHNND 617
           ++ +  D
Sbjct: 608 ESQNTTD 614
Vacuolar-sorting receptor (VSR) involved in clathrin-coated vesicles sorting from Golgi apparatus to vacuoles.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8L7E3|VSR7_ARATH Vacuolar-sorting receptor 7 OS=Arabidopsis thaliana GN=VSR7 PE=2 SV=2 Back     alignment and function description
>sp|O64758|VSR5_ARATH Vacuolar-sorting receptor 5 OS=Arabidopsis thaliana GN=VSR5 PE=2 SV=1 Back     alignment and function description
>sp|P93484|VSR1_PEA Vacuolar-sorting receptor 1 OS=Pisum sativum GN=BP80 PE=1 SV=1 Back     alignment and function description
>sp|O80977|VSR3_ARATH Vacuolar-sorting receptor 3 OS=Arabidopsis thaliana GN=VSR3 PE=2 SV=1 Back     alignment and function description
>sp|Q56ZQ3|VSR4_ARATH Vacuolar-sorting receptor 4 OS=Arabidopsis thaliana GN=VSR4 PE=2 SV=2 Back     alignment and function description
>sp|P93026|VSR1_ARATH Vacuolar-sorting receptor 1 OS=Arabidopsis thaliana GN=VSR1 PE=1 SV=2 Back     alignment and function description
>sp|O22925|VSR2_ARATH Vacuolar-sorting receptor 2 OS=Arabidopsis thaliana GN=VSR2 PE=2 SV=1 Back     alignment and function description
>sp|Q9JJS0|SCUB2_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Mus musculus GN=Scube2 PE=2 SV=1 Back     alignment and function description
>sp|Q8IWY4|SCUB1_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens GN=SCUBE1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query631
297738038 1197 unnamed protein product [Vitis vinifera] 0.988 0.521 0.788 0.0
359472782630 PREDICTED: vacuolar-sorting receptor 7-l 0.971 0.973 0.799 0.0
224075371630 predicted protein [Populus trichocarpa] 0.985 0.987 0.787 0.0
224053657642 predicted protein [Populus trichocarpa] 0.965 0.948 0.761 0.0
356532605624 PREDICTED: vacuolar-sorting receptor 7-l 0.974 0.985 0.770 0.0
356556144628 PREDICTED: vacuolar-sorting receptor 7-l 0.946 0.950 0.784 0.0
297846064631 hypothetical protein ARALYDRAFT_313733 [ 0.947 0.947 0.732 0.0
15221538631 vacuolar sorting receptor 6 [Arabidopsis 0.944 0.944 0.729 0.0
15235296625 vacuolar-sorting receptor 7 [Arabidopsis 0.960 0.969 0.726 0.0
297804128625 hypothetical protein ARALYDRAFT_492857 [ 0.960 0.969 0.722 0.0
>gi|297738038|emb|CBI27239.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1089 bits (2817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/635 (78%), Positives = 573/635 (90%), Gaps = 11/635 (1%)

Query: 8    CMASSLS--KKLTALLLILTVVFSSSVSARFVVEKSSIRVLHPQSLRSKHDSAIGNFGIP 65
            CM SS++  +    L L++ +V       RFVVEK+SI VL P  +RSKHD AIGNFGIP
Sbjct: 563  CMVSSMAGLRHQLGLFLVVGMVVMRCAWGRFVVEKNSISVLAPLDMRSKHDGAIGNFGIP 622

Query: 66   DYGGFMVGSVIYPDKGASGCQPFEGDKPFKSKFPRPTVLLLDRGECYFALKVWHGQQAGA 125
            +YGG MVGSV+YP KG+ GC PFEGDKPFKS+    T+LLLDRGECYFALK W+ QQAGA
Sbjct: 623  EYGGSMVGSVVYPQKGSFGCVPFEGDKPFKSRSSPTTILLLDRGECYFALKAWNAQQAGA 682

Query: 126  AAVLVADSVDEPLITMDSPEESTDANGYVEKIGIPSALIDRAFGLSLKEALKKGEEVVIK 185
            AAVLVADS+DEPLITMDSPEESTD++GYVEK+ IPSALIDRAFG +LK+ALKKG++V++K
Sbjct: 683  AAVLVADSIDEPLITMDSPEESTDSDGYVEKLRIPSALIDRAFGENLKQALKKGQDVLVK 742

Query: 186  LDWTESMPHPDQRVEYELWTNSNDECGIRCDEQMNFVKNFKGHAQILERGGYTLFTPHYI 245
            LDWTESMPHPD+RVEYELWTNSNDECG RCDEQMNFV+NFKGHAQILE+ GYT FTPHYI
Sbjct: 743  LDWTESMPHPDERVEYELWTNSNDECGTRCDEQMNFVQNFKGHAQILEKLGYTQFTPHYI 802

Query: 246  TWYCPRAFILSSQCKSQCINHGRYCAPDPEQDFGEGYQGKDVVFENLRQLCVHRVANESN 305
            TWYCP+AF+LS+QCKSQCINHGRYCAPDPEQ+FGEGYQGKDVVFENLRQLCVHRVANESN
Sbjct: 803  TWYCPQAFVLSNQCKSQCINHGRYCAPDPEQNFGEGYQGKDVVFENLRQLCVHRVANESN 862

Query: 306  RSWVWWDYVTDFHIRCSMKEKRYSKECAEEVMKSLDLPIEKIRKCIGDPEADVENEVLKT 365
            RSWVWWDYVTDFHIRCSMKEKRYSKECAE+VMKSLDLPI+KI+KC+G+PEADV+NEVLKT
Sbjct: 863  RSWVWWDYVTDFHIRCSMKEKRYSKECAEDVMKSLDLPIDKIKKCMGNPEADVDNEVLKT 922

Query: 366  EQEFQVGRGSRGDVTILPTLVINDVQYRGKLERTAVLRAICAGFKEATEPQICLTGDLET 425
            EQE QVGRGSRGDVTILPTLV+N++QYRGKLERTAVL+AICAGFKE TEPQ+CL+GDLET
Sbjct: 923  EQELQVGRGSRGDVTILPTLVVNNIQYRGKLERTAVLKAICAGFKETTEPQVCLSGDLET 982

