Citrus Sinensis ID: 006812


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630
MKRASFSILSQLTRCRPQKLAPFLSKNYIHDLTSSSSPLKSCTKAHGLEFRTHQPSHTINTLVGNPPQTSTRQRKIKEKSDLEEAFESAKTSEEMLQIFKQMESSFDETELGLVGLKIALKLDQEGGDPEMTLSFANRALNVLDKDERNNRPSLLVAMCLQVMGSANYSFKRFSDSLGYLSKANRMLGRLEEEGLGGSVEDIKPIMHAVHLELANVKTAMGRREEALEHLQKCLEIKELILEEDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIHKKGLGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQIALGKFEEAINTLKGVVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGILDKKETISPEEVADAYSEISMQYESMNEFETAISLLKRTLALLEKLPQAQHSEGSVSARIGWLLLLTGKVPQAIPYLESAAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQVFAFAKDIMDVSLGPHHADSIEACQNLSKAYSSMGSYTLAIEFQQRAIDAWESHGPSAQDELREARRLLEQLKIKASGASINQLPTKALPLPPTSVSGQSSQPDVSINQKLTGAM
ccccHHHHHHHHHHHccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccccccHHHHHHHHHcccc
cccHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccHHccccccHHcccccccccEEEEEEEcccc
MKRASFSILsqltrcrpqklapflsknyihdltssssplksctkahglefrthqpshtintlvgnppqtstrqrkIKEKSDLEEAFESAKTSEEMLQIFKQMESSFDETELGLVGLKIALKldqeggdpemTLSFANRALnvldkdernnrpSLLVAMCLQVMGSANYSFKRFSDSLGYLSKANRMLGRLeeeglggsvedikPIMHAVHLELANVKTAMGRREEALEHLQKCLEIKELILEEDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIHKkglghnsvevaHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQIALGKFEEAINTLKGVVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGildkketispeevADAYSEISMQYESMNEFETAISLLKRTLALLEKlpqaqhsegsvSARIGWLLLLtgkvpqaiPYLESAAERLKesfgpkhfgvGYIYNNLGaayleldrpqsAAQVFAFAKDImdvslgphhadsIEACQNLSKAYSSMGSYTLAIEFQQRAIDAweshgpsaQDELREARRLLEQLKIKAsgasinqlptkalplpptsvsgqssqpdvsinqkltgam
mkrasfsilsqltrcrpqklAPFLSKNYIHDLTSSSSPLKSCTKAHGLEfrthqpshtintlvgnppqtstrqrkikeksDLEEAFESAKTSEEMLQIFKQMESSFDETELGLVGLKIALKLDQEGGDPEMTLSFANRALNVLDKDERNNRPSLLVAMCLQVMGSANYSFKRFSDSLGYLSKANRMLGRLEEEGLGGSVEDIKPIMHAVHLELANVKTAMGRREEALEHLQKCLEIKELILEEDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIHKKGLGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQIALGKFEEAINTLKGVVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGildkketispeEVADAYSEISMQYESMNEFETAISLLKRTLALLEKLPQAQHSEGSVSARIGWLLLLTGKVPQAIPYLESAAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQVFAFAKDIMDVSLGPHHADSIEACQNLSKAYSSMGSYTLAIEFQQRAIDAWESHGPSAQDELREARRLLEQLKIKasgasinqlptkALPLpptsvsgqssqpdvsinqkltgam
MKRASFSILSQLTRCRPQKLAPFLSKNYIHDLTSSSSPLKSCTKAHGLEFRTHQPSHTINTLVGNPPQTSTRQRKIKEKSDLEEAFESAKTSEEMLQIFKQMESSFDETELGLVGLKIALKLDQEGGDPEMTLSFANRALNVLDKDERNNRPSLLVAMCLQVMGSANYSFKRFSDSLGYLSKANRMlgrleeeglggSVEDIKPIMHAVHLELANVKTAMGRREEALEHlqkcleikelileeDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIHKKGLGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQIALGKFEEAINTLKGVVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGILDKKETISPEEVADAYSEISMQYESMNEFETAISllkrtlalleklPQAQHSEGSVSARIGWLLLLTGKVPQAIPYLESAAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQVFAFAKDIMDVSLGPHHADSIEACQNLSKAYSSMGSYTLAIEFQQRAIDAWESHGPSAQDelrearrlleQLKIKASGASINQLPTKALPLPPTSVSGQSSQPDVSINQKLTGAM
***********LTRCRPQKLAPFLSKNYIH******************************************************************************TELGLVGLKIALKLD*********LSFANRALNVL********PSLLVAMCLQVMGSANYSFKRFSDSLGYLSKANRMLGRLEEEGLGGSVEDIKPIMHAVHLELANVKTAMGRREEALEHLQKCLEIKELILEEDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIHKKGLGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQIALGKFEEAINTLKGVVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGILDKKETISPEEVADAYSEISMQYESMNEFETAISLLKRTLALLEKLP******GSVSARIGWLLLLTGKVPQAIPYLESAAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQVFAFAKDIMDVSLGPHHADSIEACQNLSKAYSSMGSYTLAIEFQQRAIDAW****************************************************************
******S****LTR*************YIHDLTSSSSPLKSCTKAHGLEFRTHQ*********GNPPQTSTRQRKIKEKSDLEEAFESAKTSEEMLQIFKQMESSFDETELGLVGLKIALKLDQEGGDPEMTLSFANRALNVLDKDERNNRPSLLVAMCLQVMGSANYSFKRFSDSLGYLSKANRMLGRLEEEGLGGSVEDIKPIMHAVHLELANVKTAMGRREEALEHLQKCLEIKELILEEDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIHKKGLGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQIALGKFEEAINTLKGVVRQ*EKESETRALVFISMGKALCNQEKFADAKRCLEIACGILDKKETISPEEVADAYSEISMQYESMNEFETAISLLKRTLALLEKLPQAQHSEGSVSARIGWLLLLTGKVPQAIPYLESAAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQVFAFAKDIMDVSLGPHHADSIEACQNLSKAYSSMGSYTLAIEFQQRAIDAWESHGPSAQDELREARRLLEQLKIKASGASINQLPTKALPLPPTSVSGQSSQPDVSINQKLTGAM
MKRASFSILSQLTRCRPQKLAPFLSKNYIHDLTSSSSPLKSCTKAHGLEFRTHQPSHTINTLVGNP*************************SEEMLQIFKQMESSFDETELGLVGLKIALKLDQEGGDPEMTLSFANRALNVLDKDERNNRPSLLVAMCLQVMGSANYSFKRFSDSLGYLSKANRMLGRLEEEGLGGSVEDIKPIMHAVHLELANVKTAMGRREEALEHLQKCLEIKELILEEDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIHKKGLGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQIALGKFEEAINTLKGVVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGILDKKETISPEEVADAYSEISMQYESMNEFETAISLLKRTLALLEKLP********VSARIGWLLLLTGKVPQAIPYLESAAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQVFAFAKDIMDVSLGPHHADSIEACQNLSKAYSSMGSYTLAIEFQQRAIDAWESHGPSAQDELREARRLLEQLKIKASGASINQLPTKALPLP************VSINQKLTGAM
********LSQLTRCRPQKLAPFLSKNYIHDLTSSSSPLKSCTKAHGLEFRTHQPSHTINTLVGNPPQTSTRQRKIKEKSDLEEAFESAKTSEEMLQIFKQMESSFDETELGLVGLKIALKLDQEGGDPEMTLSFANRALNVLDKDERNNRPSLLVAMCLQVMGSANYSFKRFSDSLGYLSKANRMLGRLEEEGLGGSVEDIKPIMHAVHLELANVKTAMGRREEALEHLQKCLEIKELILEEDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIHKKGLGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQIALGKFEEAINTLKGVVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGILDKKETISPEEVADAYSEISMQYESMNEFETAISLLKRTLALLEKLPQAQHSEGSVSARIGWLLLLTGKVPQAIPYLESAAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQVFAFAKDIMDVSLGPHHADSIEACQNLSKAYSSMGSYTLAIEFQQRAIDAWESHGPSAQDELREARRLLEQLKIKASGASINQLPTKALPLPPTSVSGQSSQPDVSINQKLTG**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRASFSILSQLTRCRPQKLAPFLSKNYIHDLTSSSSPLKSCTKAHGLEFRTHQPSHTINTLVGNPPQTSTRQRKIKEKSDLEEAFESAKTSEEMLQIFKQMESSFDETELGLVGLKIALKLDQEGGDPEMTLSFANRALNVLDKDERNNRPSLLVAMCLQVMGSANYSFKRFSDSLGYLSKANRMLGRLEEEGLGGSVEDIKPIMHAVHLELANVKTAMGRREEALEHLQKCLEIKELILEEDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIHKKGLGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQIAxxxxxxxxxxxxxxxxxxxxxSETRALVFISMGKALCNQEKFADAKRCLEIACGILDKKETISPEEVADAYSEISMQYESxxxxxxxxxxxxxxxxxxxxxPQAQHSEGSVSARIGWLLLLTGKVPQAIPYLESAAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQVFAFAKDIMDVSLGPHHADSIEACQNLSKAYSSMGSYTLAIEFQQRAIDAWESHGPSAQDExxxxxxxxxxxxxxxxxxxxxQLPTKALPLPPTSVSGQSSQPDVSINQKLTGAM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query630 2.2.26 [Sep-21-2011]
A0JM231311 Nephrocystin-3 OS=Xenopus yes no 0.533 0.256 0.253 2e-11
Q6AZT71300 Nephrocystin-3 OS=Xenopus N/A no 0.533 0.258 0.250 4e-11
Q7TNH61325 Nephrocystin-3 OS=Mus mus yes no 0.512 0.243 0.247 1e-09
Q7Z4941330 Nephrocystin-3 OS=Homo sa yes no 0.511 0.242 0.238 3e-09
P0CI651303 Nephrocystin-3 OS=Danio r yes no 0.522 0.252 0.237 1e-08
P46825 571 Kinesin light chain OS=Do N/A no 0.244 0.269 0.275 3e-06
P46824 508 Kinesin light chain OS=Dr yes no 0.244 0.303 0.275 3e-06
Q05090 686 Kinesin light chain OS=St no no 0.290 0.266 0.274 4e-06
Q9NSK0 619 Kinesin light chain 4 OS= no no 0.242 0.247 0.264 4e-05
Q68G30505 Kinesin light chain 3 OS= no no 0.241 0.300 0.254 5e-05
>sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 Back     alignment and function desciption
 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 89/351 (25%), Positives = 150/351 (42%), Gaps = 15/351 (4%)

Query: 220  MGRREEALEHLQKCLEIKELILEEDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIH 279
            +G   +A+  LQ+ LEI+E  L+ D   +  +   LA  +V    F  A     +ALEI 
Sbjct: 940  LGLLSQAVTPLQRSLEIRETALDPDHPSVAQSLHQLAGVYVQSKKFGNAEQLYKQALEIS 999

Query: 280  KKGLGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNE-LSQKVLKTWGLSSELLRAEIDAA 338
            +   G   + VA +   L V+Y    + Q   EQ E L +K LK    S+    +    A
Sbjct: 1000 ENAYGSEHMRVARELDALAVLY----QKQNKFEQAEQLRKKSLKIRQKSARRKGSMYGFA 1055

Query: 339  NMQIALGKFEEAINTLKGVVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGI 398
             ++    + EE +   K         +E   L ++     L   E F   KR LE+   +
Sbjct: 1056 LLRRRALQLEE-LTLGKDTSDNARTLNELGVLYYLQ--NNLETAETFL--KRSLEMRERV 1110

Query: 399  LDKKETISPEEVADAYSEISMQYESMNEFETAISLLKRTLALLEKLPQAQHSEGSVSAR- 457
            L         + A + + ++  Y    +++ A  L +R L +  +     H   + + + 
Sbjct: 1111 LGADHP----DCAQSINNLAALYNEKKQYDKAEELYERALDIRRRALSPDHPSLAYTVKH 1166

Query: 458  IGWLLLLTGKVPQAIPYLESAAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQVF 517
            +  L    GK+ +A+P  E A E  ++SFGPKH  V     NL   Y ++ +   A+ ++
Sbjct: 1167 LAVLYKRKGKLDKAVPLYELAVEIRQKSFGPKHPSVATALVNLAVLYCQMKKQAEASPLY 1226

Query: 518  AFAKDIMDVSLGPHHADSIEACQNLSKAYSSMGSYTLAIEFQQRAIDAWES 568
              A  I + SLG  H    E  +NL+      G +  A E  +RA++  E+
Sbjct: 1227 ERAMKIYEDSLGRMHPRVGETLKNLAVLRYEEGDFEKAAELYKRAMEIKET 1277




Required for normal ciliary development and function. Inhibits disheveled-1-induced canonical Wnt-signaling activity and may also play a role in the control of non-canonical Wnt signaling that regulates planar cell polarity. Probably acts as a molecular switch between different Wnt signaling pathways. Required for proper convergent extension cell movements.
Xenopus tropicalis (taxid: 8364)
>sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 Back     alignment and function description
>sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 Back     alignment and function description
>sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 Back     alignment and function description
>sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 Back     alignment and function description
>sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 Back     alignment and function description
>sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 Back     alignment and function description
>sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 Back     alignment and function description
>sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 Back     alignment and function description
>sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query630
255583206618 kinesin light chain, putative [Ricinus c 0.973 0.991 0.770 0.0
225437850647 PREDICTED: nephrocystin-3 [Vitis vinifer 0.988 0.962 0.723 0.0
356548051616 PREDICTED: nephrocystin-3-like [Glycine 0.922 0.943 0.713 0.0
449462455634 PREDICTED: nephrocystin-3-like [Cucumis 0.987 0.981 0.700 0.0
297744126527 unnamed protein product [Vitis vinifera] 0.825 0.986 0.804 0.0
449502044634 PREDICTED: LOW QUALITY PROTEIN: nephrocy 0.987 0.981 0.699 0.0
356536829615 PREDICTED: nephrocystin-3-like [Glycine 0.923 0.946 0.709 0.0
224082792527 predicted protein [Populus trichocarpa] 0.814 0.973 0.781 0.0
297826567616 tetratricopeptide repeat-containing prot 0.892 0.912 0.691 0.0
30684882617 tetratricopeptide repeat-containing prot 0.898 0.917 0.685 0.0
>gi|255583206|ref|XP_002532368.1| kinesin light chain, putative [Ricinus communis] gi|223527924|gb|EEF30011.1| kinesin light chain, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  960 bits (2481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/618 (77%), Positives = 539/618 (87%), Gaps = 5/618 (0%)

Query: 1   MKRASFSILSQLTRCRPQ-KLAPFLSKNYIHDLT--SSSSPLKSCTKAHGLEFRTHQPSH 57
           MKRAS S LS LTR +P+  L P L + YI   T    +  LKSCTK +GL  +  Q   
Sbjct: 1   MKRASISFLSHLTRQKPKITLTPLLPRTYISGTTLHPPTDHLKSCTKTNGLILKYRQFQA 60