Query: 426  NECLERNGGCWQDTQANITACKDTFRGRLCECPIVKGVQYRGDGYISCQAYGPARCSINN 485
            NECLER+GGCW D+++NITACKDT+RGR+C+CP+V GVQYRGDGY+SC+A+GPARC++NN
Sbjct: 983  NECLERHGGCWHDSRSNITACKDTYRGRVCKCPVVDGVQYRGDGYVSCEAFGPARCAMNN 1042

Query: 486  GGCWSDTKNGLTFSACSESQITGCHCPKGFRGDGHKCEDINECKERSACQCDGCSCQNTW 545
            GGCWSDTKNG TFSACS+S++TGC CP GF+GDGHKCED+NECKER ACQCDGC+C+NTW
Sbjct: 1043 GGCWSDTKNGKTFSACSDSEVTGCQCPHGFQGDGHKCEDVNECKERLACQCDGCTCKNTW 1102

Query: 546  GGFECKCKGNLLFIKEQDACIERNGSRFGWFFTFLVLAVVVGAGVAGY--------SYMD 597
            GG++CKCKGNLL+I EQD CIER+GS+FGW   FLVLA +VGAG+AGY        SYMD
Sbjct: 1103 GGYDCKCKGNLLYIMEQDTCIERSGSKFGWSLGFLVLAALVGAGIAGYIFYKYRLRSYMD 1162

Query: 598  SEIMAIMSQYMPLDN-NHNNDVPNEAQPLRHGSSV 631
            SEIMAIMSQYMPLDN N+NN+VP EAQ LR GSSV
Sbjct: 1163 SEIMAIMSQYMPLDNHNNNNEVPTEAQALRPGSSV 1197

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359472782|ref|XP_002275462.2| PREDICTED: vacuolar-sorting receptor 7-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224075371|ref|XP_002304606.1| predicted protein [Populus trichocarpa] gi|222842038|gb|EEE79585.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224053657|ref|XP_002297915.1| predicted protein [Populus trichocarpa] gi|222845173|gb|EEE82720.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356532605|ref|XP_003534862.1| PREDICTED: vacuolar-sorting receptor 7-like [Glycine max] Back     alignment and taxonomy information
>gi|356556144|ref|XP_003546387.1| PREDICTED: vacuolar-sorting receptor 7-like [Glycine max] Back     alignment and taxonomy information
>gi|297846064|ref|XP_002890913.1| hypothetical protein ARALYDRAFT_313733 [Arabidopsis lyrata subsp. lyrata] gi|297336755|gb|EFH67172.1| hypothetical protein ARALYDRAFT_313733 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15221538|ref|NP_174375.1| vacuolar sorting receptor 6 [Arabidopsis thaliana] gi|374095475|sp|Q9FYH7.3|VSR6_ARATH RecName: Full=Vacuolar-sorting receptor 6; Short=AtVSR6; AltName: Full=BP80-like protein d; Short=AtBP80d; AltName: Full=Epidermal growth factor receptor-like protein 6; Short=AtELP6; Flags: Precursor gi|332193170|gb|AEE31291.1| vacuolar sorting receptor 6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15235296|ref|NP_193744.1| vacuolar-sorting receptor 7 [Arabidopsis thaliana] gi|71153407|sp|Q8L7E3.2|VSR7_ARATH RecName: Full=Vacuolar-sorting receptor 7; Short=AtVSR7; AltName: Full=BP80-like protein f; Short=AtBP80f; AltName: Full=Epidermal growth factor receptor-like protein 3; Short=AtELP3; Flags: Precursor gi|332658876|gb|AEE84276.1| vacuolar-sorting receptor 7 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297804128|ref|XP_002869948.1| hypothetical protein ARALYDRAFT_492857 [Arabidopsis lyrata subsp. lyrata] gi|297315784|gb|EFH46207.1| hypothetical protein ARALYDRAFT_492857 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query631
TAIR|locus:2015726631 VSR6 "VACUOLAR SORTING RECEPTO 0.923 0.923 0.707 5.4e-253
TAIR|locus:2044782618 VSR5 "VACUOLAR SORTING RECEPTO 0.909 0.928 0.628 1.6e-219
TAIR|locus:2046911628 VSR3 "vaculolar sorting recept 0.916 0.920 0.603 7.2e-210
TAIR|locus:2046931628 VSR4 "vacuolar sorting recepto 0.916 0.920 0.600 2.4e-209
TAIR|locus:2085136623 VSR1 "vacuolar sorting recepto 0.916 0.927 0.592 6.2e-204
UNIPROTKB|F1NP23 1239 NID1 "Uncharacterized protein" 0.226 0.115 0.343 3.5e-09
UNIPROTKB|H0Y4Y9175 SCUBE1 "Signal peptide, CUB an 0.206 0.742 0.312 3.6e-09
UNIPROTKB|H0YDN3172 SCUBE2 "Signal peptide, CUB an 0.172 0.633 0.354 7.5e-09
UNIPROTKB|H0YEB3192 SCUBE2 "Signal peptide, CUB an 0.172 0.567 0.354 7.5e-09
ZFIN|ZDB-GENE-050302-80 1010 scube2 "signal peptide, CUB do 0.174 0.108 0.371 1.5e-08
TAIR|locus:2015726 VSR6 "VACUOLAR SORTING RECEPTOR 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2436 (862.6 bits), Expect = 5.4e-253, P = 5.4e-253
 Identities = 420/594 (70%), Positives = 502/594 (84%)

Query:    39 EKSSIRVLHPQSLRSKHDSAIGNFGIPDYGGFMVGSVIYPDKGASGCQPFEGDKPFKSKF 98
             EKSS+ +L+P ++RSKHD+AI NFG+P+YGG+M+GSV+Y  +GA GC  F  DK FK KF
Sbjct:    30 EKSSVTILNPLAMRSKHDAAIANFGVPNYGGYMIGSVVYAGQGAYGCDSF--DKTFKPKF 87

Query:    99 PRPTVLLLDRGECYFALKVWHXXXXXXXXXXXXDSVDEPLITMDSPEESTDANGYVEKIG 158
             PRPT+L++DRGECYFALKVW+            D+VDEPLITMDSPEES +A+ ++EK+ 
Sbjct:    88 PRPTILIIDRGECYFALKVWNGQQSGVAAVLVADNVDEPLITMDSPEESKEADDFIEKLN 147

Query:   159 IPSALIDRAFGLSLKEALKKGEEVVIKLDWTESMPHPDQRVEYELWTNSNDECGIRCDEQ 218
             IPSALID +F  +LK+ALKKGEEVV+K+DW+ES+PHPD+RVEYELWTN+NDECG RCDEQ
Sbjct:   148 IPSALIDFSFANTLKQALKKGEEVVLKIDWSESLPHPDERVEYELWTNTNDECGARCDEQ 207

Query:   219 MNFVKNFKGHAQILERGGYTLFTPHYITWYCPRAFILSSQCKSQCINHGRYCAPDPEQDF 278
             MNFVKNFKGHAQILE+GGY+LFTPHYITW+CP+ ++ S+QCKSQCIN GRYCAPDPEQDF
Sbjct:   208 MNFVKNFKGHAQILEKGGYSLFTPHYITWFCPKDYVSSNQCKSQCINQGRYCAPDPEQDF 267

Query:   279 GEGYQGKDVVFENLRQLCVHRVANESNRSWVWWDYVTDFHIRCSMKEKRYSKECAEEVMK 338
             G+GY GKD+VFENLRQLCVH+VA E+NRSWVWWDYVTDFHIRCSMKEK+YSKECAE V++
Sbjct:   268 GDGYDGKDIVFENLRQLCVHKVAKENNRSWVWWDYVTDFHIRCSMKEKKYSKECAERVVE 327

Query:   339 SLDLPIEKIRKCIGDPEADVENEVLKTEQEFQVGRGSRGDVTILPTLVINDVQYRGKLER 398
             SL LP++KI+KCIGDP+A+VENEVLK EQ  QVG+G RGDVTILPTL++N+ QYRGKLER
Sbjct:   328 SLGLPLDKIKKCIGDPDANVENEVLKAEQALQVGQGDRGDVTILPTLIVNNAQYRGKLER 387

Query:   399 TAVLRAICAGFKEATEPQICLTGDLETNECLERNGGCWQDTQANITACKDTFRGRLCECP 458
              AVL+AIC+GFKE TEP ICL+GD+ETNECLE NGGCW+D ++N+TACKDTFRGR+CECP
Sbjct:   388 NAVLKAICSGFKERTEPGICLSGDIETNECLEANGGCWEDKKSNVTACKDTFRGRVCECP 447

Query:   459 IVKGVQYRGDGYISCQAYGPARCSINNGGCWSDTKNGLTFSACSESQITGCHCPKGFRGD 518
             +V GVQY+GDGY SC+ YGPARCSIN GGCWS+TK GLTFSACS  + +GC CP GF+GD
Sbjct:   448 VVNGVQYKGDGYTSCEPYGPARCSINQGGCWSETKKGLTFSACSNLETSGCRCPPGFKGD 507

Query:   519 GHKCEDINECKERSACQCDGCSCQNTWGGFECKCKGNLLFIKEQDACIERNGSRFGWFFT 578
             G KCEDI+ECKE+SACQCDGC+C+N WGGFECKC GN L++KEQD CIER+GSR GWF T
Sbjct:   508 GLKCEDIDECKEQSACQCDGCNCKNKWGGFECKCSGNRLYMKEQDTCIERSGSRIGWFPT 567

Query:   579 FXXXXXXXXXXXXXY--------SYMDSEIMAIMSQYMPLDNNHNND-VPNEAQ 623
             F             Y        SYMDSEIMAIMSQYMPL++ +  D +  E+Q
Sbjct:   568 FVILAAVASICVGGYVFYKYRLRSYMDSEIMAIMSQYMPLESQNTTDPMTGESQ 621
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=ISM
GO:0005887 "integral to plasma membrane" evidence=ISS
GO:0006623 "protein targeting to vacuole" evidence=ISS;TAS
GO:0017119 "Golgi transport complex" evidence=IPI
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009749 "response to glucose stimulus" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
TAIR|locus:2044782 VSR5 "VACUOLAR SORTING RECEPTOR 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046911 VSR3 "vaculolar sorting receptor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046931 VSR4 "vacuolar sorting receptor 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085136 VSR1 "vacuolar sorting receptor homolog 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NP23 NID1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y4Y9 SCUBE1 "Signal peptide, CUB and EGF-like domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YDN3 SCUBE2 "Signal peptide, CUB and EGF-like domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YEB3 SCUBE2 "Signal peptide, CUB and EGF-like domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050302-80 scube2 "signal peptide, CUB domain, EGF-like 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FYH7VSR6_ARATHNo assigned EC number0.72980.94450.9445yesno
P93484VSR1_PEANo assigned EC number0.61470.96030.9727N/Ano
Q8L7E3VSR7_ARATHNo assigned EC number0.72600.96030.9696nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030095001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (630 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query631
cd02125127 cd02125, PA_VSR, PA_VSR: Protease-associated (PA) 2e-61
cd00538126 cd00538, PA, PA: Protease-associated (PA) domain 2e-17
cd04818118 cd04818, PA_subtilisin_1, PA_subtilisin_1: Proteas 8e-15
cd02123153 cd02123, PA_C_RZF_like, PA_C-RZF_ like: Protease-a 2e-14
pfam0222596 pfam02225, PA, PA domain 2e-10
cd04816122 cd04816, PA_SaNapH_like, PA_SaNapH_like: Protease- 5e-08
cd02127118 cd02127, PA_hPAP21_like, PA_hPAP21_like: Protease- 6e-08
cd02133143 cd02133, PA_C5a_like, PA_C5a_like: Protease-associ 1e-07
cd02132139 cd02132, PA_GO-like, PA_GO-like: Protease-associat 1e-07
cd04813117 cd04813, PA_1, PA_1: Protease-associated (PA) doma 1e-06
cd02126126 cd02126, PA_EDEM3_like, PA_EDEM3_like: protease as 2e-06
cd02130122 cd02130, PA_ScAPY_like, PA_ScAPY_like: Protease-as 5e-06
cd02124129 cd02124, PA_PoS1_like, PA_PoS1_like: Protease-asso 1e-05
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 3e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 3e-05
cd02129120 cd02129, PA_hSPPL_like, PA_hSPPL_like: Protease-as 1e-04
pfam1266224 pfam12662, cEGF, Complement Clr-like EGF-like 0.001
>gnl|CDD|239040 cd02125, PA_VSR, PA_VSR: Protease-associated (PA) domain-containing plant vacuolar sorting receptor (VSR) Back     alignment and domain information 
 Score =  199 bits (508), Expect = 2e-61
 Identities = 78/128 (60%), Positives = 97/128 (75%), Gaps = 3/128 (2%)