Query: 58  TINTLVGNPPQTSTRQRKIKEKSDLEEAFESAKTSEEMLQIFKQMESSFDETELGLVGLK 117
             +  +    Q S+RQRKIKEKS LEEAFESA T++EMLQ FK+ME+SF+E ELGL  LK
Sbjct: 61  NPSEDIEKNLQISSRQRKIKEKSQLEEAFESADTADEMLQAFKEMETSFNEKELGLASLK 120

Query: 118 IALKLDQEGGDPEMTLSFANRALNVLDKDERNNRPSLLVAMCLQVMGSANYSFKRFSDSL 177
           + LKLDQEG DPE  LSFA RALNVLD ++ N++PSLLVAM LQ+MGS NYS KRF+DSL
Sbjct: 121 LGLKLDQEGEDPEKALSFATRALNVLDNND-NSKPSLLVAMALQLMGSVNYSLKRFNDSL 179

Query: 178 GYLSKANRMLGRLEEEGLGGSVEDIKPIMHAVHLELANVKTAMGRREEALEHLQKCLEIK 237
           GYLS+ANR+LGRLEEEG+  ++EDIKP++HAV LELANVKTAMGRREEALE+L+KCL+IK
Sbjct: 180 GYLSRANRVLGRLEEEGIS-NIEDIKPVLHAVQLELANVKTAMGRREEALENLRKCLQIK 238

Query: 238 ELILEEDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIHKKGLGHNSVEVAHDRRLL 297
           E+ LE+DS+ELGVANR+LAEA+VAVLNFKEALPFGLKALEIH+ GLG+NSVEVA DR+LL
Sbjct: 239 EMTLEKDSKELGVANRELAEAYVAVLNFKEALPFGLKALEIHRSGLGNNSVEVARDRKLL 298

Query: 298 GVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQIALGKFEEAINTLKGV 357
           GVIYSGLEEH+KALEQNELSQ+VLK WGLSS+LL AEIDAANMQIALG+++EAI+TLKGV
Sbjct: 299 GVIYSGLEEHEKALEQNELSQQVLKKWGLSSDLLHAEIDAANMQIALGRYDEAIDTLKGV 358

Query: 358 VRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGILDKKETISPEEVADAYSEI 417
           V+QT+K+SETRALVFISM KALCNQEKFAD KRCLEIACGILDKKE +SP EVA+AYSEI
Sbjct: 359 VQQTDKDSETRALVFISMAKALCNQEKFADTKRCLEIACGILDKKEAVSPVEVAEAYSEI 418

Query: 418 SMQYESMNEFETAISLLKRTLALLEKLPQAQHSEGSVSARIGWLLLLTGKVPQAIPYLES 477
           +MQYE+MNEFETAISLLKRTL+LLEKLPQ QHSEGSVSARIGWLLLLTGKVPQAIPYLES
Sbjct: 419 AMQYETMNEFETAISLLKRTLSLLEKLPQEQHSEGSVSARIGWLLLLTGKVPQAIPYLES 478

Query: 478 AAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQVFAFAKDIMDVSLGPHHADSIE 537
           AAERLKESFG KHFGVGYIYNNLGAAYLELDRPQSAAQ+FA AKDIMDV+LGPHHADSIE
Sbjct: 479 AAERLKESFGSKHFGVGYIYNNLGAAYLELDRPQSAAQMFAVAKDIMDVALGPHHADSIE 538

Query: 538 ACQNLSKAYSSMGSYTLAIEFQQRAIDAWESHGPSAQDELREARRLLEQLKIKASGASIN 597
           ACQNLSKAY +MGSY LAIEFQ+R IDAWESHGP+ QDEL EA+RL EQLK KA GAS N
Sbjct: 539 ACQNLSKAYGAMGSYALAIEFQKRVIDAWESHGPTVQDELIEAQRLFEQLKAKARGASTN 598

Query: 598 QLPTKALPLPPTSVSGQS 615
           QL TKALPLP +S SG++
Sbjct: 599 QLATKALPLPHSSPSGRT 616




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225437850|ref|XP_002263867.1| PREDICTED: nephrocystin-3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356548051|ref|XP_003542417.1| PREDICTED: nephrocystin-3-like [Glycine max] Back     alignment and taxonomy information
>gi|449462455|ref|XP_004148956.1| PREDICTED: nephrocystin-3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297744126|emb|CBI37096.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449502044|ref|XP_004161528.1| PREDICTED: LOW QUALITY PROTEIN: nephrocystin-3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356536829|ref|XP_003536936.1| PREDICTED: nephrocystin-3-like [Glycine max] Back     alignment and taxonomy information
>gi|224082792|ref|XP_002306840.1| predicted protein [Populus trichocarpa] gi|222856289|gb|EEE93836.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297826567|ref|XP_002881166.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297327005|gb|EFH57425.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30684882|ref|NP_850163.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|17380952|gb|AAL36288.1| putative kinesin light chain [Arabidopsis thaliana] gi|330253419|gb|AEC08513.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query630
TAIR|locus:2042506617 AT2G31240 "AT2G31240" [Arabido 0.961 0.982 0.610 3.8e-188
TAIR|locus:2015959650 KLCR3 "AT1G27500" [Arabidopsis 0.766 0.743 0.252 2.8e-31
TAIR|locus:2086834663 KLCR2 "kinesin light chain-rel 0.722 0.686 0.265 1.5e-30
TAIR|locus:2123411609 KLCR1 "kinesin light chain-rel 0.825 0.853 0.244 5.3e-30
ASPGD|ASPL0000018313 1288 AN3547 [Emericella nidulans (t 0.577 0.282 0.224 1.8e-09
UNIPROTKB|Q6AZT71300 nphp3 "Nephrocystin-3" [Xenopu 0.476 0.230 0.246 7.6e-08
UNIPROTKB|A0JM231311 nphp3 "Nephrocystin-3" [Xenopu 0.476 0.228 0.249 6.3e-07
UNIPROTKB|F1SNS5293 F1SNS5 "Uncharacterized protei 0.163 0.351 0.320 2.7e-06
UNIPROTKB|E1BSU81316 NPHP3 "Uncharacterized protein 0.476 0.227 0.230 8.7e-06
ASPGD|ASPL0000046994 1262 AN9426 [Emericella nidulans (t 0.466 0.232 0.206 2.2e-05
TAIR|locus:2042506 AT2G31240 "AT2G31240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1824 (647.1 bits), Expect = 3.8e-188, P = 3.8e-188
 Identities = 380/622 (61%), Positives = 460/622 (73%)

Query:     1 MKRASFSILSQLT--RCRPQKLAPFLSKNYIHDLTSSS-SPLK----SCTKAHGLEFRTH 53
             MK  S S++ +L   + RP  L+  L+       +SS  SP +    SC + + L  R  
Sbjct:     1 MKSLSISLIRRLHFHKIRPIPLSIHLNAASSSSSSSSLISPAREISTSCRRTNDLIKRQF 60

Query:    54 --QPSHTINTLVGNPPQTSTRQRKIKEKSDLEEAFESAKTSEEMLQIFKQMESSFDETEL 111
                P   +NT V  PP+ S+     KEK DLEEAFESA T++EM+++FK+ME SF+  EL
Sbjct:    61 WVNPYRNLNTHVEEPPEISSSD---KEKIDLEEAFESANTTDEMVRLFKEMELSFEGNEL 117