Query: 61  NFGIPDYGGFMVGSVIYPDKGASGCQPFEG-DKPFKSK-FPRPTVLLLDRGECYFALKVW 118
           NFG+P YGG + G V+YP +  +GC+ F+   KP KS+   RP +LLLDRG C+F LK W
Sbjct: 1   NFGLPQYGGTLTGVVVYPKENRTGCKEFDVFFKPKKSEPGRRPVILLLDRGGCFFTLKAW 60

Query: 119 HGQQAGAAAVLVADSVDEPLITMDSPEESTDANGYVEKIGIPSALIDRAFGLSLKEALKK 178
           + QQAGAAAVLVAD+VDEPL+TMD+PEES  +  Y+EKI IPSALI +AFG  LK+A+  
Sbjct: 61  NAQQAGAAAVLVADNVDEPLLTMDTPEES-GSADYIEKITIPSALITKAFGEKLKKAISN 119

Query: 179 GEEVVIKL 186
           GE VVIKL
Sbjct: 120 GEMVVIKL 127

This group includes various PA domain-containing VSRs such as garden pea BP-80, pumpkin PV72, and various Arabidopsis VSRs including AtVSR1. In contrast to most eukaryotes, which only have one or two VSRs, plants have several. This may in part be a reflection of having a more complex vacuolar system with both lytic vacuoles and storage vacuoles. The lytic vacuole is thought to be equivalent to the mammalian lysosome and the yeast vacuole. Pea BP-80 is a type 1 transmembrane protein, involved in the targeting of proteins to the lytic vacuole; it has been suggested that this protein also mediates targeting to the storage vacuole. PV72 and AtVSR1 may mediate transport of seed storage proteins to protein storage vacuoles. The significance of the PA domain to VSRs has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Length = 127
>gnl|CDD|238300 cd00538, PA, PA: Protease-associated (PA) domain Back     alignment and domain information
>gnl|CDD|240122 cd04818, PA_subtilisin_1, PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1 Back     alignment and domain information
>gnl|CDD|239038 cd02123, PA_C_RZF_like, PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like Back     alignment and domain information
>gnl|CDD|216938 pfam02225, PA, PA domain Back     alignment and domain information
>gnl|CDD|240120 cd04816, PA_SaNapH_like, PA_SaNapH_like: Protease-associated domain containing proteins like Streptomyces anulatus N-acetylpuromycin N-acetylhydrolase (SaNapH) Back     alignment and domain information
>gnl|CDD|239042 cd02127, PA_hPAP21_like, PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa) Back     alignment and domain information
>gnl|CDD|239048 cd02133, PA_C5a_like, PA_C5a_like: Protease-associated domain containing proteins like Streptococcus pyogenes C5a peptidase Back     alignment and domain information
>gnl|CDD|239047 cd02132, PA_GO-like, PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10 Back     alignment and domain information
>gnl|CDD|240117 cd04813, PA_1, PA_1: Protease-associated (PA) domain subgroup 1 Back     alignment and domain information
>gnl|CDD|239041 cd02126, PA_EDEM3_like, PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins Back     alignment and domain information
>gnl|CDD|239045 cd02130, PA_ScAPY_like, PA_ScAPY_like: Protease-associated domain containing proteins like Saccharomyces cerevisiae aminopeptidase Y (ScAPY) Back     alignment and domain information
>gnl|CDD|239039 cd02124, PA_PoS1_like, PA_PoS1_like: Protease-associated (PA) domain PoS1-like Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|239044 cd02129, PA_hSPPL_like, PA_hSPPL_like: Protease-associated domain containing human signal peptide peptidase-like (hSPPL)-like Back     alignment and domain information
>gnl|CDD|221695 pfam12662, cEGF, Complement Clr-like EGF-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 631
cd02125127 PA_VSR PA_VSR: Protease-associated (PA) domain-con 99.94
KOG1214 1289 consensus Nidogen and related basement membrane pr 99.86
cd02126126 PA_EDEM3_like PA_EDEM3_like: protease associated d 99.86
cd02123153 PA_C_RZF_like PA_C-RZF_ like: Protease-associated 99.86
cd02127118 PA_hPAP21_like PA_hPAP21_like: Protease-associated 99.86
cd02122138 PA_GRAIL_like PA _GRAIL_like: Protease-associated 99.85
cd02132139 PA_GO-like PA_GO-like: Protease-associated domain 99.84
cd04813117 PA_1 PA_1: Protease-associated (PA) domain subgrou 99.77
cd02129120 PA_hSPPL_like PA_hSPPL_like: Protease-associated d 99.76
cd04816122 PA_SaNapH_like PA_SaNapH_like: Protease-associated 99.74
KOG3920193 consensus Uncharacterized conserved protein, conta 99.73
cd02130122 PA_ScAPY_like PA_ScAPY_like: Protease-associated d 99.72
cd04818118 PA_subtilisin_1 PA_subtilisin_1: Protease-associat 99.71
cd02124129 PA_PoS1_like PA_PoS1_like: Protease-associated (PA 99.64
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.64
cd04817139 PA_VapT_like PA_VapT_like: Protease-associated dom 99.59
KOG2442541 consensus Uncharacterized conserved protein, conta 99.46
PF02225101 PA: PA domain; InterPro: IPR003137 The PA (Proteas 99.45
cd00538126 PA PA: Protease-associated (PA) domain. The PA dom 99.43
KOG1219 4289 consensus Uncharacterized conserved protein, conta 99.42
cd02133143 PA_C5a_like PA_C5a_like: Protease-associated domai 99.36
cd04819127 PA_2 PA_2: Protease-associated (PA) domain subgrou 99.29
cd04815134 PA_M28_2 PA_M28_2: Protease-associated (PA) domain 99.18
cd02120126 PA_subtilisin_like PA_subtilisin_like: Protease-as 98.98
cd02128183 PA_TfR PA_TfR: Protease-associated domain containi 98.93
KOG1214 1289 consensus Nidogen and related basement membrane pr 98.83
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.69
KOG4289 2531 consensus Cadherin EGF LAG seven-pass G-type recep 98.69
KOG4289 2531 consensus Cadherin EGF LAG seven-pass G-type recep 98.4
cd02121220 PA_GCPII_like PA_GCPII_like: Protease-associated d 98.38
KOG1219 4289 consensus Uncharacterized conserved protein, conta 98.38
KOG4260350 consensus Uncharacterized conserved protein [Funct 98.28
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.21
cd04822151 PA_M28_1_3 PA_M28_1_3: Protease-associated (PA) do 98.2
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 98.14
KOG4260350 consensus Uncharacterized conserved protein [Funct 98.07
cd04814142 PA_M28_1 PA_M28_1: Protease-associated (PA) domain 98.03
KOG1217 487 consensus Fibrillins and related proteins containi 98.0
cd02131153 PA_hNAALADL2_like PA_hNAALADL2_like: Protease-asso 97.99
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.95
cd04820137 PA_M28_1_1 PA_M28_1_1: Protease-associated (PA) do 97.89
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.78
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.64
PF1266224 cEGF: Complement Clr-like EGF-like 97.61
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.55
KOG1217487 consensus Fibrillins and related proteins containi 97.54
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.34
PF1266224 cEGF: Complement Clr-like EGF-like 97.14
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 96.76
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.66
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.53
smart0017939 EGF_CA Calcium-binding EGF-like domain. 96.3
smart0018135 EGF Epidermal growth factor-like domain. 95.77
cd0005336 EGF Epidermal growth factor domain, found in epide 95.71
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 95.16
PF0000832 EGF: EGF-like domain This is a sub-family of the P 94.75
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 94.15
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 94.08
cd04821157 PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) do 94.04
KOG0994 1758 consensus Extracellular matrix glycoprotein Lamini 93.53
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 92.73
KOG1225525 consensus Teneurin-1 and related extracellular mat 91.36
cd0005336 EGF Epidermal growth factor domain, found in epide 90.53
KOG2195702 consensus Transferrin receptor and related protein 88.5
smart0018135 EGF Epidermal growth factor-like domain. 88.49
KOG1225 525 consensus Teneurin-1 and related extracellular mat 87.16
KOG0994 1758 consensus Extracellular matrix glycoprotein Lamini 86.55
PHA03099139 epidermal growth factor-like protein (EGF-like pro 85.54
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 82.36
>cd02125 PA_VSR PA_VSR: Protease-associated (PA) domain-containing plant vacuolar sorting receptor (VSR) Back     alignment and domain information 
Probab=99.94  E-value=2.9e-26  Score=207.34  Aligned_cols=125  Identities=61%  Similarity=1.032  Sum_probs=105.0

Q ss_pred             CcCCCCCCCceEEEEEecCCCCCCCCCCCCCC-CCC-CCCCCCEEEEEecCccCHHHHHHHHHHcCCcEEEEEeCCCCCc
Q 006787           61 NFGIPDYGGFMVGSVIYPDKGASGCQPFEGDK-PFK-SKFPRPTVLLLDRGECYFALKVWHGQQAGAAAVLVADSVDEPL  138 (631)
Q Consensus        61 ~FG~~~~~~~i~g~lv~~~~~~~gC~~~~~~~-~~~-~~~~~~~i~LV~RG~CsF~~Kv~nAq~aGA~avII~~~~~~~~  138 (631)
                      |||.++||++++|.|++++++.+||++++... +.+ ..+..++||||+||+|+|.+|++|||++||++|||||+.++++
T Consensus         1 ~FG~~~yg~~~~G~l~~~~~~~~gC~~~~~~~~~~~~~~~~~~~IvLv~RG~C~F~~K~~~Aq~aGA~avII~n~~~~~~   80 (127)
T cd02125           1 NFGLPQYGGTLTGVVVYPKENRTGCKEFDVFFKPKKSEPGRRPVILLLDRGGCFFTLKAWNAQQAGAAAVLVADNVDEPL   80 (127)
T ss_pred             CCCCCCcCCeeEEEEEecCCccccCCCCcccccccccccCCCceEEEEECCCcCHHHHHHHHHHCCCcEEEEEECCCCcc
Confidence            79999999999999999989999999997311 111 1134589999999999999999999999999999999998878


Q ss_pred             cccCCCCCCCCcCCcccccCccEEEEeHHHHHHHHHHHHcCCEEEEEE
Q 006787          139 ITMDSPEESTDANGYVEKIGIPSALIDRAFGLSLKEALKKGEEVVIKL  186 (631)
Q Consensus       139 ~~m~~~~~~~~~~~~~~~i~IP~~~I~~~~G~~l~~~l~~g~~V~v~l  186 (631)
                      +.|..+.++. ..++..+++||++||++++|+.|++.|++|..|+|+|
T Consensus        81 ~~m~~~~~~~-~~~~~~~i~IP~v~Is~~~G~~L~~~l~~g~~V~v~~  127 (127)
T cd02125          81 LTMDTPEESG-SADYIEKITIPSALITKAFGEKLKKAISNGEMVVIKL  127 (127)
T ss_pred             ccccCccccc-ccccCCCceEeEEEECHHHHHHHHHHHhcCCeEEEeC
Confidence            8886654421 1144567899999999999999999999999999875