Query:   112 GLVGLKIALKLDQEGGDPEMTLSFANRALNVLDKDERNNRPSLLVAMCLQVMGSANYSFK 171
             GL  LK+ L LD+EG DPE  LS+A++AL   D D   N+P+LLVAM  Q+MGSANY  K
Sbjct:   118 GLSALKLGLHLDREGEDPEKVLSYADKALKSFDGD--GNKPNLLVAMASQLMGSANYGLK 175

Query:   172 RFSDSLGYLSKANRMXXXXXXXXXXXSVEDIKPIMHAVHLELANVKTAMGRREEALEHXX 231
             RFSDSLGYL++ANR+            VED++P++HAV LELANVK AMGRREEA+E+  
Sbjct:   176 RFSDSLGYLNRANRILVKLEADGDCV-VEDVRPVLHAVQLELANVKNAMGRREEAIENLK 234

Query:   232 XXXXXXXXXXXXDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIHKKGLGHNSVEVA 291
                         DS+E+GVANR LA+A+VAVLNF EALP+ LKALEIHKK LG+NS EVA
Sbjct:   235 KSLEIKEMTFDEDSKEMGVANRSLADAYVAVLNFNEALPYALKALEIHKKELGNNSAEVA 294

Query:   292 HDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQIALGKFEEAI 351
              DRRLLGVIYSGLE+H KALEQN LSQ+VLK WG+  EL+RAEIDAANM++ALGK+EEAI
Sbjct:   295 QDRRLLGVIYSGLEQHDKALEQNRLSQRVLKNWGMKLELIRAEIDAANMKVALGKYEEAI 354

Query:   352 NTLKGVVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGILDKKETISPEEVA 411
             + LK VV+QT+K+SE RA+VFISM KAL NQ+KFA++KRCLE AC IL+KKET  P EVA
Sbjct:   355 DILKSVVQQTDKDSEMRAMVFISMSKALVNQQKFAESKRCLEFACEILEKKETALPVEVA 414

Query:   412 DAYSEISMQYESMNEFETAISXXXXXXXXXXXXPQAQHSEGSVSARIGWLLLLTGKVPQA 471
             +AYSE++MQYESMNEFETAIS            PQ QHSEGSVSARIGWLLL +G+V QA
Sbjct:   415 EAYSEVAMQYESMNEFETAISLLQKTLGILEKLPQEQHSEGSVSARIGWLLLFSGRVSQA 474

Query:   472 IPYLESAAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQVFAFAKDIMDVSLGPH 531
             +PYLESAAERLKESFG KHFGVGY+YNNLGAAYLEL RPQSAAQ+FA AKDIMDVSLGP+
Sbjct:   475 VPYLESAAERLKESFGAKHFGVGYVYNNLGAAYLELGRPQSAAQMFAVAKDIMDVSLGPN 534

Query:   532 HADSIEACQNLSKAYSSMGSYTLAIEFQQRAIDAWESHGPSAQDXXXXXXXXXXQLKIKA 591
             H DSI+ACQNLSKAY+ MG+Y+LA+EFQQR I+AW++HG SA+D           L++KA
Sbjct:   535 HVDSIDACQNLSKAYAGMGNYSLAVEFQQRVINAWDNHGDSAKDEMKEAKRLLEDLRLKA 594

Query:   592 -SGASINQLPTKALPLPPTSVS 612
               G S N+L  KALPLP  S S
Sbjct:   595 RGGVSTNKLLNKALPLPKPSHS 616




GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0006457 "protein folding" evidence=RCA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2015959 KLCR3 "AT1G27500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086834 KLCR2 "kinesin light chain-related 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123411 KLCR1 "kinesin light chain-related 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000018313 AN3547 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AZT7 nphp3 "Nephrocystin-3" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|A0JM23 nphp3 "Nephrocystin-3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|F1SNS5 F1SNS5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSU8 NPHP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ASPGD|ASPL0000046994 AN9426 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00007508001
SubName- Full=Chromosome chr7 scaffold_192, whole genome shotgun sequence; (647 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query630
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 9e-08
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-06
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-05
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 6e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.001
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.001
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.002
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.002
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.003
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.004
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.004
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.004
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
 Score = 49.3 bits (118), Expect = 9e-08
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 204 PIMHAVHLELANVKTAMGRREEALEHLQKCLEIKELILEEDSRELGVANRDLAEAFVAVL 263
           P + A    LA V   +G  +EALE L+K LE+    L ED  E   A  +LA  ++A+ 
Sbjct: 2   PDLAAALNNLALVLRRLGDYDEALELLEKALELARE-LGEDHPETARALNNLARLYLALG 60

Query: 264 NFKEALPFGLKALEIHKK 281
           ++ EAL +  KAL + + 
Sbjct: 61  DYDEALEYLEKALALREA 78


Length = 78

>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 630
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 100.0
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.96
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.95
KOG0547606 consensus Translocase of outer mitochondrial membr 99.95
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.94
KOG2003840 consensus TPR repeat-containing protein [General f 99.93
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.93
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.92
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.91
KOG0547606 consensus Translocase of outer mitochondrial membr 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
PLN03218 1060 maturation of RBCL 1; Provisional 99.9
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.9
PLN03218 1060 maturation of RBCL 1; Provisional 99.9
KOG2003 840 consensus TPR repeat-containing protein [General f 99.89
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.89
KOG1126638 consensus DNA-binding cell division cycle control 99.88
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.88
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.88
KOG1126638 consensus DNA-binding cell division cycle control 99.88
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.87
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.87
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.87
KOG2076 895 consensus RNA polymerase III transcription factor 99.87
PRK14574 822 hmsH outer membrane protein; Provisional 99.84
KOG2076 895 consensus RNA polymerase III transcription factor 99.84
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.84
PLN03077 857 Protein ECB2; Provisional 99.84
PLN03077857 Protein ECB2; Provisional 99.83
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.81
PRK04841903 transcriptional regulator MalT; Provisional 99.81
PRK14574 822 hmsH outer membrane protein; Provisional 99.81
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.8
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.79
KOG1129478 consensus TPR repeat-containing protein [General f 99.79
KOG1941518 consensus Acetylcholine receptor-associated protei 99.79
KOG1129478 consensus TPR repeat-containing protein [General f 99.79
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.77
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.76
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.76
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.75
PRK04841903 transcriptional regulator MalT; Provisional 99.75
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.75
KOG1941518 consensus Acetylcholine receptor-associated protei 99.75
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.74
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.73
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.73
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.73
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.72
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.72
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.72
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.72
PRK12370553 invasion protein regulator; Provisional 99.72
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.72
PRK12370553 invasion protein regulator; Provisional 99.71
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.71
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.7
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.69
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.69
PRK11189296 lipoprotein NlpI; Provisional 99.69
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.68
PRK11189296 lipoprotein NlpI; Provisional 99.68
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.68
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.67
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.67
KOG1125579 consensus TPR repeat-containing protein [General f 99.66
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.66
KOG2376652 consensus Signal recognition particle, subunit Srp 99.65
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.65
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.65
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.64
KOG1125579 consensus TPR repeat-containing protein [General f 99.64
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.62
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.61
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.59
KOG1915677 consensus Cell cycle control protein (crooked neck 99.58
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.57
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.5
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.48
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.46
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.46
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.46
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.43
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.41
PLN02789320 farnesyltranstransferase 99.4
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.4
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.36
PLN02789320 farnesyltranstransferase 99.36
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.34
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.33
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.31
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.31
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 99.3
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.28
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.23
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.23
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.22
PRK15359144 type III secretion system chaperone protein SscB; 99.22
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.21
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.19
PRK15359144 type III secretion system chaperone protein SscB; 99.19
KOG1128777 consensus Uncharacterized conserved protein, conta 99.19
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.17
KOG1128777 consensus Uncharacterized conserved protein, conta 99.16
PRK10370198 formate-dependent nitrite reductase complex subuni 99.15
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 99.14
PRK10370198 formate-dependent nitrite reductase complex subuni 99.14
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.11
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.09
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.09
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.08
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.07
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.07
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.04
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 99.04
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.04
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.03
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.02
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.01
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.01
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.99
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.98
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.97
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.97
KOG1585308 consensus Protein required for fusion of vesicles 98.96
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.96
KOG1585308 consensus Protein required for fusion of vesicles 98.94
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.92
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.92
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.9
PF12688120 TPR_5: Tetratrico peptide repeat 98.9
KOG0553304 consensus TPR repeat-containing protein [General f 98.9
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.89
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.88
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.87
KOG0553304 consensus TPR repeat-containing protein [General f 98.87
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 98.86
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.86
KOG1586288 consensus Protein required for fusion of vesicles 98.81
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.8
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.76
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.75
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.72
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 98.72
PF12688120 TPR_5: Tetratrico peptide repeat 98.71
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.7
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.7
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.7
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.67
KOG1586288 consensus Protein required for fusion of vesicles 98.66
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.65
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.64
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.64
KOG2471696 consensus TPR repeat-containing protein [General f 98.62
PRK10803263 tol-pal system protein YbgF; Provisional 98.61
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.61
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.6
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.58
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.57
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.56
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.56
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.53
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.52
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.49
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.47
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.47
PRK10803263 tol-pal system protein YbgF; Provisional 98.46
PRK15331165 chaperone protein SicA; Provisional 98.45
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.45
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.42
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.42
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.39
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.38
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.38
KOG2471 696 consensus TPR repeat-containing protein [General f 98.37
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.36
COG3898531 Uncharacterized membrane-bound protein [Function u 98.32
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.32
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.32
KOG4555175 consensus TPR repeat-containing protein [Function 98.3
KOG4555175 consensus TPR repeat-containing protein [Function 98.3
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.28
COG5159421 RPN6 26S proteasome regulatory complex component [ 98.27
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.27
COG4700251 Uncharacterized protein conserved in bacteria cont 98.27
KOG4234271 consensus TPR repeat-containing protein [General f 98.25
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.22
COG3898531 Uncharacterized membrane-bound protein [Function u 98.19
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.19
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.18
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.16
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.15
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.14
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.12
PRK15331165 chaperone protein SicA; Provisional 98.12
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.09
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.08
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.08
KOG4234271 consensus TPR repeat-containing protein [General f 98.08
PF13512142 TPR_18: Tetratricopeptide repeat 98.08
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 98.05
COG5159421 RPN6 26S proteasome regulatory complex component [ 98.04
COG4700251 Uncharacterized protein conserved in bacteria cont 98.03
KOG1463411 consensus 26S proteasome regulatory complex, subun 98.03
KOG20411189 consensus WD40 repeat protein [General function pr 98.02
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 98.02
PF13512142 TPR_18: Tetratricopeptide repeat 98.0
KOG1463411 consensus 26S proteasome regulatory complex, subun 98.0
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.99
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.99
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.96
PRK11906458 transcriptional regulator; Provisional 97.93
PF1337173 TPR_9: Tetratricopeptide repeat 97.89
PRK11906458 transcriptional regulator; Provisional 97.89
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 97.88
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.86
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.82
PF1337173 TPR_9: Tetratricopeptide repeat 97.81
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.8
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.77
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.74
KOG4648536 consensus Uncharacterized conserved protein, conta 97.69
KOG4648 536 consensus Uncharacterized conserved protein, conta 97.68
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.68
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.66
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.62
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.6
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.58
KOG1550552 consensus Extracellular protein SEL-1 and related 97.58
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.55
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.53
KOG1550552 consensus Extracellular protein SEL-1 and related 97.52
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.49
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.49
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.42
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.39
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.38
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.37
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.37
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.36
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.32
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.32
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.31
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.31
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.3
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.28
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.27
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.25
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.25
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.23
PF1342844 TPR_14: Tetratricopeptide repeat 97.21
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.16
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.15
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.14
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.1
PF1286294 Apc5: Anaphase-promoting complex subunit 5 97.08
PF1343134 TPR_17: Tetratricopeptide repeat 97.05
PF1342844 TPR_14: Tetratricopeptide repeat 97.04
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.03
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.94
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.92
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.9
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.9
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.85
PF1343134 TPR_17: Tetratricopeptide repeat 96.79
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.79
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.76
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.73
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.71
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.71
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.66
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.66
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.63
KOG4814 872 consensus Uncharacterized conserved protein [Funct 96.6
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 96.43
KOG4814872 consensus Uncharacterized conserved protein [Funct 96.2
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 96.17
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 96.05
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.95
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.88
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.85
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.69
KOG2581493 consensus 26S proteasome regulatory complex, subun 95.6
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.59
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.59
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 95.57
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 95.52
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 95.5
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.46
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 95.42
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.16
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 95.05
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 94.88
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.83
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.82
KOG20411189 consensus WD40 repeat protein [General function pr 94.67
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 94.66
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 94.66
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.66
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 94.52
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 94.51
PRK14707 2710 hypothetical protein; Provisional 94.44
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 94.4
PRK14707 2710 hypothetical protein; Provisional 94.37
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.25
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.22
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 94.17
KOG1258577 consensus mRNA processing protein [RNA processing 94.17
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 94.17
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 94.04
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 94.01
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 93.88
KOG0687393 consensus 26S proteasome regulatory complex, subun 93.7
KOG3783546 consensus Uncharacterized conserved protein [Funct 93.39
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 93.2
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 92.94
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 92.82
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.53
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 92.38
KOG2581493 consensus 26S proteasome regulatory complex, subun 92.29
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.21
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.16
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.96
KOG4507 886 consensus Uncharacterized conserved protein, conta 91.89
COG5187412 RPN7 26S proteasome regulatory complex component, 91.56
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 91.42
KOG0687393 consensus 26S proteasome regulatory complex, subun 91.4
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 91.36
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.3
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 91.19
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.0
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 90.97
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 90.9
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.8
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 90.77
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 90.69
PF1304150 PPR_2: PPR repeat family 90.68
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 90.59
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.57
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 90.57
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 90.55
COG3629280 DnrI DNA-binding transcriptional activator of the 90.3
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 90.29
PF1285434 PPR_1: PPR repeat 90.29
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 90.11
KOG4014248 consensus Uncharacterized conserved protein (conta 90.0
KOG0508 615 consensus Ankyrin repeat protein [General function 89.83
PF1304150 PPR_2: PPR repeat family 88.99
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 88.92
PF1285434 PPR_1: PPR repeat 88.2
KOG4014248 consensus Uncharacterized conserved protein (conta 88.08
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 87.91
KOG0508615 consensus Ankyrin repeat protein [General function 87.71
cd0267979 MIT_spastin MIT: domain contained within Microtubu 87.69
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 87.45
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 87.17
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 86.85
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 86.76
COG3947361 Response regulator containing CheY-like receiver a 86.58
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 86.51
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 86.48
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 86.44
KOG1258577 consensus mRNA processing protein [RNA processing 86.24
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 86.21
COG3629280 DnrI DNA-binding transcriptional activator of the 86.2
PRK10941269 hypothetical protein; Provisional 86.18
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.78
PF05053 618 Menin: Menin; InterPro: IPR007747 MEN1, the gene r 85.53
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 84.86
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 84.77
COG5187412 RPN7 26S proteasome regulatory complex component, 84.01
PRK10941269 hypothetical protein; Provisional 83.99
KOG2422665 consensus Uncharacterized conserved protein [Funct 83.82
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 83.62
COG3947361 Response regulator containing CheY-like receiver a 83.1
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 83.01
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 82.86
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 82.81
KOG4563 400 consensus Cell cycle-regulated histone H1-binding 82.22
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 80.51
KOG3364149 consensus Membrane protein involved in organellar 80.47
KOG2422665 consensus Uncharacterized conserved protein [Funct 80.37
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 80.34
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3.1e-42  Score=318.59  Aligned_cols=383  Identities=18%  Similarity=0.174  Sum_probs=347.6