This group includes various PA domain-containing VSRs such as garden pea BP-80, pumpkin PV72, and various Arabidopsis VSRs including AtVSR1. In contrast to most eukaryotes, which only have one or two VSRs, plants have several. This may in part be a reflection of having a more complex vacuolar system with both lytic vacuoles and storage vacuoles. The lytic vacuole is thought to be equivalent to the mammalian lysosome and the yeast vacuole. Pea BP-80 is a type 1 transmembrane protein, involved in the targeting of proteins to the lytic vacuole; it has been suggested that this protein also mediates targeting to the storage vacuole. PV72 and AtVSR1 may mediate transport of seed storage proteins to protein storage vacuoles. The significance of the PA domain to VSRs has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may partic
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>cd02126 PA_EDEM3_like PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins Back     alignment and domain information
>cd02123 PA_C_RZF_like PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like Back     alignment and domain information
>cd02127 PA_hPAP21_like PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa) Back     alignment and domain information
>cd02122 PA_GRAIL_like PA _GRAIL_like: Protease-associated (PA) domain GRAIL-like Back     alignment and domain information
>cd02132 PA_GO-like PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10 Back     alignment and domain information
>cd04813 PA_1 PA_1: Protease-associated (PA) domain subgroup 1 Back     alignment and domain information
>cd02129 PA_hSPPL_like PA_hSPPL_like: Protease-associated domain containing human signal peptide peptidase-like (hSPPL)-like Back     alignment and domain information
>cd04816 PA_SaNapH_like PA_SaNapH_like: Protease-associated domain containing proteins like Streptomyces anulatus N-acetylpuromycin N-acetylhydrolase (SaNapH) Back     alignment and domain information
>KOG3920 consensus Uncharacterized conserved protein, contains PA domain [General function prediction only] Back     alignment and domain information
>cd02130 PA_ScAPY_like PA_ScAPY_like: Protease-associated domain containing proteins like Saccharomyces cerevisiae aminopeptidase Y (ScAPY) Back     alignment and domain information
>cd04818 PA_subtilisin_1 PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1 Back     alignment and domain information
>cd02124 PA_PoS1_like PA_PoS1_like: Protease-associated (PA) domain PoS1-like Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04817 PA_VapT_like PA_VapT_like: Protease-associated domain containing proteins like VapT from Vibrio metschnikovii strain RH530 Back     alignment and domain information
>KOG2442 consensus Uncharacterized conserved protein, contains PA domain [General function prediction only] Back     alignment and domain information
>PF02225 PA: PA domain; InterPro: IPR003137 The PA (Protease associated) domain is found as an insert domain in diverse proteases, which include the MEROPS peptidase families A22B, M28, and S8A [] Back     alignment and domain information
>cd00538 PA PA: Protease-associated (PA) domain Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>cd02133 PA_C5a_like PA_C5a_like: Protease-associated domain containing proteins like Streptococcus pyogenes C5a peptidase Back     alignment and domain information
>cd04819 PA_2 PA_2: Protease-associated (PA) domain subgroup 2 Back     alignment and domain information
>cd04815 PA_M28_2 PA_M28_2: Protease-associated (PA) domain, peptidase family M28, subfamily-2 Back     alignment and domain information
>cd02120 PA_subtilisin_like PA_subtilisin_like: Protease-associated domain containing subtilisin-like proteases Back     alignment and domain information
>cd02128 PA_TfR PA_TfR: Protease-associated domain containing proteins like transferrin receptor (TfR) Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] Back     alignment and domain information
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] Back     alignment and domain information
>cd02121 PA_GCPII_like PA_GCPII_like: Protease-associated domain containing protein, glutamate carboxypeptidase II (GCPII)-like Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>cd04822 PA_M28_1_3 PA_M28_1_3: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 3 Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd04814 PA_M28_1 PA_M28_1: Protease-associated (PA) domain, peptidase family M28, subfamily-1 Back     alignment and domain information
>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>cd02131 PA_hNAALADL2_like PA_hNAALADL2_like: Protease-associated domain containing proteins like human N-acetylated alpha-linked acidic dipeptidase-like 2 protein (hNAALADL2) Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>cd04820 PA_M28_1_1 PA_M28_1_1: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 1 Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd04821 PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 2 Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>KOG2195 consensus Transferrin receptor and related proteins containing the protease-associated (PA) domain [Posttranslational modification, protein turnover, chaperones; Inorganic ion transport and metabolism; General function prediction only] Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query631
3v65_B 386 Crystal Structure Of Agrin And Lrp4 Complex Length 5e-04
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure 
Iteration: 1

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 9/89 (10%)
Query: 477 GPARCSINNGGCWSDTKNGLTFSACSESQITGCHCPKGFRGDGHKCEDINECKERSACQC 536
           G   C++NNGGC    +       C+      CH       DG  C+D+NEC E   C  
Sbjct: 2   GEENCNVNNGGCAQKCQMIRGAVQCT------CHTGYRLTEDGRTCQDVNECAEEGYCS- 54
Query: 537 DGCSCQNTWGGFECKCKGNLLFIKEQDAC 565
               C N+ G F+C C+       ++ +C
Sbjct: 55  --QGCTNSEGAFQCWCEAGYELRPDRRSC 81

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query631
3icu_A194 E3 ubiquitin-protein ligase RNF128; E3 ligase, ene 2e-17
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 4e-13
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 3e-04
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-12
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 3e-05
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 9e-12
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 3e-11
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 1e-04
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 5e-11
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 4e-10
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 9e-05
2bou_A143 EGF-like module containing mucin-like hormone rece 6e-10
2bou_A143 EGF-like module containing mucin-like hormone rece 4e-08
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 7e-09
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 5e-07
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 2e-05
3v65_B 386 Low-density lipoprotein receptor-related protein; 6e-07
3v65_B 386 Low-density lipoprotein receptor-related protein; 7e-04
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 1e-06
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 3e-05
1xf1_A 926 C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 3e-05
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 5e-04
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 3e-05
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-04
2vh0_B134 Activated factor XA light chain; serine protease, 3e-05
2ek8_A421 Aminopeptidase; metalloproteinase, hydrolase; 1.80 6e-05
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 6e-05
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 7e-05
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-04
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-04
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-04
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 2e-04
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-04
1aut_L114 Activated protein C; serine proteinase, plasma cal 2e-04
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 3e-04
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 5e-04
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 7e-04
>3icu_A E3 ubiquitin-protein ligase RNF128; E3 ligase, energy, PA domain, transmembrane,protein turnover conjugation pathway; HET: NAG; 2.10A {Homo sapiens} Length = 194 Back     alignment and structure
 Score = 80.2 bits (197), Expect = 2e-17
 Identities = 25/146 (17%), Positives = 53/146 (36%), Gaps = 16/146 (10%)

Query: 56  DSAIGNFGIPDYGGFMVGSVIYPD--KGASGCQP---FEGDKPFKSKFPRPTVLLLDRGE 110
            S  G +G       + G ++ PD     + C P   F     + S      + L+ RG 
Sbjct: 55  LSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGG 114

Query: 111 -CYFALKVWHGQQAGAAAVLVADSVDEPLITMDSPEESTDANGYVEKIGIPSALIDRAFG 169
            C FA K+    + GA+  ++ +        +           +   + I + +I    G
Sbjct: 115 GCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMS--------HPGAVDIVAIMIGNLKG 166