Q ss_pred             ccCcchHHHHHHHHHHHHHHhCCChHHHHHHHHHHHHHHHHhhhCCCCChhHHHHHHHhhHHHhhccChHHHHHHHHHHH
Q 006812          105 SFDETELGLVGLKIALKLDQEGGDPEMTLSFANRALNVLDKDERNNRPSLLVAMCLQVMGSANYSFKRFSDSLGYLSKAN  184 (630)
Q Consensus       105 ~~~~~~~~~~~~~~g~~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al  184 (630)
                      ...+|..+.+|.++|.++...| ++++|+.+|+.++++.          |..+++|.++|.++...|+.+.|...|..++
T Consensus       109 ~r~~~q~ae~ysn~aN~~kerg-~~~~al~~y~~aiel~----------p~fida~inla~al~~~~~~~~a~~~~~~al  177 (966)
T KOG4626|consen  109 IRKNPQGAEAYSNLANILKERG-QLQDALALYRAAIELK----------PKFIDAYINLAAALVTQGDLELAVQCFFEAL  177 (966)
T ss_pred             hhccchHHHHHHHHHHHHHHhc-hHHHHHHHHHHHHhcC----------chhhHHHhhHHHHHHhcCCCcccHHHHHHHH
Confidence            3356888999999999999999 9999999999999875          3457899999999999999999999999999


Q ss_pred             HHHhHhhhcCCCCCCccchhhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHhcC
Q 006812          185 RMLGRLEEEGLGGSVEDIKPIMHAVHLELANVKTAMGRREEALEHLQKCLEIKELILEEDSRELGVANRDLAEAFVAVLN  264 (630)
Q Consensus       185 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~  264 (630)
                      ++                .|...-+...+|..+..+|+..+|..+|.+|++..        |..+.+|.+||.++..+|+
T Consensus       178 ql----------------nP~l~ca~s~lgnLlka~Grl~ea~~cYlkAi~~q--------p~fAiawsnLg~~f~~~Ge  233 (966)
T KOG4626|consen  178 QL----------------NPDLYCARSDLGNLLKAEGRLEEAKACYLKAIETQ--------PCFAIAWSNLGCVFNAQGE  233 (966)
T ss_pred             hc----------------CcchhhhhcchhHHHHhhcccchhHHHHHHHHhhC--------CceeeeehhcchHHhhcch
Confidence            98                45556667789999999999999999999999544        5668999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhhcCCCCHHHHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHHcCCChhHHHHHHHHHHHHHHc
Q 006812          265 FKEALPFGLKALEIHKKGLGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQIAL  344 (630)
Q Consensus       265 ~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~la~~~~~~  344 (630)
                      ...|+.+|++|+.+.        |....+|.+||.+|...+.++.|+.+|.+|+.+      .|..+.++.++|.+|+.+
T Consensus       234 i~~aiq~y~eAvkld--------P~f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~l------rpn~A~a~gNla~iYyeq  299 (966)
T KOG4626|consen  234 IWLAIQHYEEAVKLD--------PNFLDAYINLGNVYKEARIFDRAVSCYLRALNL------RPNHAVAHGNLACIYYEQ  299 (966)
T ss_pred             HHHHHHHHHHhhcCC--------CcchHHHhhHHHHHHHHhcchHHHHHHHHHHhc------CCcchhhccceEEEEecc
Confidence            999999999999864        455788999999999999999999999999887      788999999999999999


Q ss_pred             CCHHHHHHHHHHHHHHhhhcchHHHHHHHHHHHHHHhhccHHHHHHHHHHHHHHHHhhcCCCcHHHHHHHHHHHHHHHHc
Q 006812          345 GKFEEAINTLKGVVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGILDKKETISPEEVADAYSEISMQYESM  424 (630)
Q Consensus       345 g~~~~A~~~~~~~l~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~la~~~~~~  424 (630)
                      |..+-|+..|+++++..+.    ...+|.+||.++...|+..+|..+|.+++.+.        |..+.+.++||.+|..+
T Consensus       300 G~ldlAI~~Ykral~~~P~----F~~Ay~NlanALkd~G~V~ea~~cYnkaL~l~--------p~hadam~NLgni~~E~  367 (966)
T KOG4626|consen  300 GLLDLAIDTYKRALELQPN----FPDAYNNLANALKDKGSVTEAVDCYNKALRLC--------PNHADAMNNLGNIYREQ  367 (966)
T ss_pred             ccHHHHHHHHHHHHhcCCC----chHHHhHHHHHHHhccchHHHHHHHHHHHHhC--------CccHHHHHHHHHHHHHh
Confidence            9999999999999996544    35599999999999999999999999999987        67789999999999999


Q ss_pred             CCHHHHHHHHHHHHHHHHhCCCCCCchhHHHHHHHHHHHHcCChhhHHHHHHHHHHHHHHhcCCCCccHHHHHHHHHHHH
Q 006812          425 NEFETAISLLKRTLALLEKLPQAQHSEGSVSARIGWLLLLTGKVPQAIPYLESAAERLKESFGPKHFGVGYIYNNLGAAY  504 (630)
Q Consensus       425 g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~l~~~~  504 (630)
                      |.+++|..+|.+++++....       +....+||.+|.++|++++|+.+|++++.|        .|..+.++.++|..|
T Consensus       368 ~~~e~A~~ly~~al~v~p~~-------aaa~nNLa~i~kqqgnl~~Ai~~YkealrI--------~P~fAda~~NmGnt~  432 (966)
T KOG4626|consen  368 GKIEEATRLYLKALEVFPEF-------AAAHNNLASIYKQQGNLDDAIMCYKEALRI--------KPTFADALSNMGNTY  432 (966)
T ss_pred             ccchHHHHHHHHHHhhChhh-------hhhhhhHHHHHHhcccHHHHHHHHHHHHhc--------CchHHHHHHhcchHH
Confidence            99999999999999974322       457899999999999999999999999984        588999999999999


Q ss_pred             HHcCChhHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHcCC
Q 006812          505 LELDRPQSAAQVFAFAKDIMDVSLGPHHADSIEACQNLSKAYSSMGSYTLAIEFQQRAIDAWESHGP  571 (630)
Q Consensus       505 ~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~  571 (630)
                      ..+|+.+.|+.+|.+|+.        -+|..+++..+||.+|...|+..+|+.-|+.|+++-+.+.+
T Consensus       433 ke~g~v~~A~q~y~rAI~--------~nPt~AeAhsNLasi~kDsGni~~AI~sY~~aLklkPDfpd  491 (966)
T KOG4626|consen  433 KEMGDVSAAIQCYTRAIQ--------INPTFAEAHSNLASIYKDSGNIPEAIQSYRTALKLKPDFPD  491 (966)
T ss_pred             HHhhhHHHHHHHHHHHHh--------cCcHHHHHHhhHHHHhhccCCcHHHHHHHHHHHccCCCCch
Confidence            999999999999999999        56999999999999999999999999999999987655444



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF05053 Menin: Menin; InterPro: IPR007747 MEN1, the gene responsible for multiple endocrine neoplasia type 1, is a tumour suppressor gene that encodes a protein called Menin which may be an atypical GTPase stimulated by nm23 [] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query630
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-27
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-27
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 6e-26
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-25
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 3e-08
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-05
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-25
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-19
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-19
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 6e-13
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-09
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 5e-22
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-17
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 2e-04
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-21
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-19
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-13
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-19
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-18
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-18
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-11
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 4e-19
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 5e-19
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 7e-16
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-15
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-17
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-17
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 5e-17
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-10
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-10
2gw1_A 514 Mitochondrial precursor proteins import receptor; 4e-17
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-15
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-14
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-12
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-16
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-06
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 5e-16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 3e-11
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 7e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-15
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 4e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-15
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-13
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 9e-15
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 4e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-14
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-12
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-07
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-14
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-13
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-08
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-12
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 8e-12
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 6e-11
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 8e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-10
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-07
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-10
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 9e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 9e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-09
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 8e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 5e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 6e-08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 3e-05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 6e-08
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 4e-05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 2e-04
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 2e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-07
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-07
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-07
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-07
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 5e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 5e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 6e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-04
3qww_A433 SET and MYND domain-containing protein 2; methyltr 6e-07
3qww_A433 SET and MYND domain-containing protein 2; methyltr 2e-06
3qww_A433 SET and MYND domain-containing protein 2; methyltr 9e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 6e-07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-06
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 4e-06
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 2e-04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 6e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 8e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 8e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 8e-06
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-05
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 2e-05
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 4e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 6e-04
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
 Score =  113 bits (286), Expect = 2e-27
 Identities = 56/402 (13%), Positives = 119/402 (29%), Gaps = 44/402 (10%)

Query: 163 MGSANYSFKRFSDSLGYLSKANRMLGRLEEEGLGGSVEDIKPIMHAVHLELANVKTAMGR 222
              ++                ++     +              M              G 
Sbjct: 14  ENVSSLGLGSGGGGTNSHDGNSQQGSGSDG----------GSSMCLELALEGERLCNAGD 63

Query: 223 REEALEHLQKCLEIKELILEEDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIHKKG 282
               +   Q  ++       ED R L      L  A+  + ++ +A+ +    L + K  
Sbjct: 64  CRAGVAFFQAAIQAGT----EDLRTLSAIYSQLGNAYFYLGDYNKAMQYHKHDLTLAKSM 119

Query: 283 LGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQI 342
                   +     LG     +    +A    E    + +  G      RA  +  N+  
Sbjct: 120 NDRLGEAKSSGN--LGNTLKVMGRFDEAAICCERHLTLARQLGDRLSEGRALYNLGNVYH 177

Query: 343 ALGKFEEAINTLKGVVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGILDKK 402
           A GK     N  K      E  +           +A+   ++       L++   + D+ 
Sbjct: 178 AKGKHLGQRNPGKFGDDVKEALT-----------RAVEFYQE------NLKLMRDLGDRG 220

Query: 403 ETISPEEVADAYSEISMQYESMNEFETAISLLKRTLALLEKLPQAQHSEGSVSARIGWLL 462
                     A   +   Y  + +F+ AI   +  L +  +    + +E   ++ +G   
Sbjct: 221 A------QGRACGNLGNTYYLLGDFQAAIEHHQERLRIAREF-GDRAAERRANSNLGNSH 273

Query: 463 LLTGKVPQAIPYLESAAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQVFAFAKD 522
           +  G+   A  + +     L    G +         +LG  Y  L    +A +       
Sbjct: 274 IFLGQFEDAAEHYKRTLA-LAVELGERE-VEAQSCYSLGNTYTLLHEFNTAIEYHNRHLA 331

Query: 523 IMDVSLGPHHADSIEACQNLSKAYSSMGSYTLAIEFQQRAID 564
           I    LG        AC +L  A+S++G +  A+++ ++ + 
Sbjct: 332 IA-QELG-DRIGEARACWSLGNAHSAIGGHERALKYAEQHLQ 371


>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query630
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 100.0
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.98
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.98
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.98
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.97
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.97
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.97
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.97
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.96
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.96
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.95
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.94
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.94
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.94
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.94
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.94
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.93
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.93
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.92
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.92
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.92
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.91
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.91
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.91
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.9
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.9
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.9
3u4t_A272 TPR repeat-containing protein; structural genomics 99.89
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.89
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.88
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
3u4t_A272 TPR repeat-containing protein; structural genomics 99.88
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.88
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.88
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.87
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.87
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.86
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.86
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.85
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.85
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.84
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.84
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.83
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.83
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.82
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.82
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.82
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.81
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.81
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.81
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.8
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.8
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.8
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.8
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.79
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.79
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.79
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.79
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.78
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.78
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.77
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.76
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.75
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.75
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.73
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.73
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.73
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.72
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.72
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.71
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.71
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.7
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.7
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.7
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.7
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.7
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.69
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.69
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.67
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.66
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.65
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.64
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.64
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.64
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.63
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.63
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.63
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.63
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.61
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.61
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.6
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.6
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.59
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.54
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.52
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.52
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.51
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.51
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.5
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.5
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.5
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.49
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.49
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.48
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.47
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.47
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.46
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.45
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.44
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.44
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.43
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.41
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.4
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.4
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.4
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.39
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.38
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.37
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.37
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.36
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.35
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.34
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.33
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.33
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.33
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.32
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.32
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.32
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.31
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.31
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.3
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.27
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.26
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.26
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.26
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.26
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.23
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.23
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.22
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.22
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.22
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.21
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.21
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.21
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.2
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.19
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.18
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.17
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.17
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.16
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.16
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.15
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.14
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.13
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.11
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.11
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.1
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.09
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.09
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.08
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.08
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.08
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.07
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.06
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.05
3k9i_A117 BH0479 protein; putative protein binding protein, 99.01
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.0
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.99
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.98
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.97
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.97
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.91
3k9i_A117 BH0479 protein; putative protein binding protein, 98.88
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.86
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.85
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.84
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.83
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.83
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.82
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.79
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.75
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.71
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.7
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.69
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.69
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.68
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.62
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.62
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.61
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.58
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.56
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 98.41
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.39
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.36
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 98.35
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.31
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.27
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.24
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.21
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.01
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.99
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.98
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.96
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.95
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.89
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.78
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.77
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 97.7
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 97.52
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.03
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.93
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.72
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.56
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.45
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.44
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.43
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.31
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.7
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.63
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.58
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.22
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.16
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.42
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.36
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.12
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.04
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.88
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.72
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.59
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.51
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 93.45
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 93.21
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 93.05
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.76
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 92.46
2npm_A260 14-3-3 domain containing protein; cell regulator p 92.11
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 90.74
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 90.67
3re2_A472 Predicted protein; menin, multiple endocrine neopl 90.26
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 90.17
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 89.91
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 89.77
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 89.75
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.39
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 89.32
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 89.09
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 88.93
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 88.48
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 88.34
3u84_A 550 Menin; MLL, JUND, ledgf, TPR, transglutaminase-lik 88.07
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 87.94
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 87.75
3iqu_A236 14-3-3 protein sigma; signal transuction, nucleus, 87.2
4gq4_A489 Menin; tumor suppressor, nucleus, transcription-tr 85.3
4b4t_O 393 26S proteasome regulatory subunit RPN9; hydrolase, 83.98
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 82.57
3iqu_A236 14-3-3 protein sigma; signal transuction, nucleus, 80.5
3efz_A268 14-3-3 protein; 14-3-3, cell regulation, structura 80.08
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=1.1e-35  Score=293.46  Aligned_cols=365  Identities=19%  Similarity=0.172  Sum_probs=318.8

Q ss_pred             HHHHHHHHhCCChHHHHHHHHHHHHHHHHhhhCCCCChhHHHHHHHhhHHHhhccChHHHHHHHHHHHHHHhHhhhcCCC
Q 006812          117 KIALKLDQEGGDPEMTLSFANRALNVLDKDERNNRPSLLVAMCLQVMGSANYSFKRFSDSLGYLSKANRMLGRLEEEGLG  196 (630)
Q Consensus       117 ~~g~~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~  196 (630)
                      .+|..++..| ++++|+..++++++..+          ..+.++..+|.++...|++++|..++++++..          
T Consensus         4 ~~a~~~~~~g-~~~~A~~~~~~~~~~~p----------~~~~~~~~l~~~~~~~~~~~~a~~~~~~a~~~----------   62 (388)
T 1w3b_A            4 ELAHREYQAG-DFEAAERHCMQLWRQEP----------DNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ----------   62 (388)
T ss_dssp             THHHHHHHHT-CHHHHHHHHHHHHHHCT----------TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH----------
T ss_pred             hHHHHHHHCC-CHHHHHHHHHHHHHhCC----------CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhc----------
Confidence            4577778888 99999999999887642          33556788999999999999999999999987          


Q ss_pred             CCCccchhhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHH
Q 006812          197 GSVEDIKPIMHAVHLELANVKTAMGRREEALEHLQKCLEIKELILEEDSRELGVANRDLAEAFVAVLNFKEALPFGLKAL  276 (630)
Q Consensus       197 ~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al  276 (630)
                            .|....+++.+|.++...|++++|+..|++++++.        |....++..+|.++...|++++|+..|++++
T Consensus        63 ------~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~--------p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al  128 (388)
T 1w3b_A           63 ------NPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLK--------PDFIDGYINLAAALVAAGDMEGAVQAYVSAL  128 (388)
T ss_dssp             ------CTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC--------TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHH
T ss_pred             ------CCCchHHHHHHHHHHHHCCCHHHHHHHHHHHHHcC--------cchHHHHHHHHHHHHHcCCHHHHHHHHHHHH
Confidence                  34446788999999999999999999999998643        4446789999999999999999999999999


Q ss_pred             HHHhhhcCCCCHHHHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHHcCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHH
Q 006812          277 EIHKKGLGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQIALGKFEEAINTLKG  356 (630)
Q Consensus       277 ~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~  356 (630)
                      ++.+        ....++..+|.++...|++++|+..|++++..      .|....++..+|.++...|++++|+..|++
T Consensus       129 ~~~p--------~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~------~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~  194 (388)
T 1w3b_A          129 QYNP--------DLYCVRSDLGNLLKALGRLEEAKACYLKAIET------QPNFAVAWSNLGCVFNAQGEIWLAIHHFEK  194 (388)
T ss_dssp             HHCT--------TCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHH------CTTCHHHHHHHHHHHHTTTCHHHHHHHHHH
T ss_pred             HhCC--------CcHHHHHHHHHHHHHccCHHHHHHHHHHHHHh------CCCCHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            8643        33466788999999999999999999999886      677788999999999999999999999999


Q ss_pred             HHHHhhhcchHHHHHHHHHHHHHHhhccHHHHHHHHHHHHHHHHhhcCCCcHHHHHHHHHHHHHHHHcCCHHHHHHHHHH
Q 006812          357 VVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGILDKKETISPEEVADAYSEISMQYESMNEFETAISLLKR  436 (630)
Q Consensus       357 ~l~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~  436 (630)
                      ++...+..    ..++..+|.++...|++++|+..+++++.+.        |....++..+|.++...|++++|+..|++
T Consensus       195 al~~~p~~----~~~~~~lg~~~~~~~~~~~A~~~~~~al~~~--------p~~~~~~~~l~~~~~~~g~~~~A~~~~~~  262 (388)
T 1w3b_A          195 AVTLDPNF----LDAYINLGNVLKEARIFDRAVAAYLRALSLS--------PNHAVVHGNLACVYYEQGLIDLAIDTYRR  262 (388)
T ss_dssp             HHHHCTTC----HHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC--------TTCHHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred             HHhcCCCc----HHHHHHHHHHHHHcCCHHHHHHHHHHHHhhC--------cCCHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            99975544    4589999999999999999999999998874        45567889999999999999999999999


Q ss_pred             HHHHHHhCCCCCCchhHHHHHHHHHHHHcCChhhHHHHHHHHHHHHHHhcCCCCccHHHHHHHHHHHHHHcCChhHHHHH
Q 006812          437 TLALLEKLPQAQHSEGSVSARIGWLLLLTGKVPQAIPYLESAAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQV  516 (630)
Q Consensus       437 al~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~  516 (630)
                      ++++     .+.  ...++..+|.++...|++++|+.+|++++++        .|....++..+|.++...|++++|+..
T Consensus       263 al~~-----~p~--~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~--------~p~~~~~~~~l~~~~~~~g~~~~A~~~  327 (388)
T 1w3b_A          263 AIEL-----QPH--FPDAYCNLANALKEKGSVAEAEDCYNTALRL--------CPTHADSLNNLANIKREQGNIEEAVRL  327 (388)
T ss_dssp             HHHT-----CSS--CHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH--------CTTCHHHHHHHHHHHHTTTCHHHHHHH
T ss_pred             HHhh-----CCC--CHHHHHHHHHHHHHcCCHHHHHHHHHHHHhh--------CcccHHHHHHHHHHHHHcCCHHHHHHH
Confidence            9985     222  2457899999999999999999999999984        355567899999999999999999999


Q ss_pred             HHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHH
Q 006812          517 FAFAKDIMDVSLGPHHADSIEACQNLSKAYSSMGSYTLAIEFQQRAIDA  565 (630)
Q Consensus       517 ~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~  565 (630)
                      |+++++        ..|+...++.++|.+|...|++++|+..|++++++
T Consensus       328 ~~~al~--------~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~  368 (388)
T 1w3b_A          328 YRKALE--------VFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI  368 (388)
T ss_dssp             HHHHTT--------SCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT
T ss_pred             HHHHHh--------cCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhh
Confidence            999987        45666789999999999999999999999999864



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>3re2_A Predicted protein; menin, multiple endocrine neoplasia 1, tumor suppressor, MIX lineage leukemia, unknown function; 1.95A {Nematostella vectensis} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>3u84_A Menin; MLL, JUND, ledgf, TPR, transglutaminase-like, transcription, epigenetics, cancer; 2.50A {Homo sapiens} PDB: 3u85_A 3u86_A 3u88_A* Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... Back     alignment and structure
>4gq4_A Menin; tumor suppressor, nucleus, transcription-transcription inhib complex; HET: 0RT EPE PE4; 1.27A {Homo sapiens} PDB: 4gq3_A* 4gpq_A* 4gq6_A* Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... Back     alignment and structure
>3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 630
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-11
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.003
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-11
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-07
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 2e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 7e-06
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-04
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 2e-05
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 1e-04
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.002
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 67.4 bits (163), Expect = 1