Query: 170 LSLKEALKKGEEVVIKLDWTESMPHP 195
             + +++++G +V + +       H 
Sbjct: 167 TKILQSIQRGIQVTMVI--EVGKKHG 190
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Length = 926 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2ek8_A Aminopeptidase; metalloproteinase, hydrolase; 1.80A {Aneurinibacillus SP} PDB: 2ek9_A* Length = 421 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query631
3icu_A194 E3 ubiquitin-protein ligase RNF128; E3 ligase, ene 99.89
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.64
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.63
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.62
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.6
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.6
2bou_A143 EGF-like module containing mucin-like hormone rece 99.59
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.59
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.46
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.44
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.41
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.41
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.4
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.34
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.25
2bou_A143 EGF-like module containing mucin-like hormone rece 99.22
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.14
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.12
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.06
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.05
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 99.04
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.99
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.99
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.98
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.98
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.97
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.96
2vh0_B134 Activated factor XA light chain; serine protease, 98.95
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.94
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.94
3iib_A444 Peptidase M28; YP_926796.1, structural genomics, J 98.89
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.87
2ek8_A421 Aminopeptidase; metalloproteinase, hydrolase; 1.80 98.84
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.83
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.82
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.79
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.72
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.7
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.69
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.68
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.67
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.64
2vh0_B134 Activated factor XA light chain; serine protease, 98.64
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.63
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.56
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.56
3fed_A707 Glutamate carboxypeptidase III; metallopeptidase, 98.51
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.45
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.4
3kas_A640 Transferrin receptor protein 1; transferrin recept 98.4
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 98.39
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.36
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.33
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.3
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.26
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.22
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.21
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.16
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.15
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.15
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.12
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.04
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.94
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 97.93
3i6s_A649 Subtilisin-like protease; PA-domain, FN3-domain, h 97.92
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.9
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.89
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.82
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.82
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.81
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.73
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 97.71
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.71
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.69
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.61
1xf1_A 926 C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St 97.55
1y9z_A441 Alkaline serine protease; subtilisin-like alpha/be 97.53
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.51
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 97.47
1szb_A170 Mannose binding lectin-associated serine protease- 97.42
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.41
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.4
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 97.35
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.24
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.24
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.21
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.15
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 97.08
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 96.91
1ob1_C99 Major merozoite surface protein; immune system, im 96.9
1nzi_A159 Complement C1S component; calcium, innate immunity 96.89
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 96.86
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.84
2k2s_B61 Micronemal protein 6; microneme protein complex, c 96.81
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.8
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.62
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 96.6
1ob1_C99 Major merozoite surface protein; immune system, im 96.54
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 96.44
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 96.34
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.3
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 96.23
1szb_A170 Mannose binding lectin-associated serine protease- 96.22
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 96.04
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 96.02
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 95.59
1nql_B53 Epidermal growth factor; cell surface receptor, ty 95.45
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 95.43
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 95.43
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 95.4
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 95.31
1a3p_A45 Epidermal growth factor; disulfide connectivities, 95.27
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 94.97
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 94.9
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 94.6
1nzi_A159 Complement C1S component; calcium, innate immunity 94.52
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 94.42
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 94.27
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 93.98
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 93.21
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 93.15
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 92.47
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 92.38
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 92.37
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 92.21
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 91.49
1nql_B53 Epidermal growth factor; cell surface receptor, ty 89.73
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 89.73
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 88.84
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 88.78
3vta_A621 Cucumisin; subtilisin-like fold, serine protease, 88.47
3gha_A202 Disulfide bond formation protein D; BDBD, DSBA-lik 86.7
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 85.65
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 85.49
3bci_A186 Disulfide bond protein A; thiol-disulfide oxidored 85.48
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 85.22
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 85.1
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 84.87
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 84.31
1nt0_A286 MAsp2, mannose-binding protein associated serine p 82.83
3dem_A278 Complement factor MAsp-3; complement system, innat 82.73
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 81.9
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 81.77
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 81.6
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 81.25
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 81.15
>3icu_A E3 ubiquitin-protein ligase RNF128; E3 ligase, energy, PA domain, transmembrane,protein turnover conjugation pathway; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
Probab=99.89  E-value=3.9e-22  Score=190.69  Aligned_cols=144  Identities=21%  Similarity=0.323  Sum_probs=111.9

Q ss_pred             EEEeeceEEEEc--CCC---cceeecccccCcCCCCCCCceEEEEEecC--CCCCCCCCCCCCC-CC--CCCCCCCEEEE
Q 006787           36 FVVEKSSIRVLH--PQS---LRSKHDSAIGNFGIPDYGGFMVGSVIYPD--KGASGCQPFEGDK-PF--KSKFPRPTVLL  105 (631)
Q Consensus        36 ~~v~~~~~~v~~--p~~---~~~~~~~~~a~FG~~~~~~~i~g~lv~~~--~~~~gC~~~~~~~-~~--~~~~~~~~i~L  105 (631)
                      ..+.++.+.++.  |..   .........++||..++.+.+.|.|+++.  ++.+||+++++.. +.  .++...++|||
T Consensus        30 ~~~~~A~vn~sy~d~~~~~n~t~~~~~e~a~FG~~~p~~~v~G~lv~~~~~~~~~GC~~~~~~~~~~~~~~~~~~gkIaL  109 (194)
T 3icu_A           30 EAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLAL  109 (194)
T ss_dssp             SCEEEEEEEEEEECCSSCTTCEEEEEEEEEEECTTSCCSCEEEEEECBSSTTCTTCCSTTCCBCCCBCTTSSCBCCEEEE
T ss_pred             eeEEEEEEEEEEECCCCCccceeeecccccccCCCCCCCCcEEEEEecCCCCCcCCCCCCccccCCcccccccCCCeEEE
Confidence            344555555544  332   22235678899999999999999999876  4789999987221 11  11234589999


Q ss_pred             EecCc-cCHHHHHHHHHHcCCcEEEEEeCCC--CCccccCCCCCCCCcCCcccccCccEEEEeHHHHHHHHHHHHcCCEE
Q 006787          106 LDRGE-CYFALKVWHGQQAGAAAVLVADSVD--EPLITMDSPEESTDANGYVEKIGIPSALIDRAFGLSLKEALKKGEEV  182 (631)
Q Consensus       106 V~RG~-CsF~~Kv~nAq~aGA~avII~~~~~--~~~~~m~~~~~~~~~~~~~~~i~IP~~~I~~~~G~~l~~~l~~g~~V  182 (631)
                      |+||+ |+|.+|++|||++||+||||||+.+  +.+++|..++          ..+||++||++++|+.|+++|++|.+|
T Consensus       110 V~RG~~CsF~~Kv~nAq~aGA~avIIyNn~~~g~~~~~m~~~~----------~~~IPsv~Is~~~G~~L~~~L~~G~~V  179 (194)
T 3icu_A          110 IQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPG----------AVDIVAIMIGNLKGTKILQSIQRGIQV  179 (194)
T ss_dssp             EESCTTCCHHHHHHHHHHTTCSEEEEECCTTCTTCCCCCCCTT----------CCSSEEEEECHHHHHHHHHHHHTTCCE
T ss_pred             EECCCCcCHHHHHHHHHHCCCcEEEEEeCCCCCCceeeecCCC----------CCceeEEEECHHHHHHHHHHHHCCCeE
Confidence            99999 9999999999999999999999852  3557775332          247999999999999999999999999


Q ss_pred             EEEEEec
Q 006787          183 VIKLDWT  189 (631)
Q Consensus       183 ~v~l~~~  189 (631)
                      +++|.+.
T Consensus       180 tvti~vg  186 (194)
T 3icu_A          180 TMVIEVG  186 (194)
T ss_dssp             EEEEEEE
T ss_pred             EEEEECC
Confidence            9999883
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>3iib_A Peptidase M28; YP_926796.1, structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.70A {Shewanella amazonensis SB2B} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2ek8_A Aminopeptidase; metalloproteinase, hydrolase; 1.80A {Aneurinibacillus SP} PDB: 2ek9_A* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3fed_A Glutamate carboxypeptidase III; metallopeptidase, bimetallic active site, N-glycosylation, C cation, chloride anion, zinc IONS, dipept glycoprotein; HET: NAG BIX; 1.29A {Homo sapiens} PDB: 3fec_A* 3fee_A* 3ff3_A* 2c6c_A* 2c6g_A* 2c6p_A* 2cij_A* 2jbj_A* 2jbk_A* 3rbu_A* 3bi1_A* 2oot_A* 2pvv_A* 2pvw_A* 2xei_A* 2or4_A* 3bi0_A* 3bhx_A* 3d7d_A* 3d7f_A* ... Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3kas_A Transferrin receptor protein 1; transferrin receptor 1, arenavirus, cell MEMB disulfide bond, endocytosis, HOST-virus inter receptor, secreted, transmembrane; HET: NAG FUC BMA MAN; 2.40A {Homo sapiens} PDB: 1de4_C* 3s9l_A* 3s9m_A* 3s9n_A* 1cx8_A* 1suv_A 2nsu_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Back     alignment and structure
>1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo} Back     alignment and structure
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Back     alignment and structure
>3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 631
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 2e-04
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 2e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 5e-04
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 7e-04
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 9e-04
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 0.002
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 0.004
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 0.004
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 0.004
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 0.004
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Fibrillin-1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 37.0 bits (86), Expect = 2e-04
 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 2/32 (6%)

Query: 522 CEDINECKERSACQCDGCSCQNTWGGFECKCK 553
             D++ECKE   C   G  C NT G + C+C 
Sbjct: 2   AVDMDECKEPDVC-KHG-QCINTDGSYRCECP 31
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query631
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.84
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1de4c2193 Transferrin receptor ectodomain, apical domain {Hu 98.76
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.75
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.73
d1nt0a345 Mannose-binding protein associated serine protease 98.65
d1szba245 Mannose-binding protein associated serine protease 98.64
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.6
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.52
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.51
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.4
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.38
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.37
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.36
d3bi1a2233 Glutamate carboxypeptidase II {Human (Homo sapiens 98.35
d1nt0a345 Mannose-binding protein associated serine protease 98.34
d1szba245 Mannose-binding protein associated serine protease 98.33
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.32
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.23
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.23
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.21
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.17
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.11
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 98.05
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.02
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.0
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.95
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.85
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.83
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.81
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.77
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.76
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.76
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.75
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.7
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.69
d1ijqa250 Low density lipoprotein (LDL) receptor, different 97.68
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.65
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.6
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 97.57
d1ijqa250 Low density lipoprotein (LDL) receptor, different 97.49
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.4
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.37
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.34
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.31
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.29
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.25
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.15
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.14
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.08
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 97.02
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 96.95
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.84
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 96.8
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.78
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 96.51
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.32
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 96.29
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 95.92
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 95.64
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 95.49
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 94.69
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 94.52
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 94.04
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 93.86
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 89.83
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 89.76
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 89.37
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 84.75
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 84.13
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 81.86
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 80.93
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 80.32
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Low density lipoprotein (LDL) receptor, different EGF domains
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.84  E-value=9.7e-10  Score=76.03  Aligned_cols=40  Identities=30%  Similarity=0.805  Sum_probs=37.2

Q ss_pred             CcCccCCCCCCCCCCeeeecCCCeEEecCCCCeecCCCCceee
Q 006787          525 INECKERSACQCDGCSCQNTWGGFECKCKGNLLFIKEQDACIE  567 (631)
Q Consensus       525 ideC~~~~~C~~~~~~C~nt~Gsy~C~C~~G~~~~~d~~~C~~  567 (631)
                      ||||+.+++|.   +.|+|++|+|+|.|++||.+..|+++|++
T Consensus         1 idEC~~~~~C~---~~C~n~~Gsy~C~C~~Gy~L~~d~~~C~a   40 (41)
T d1i0ua2           1 IDECQDPDTCS---QLCVNLEGGYKCQCEEGFQLDPHTKACKA   40 (41)
T ss_dssp             CCTTTTTTSCS---SCEECSSSCCEECCCTTEEECTTTCCEEE
T ss_pred             CccCCCCCCCC---CEeECCCCCEEeECCCCCeECCCCCcccc
Confidence            79998767898   89999999999999999999999999975
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1de4c2 c.8.4.1 (C:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bi1a2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure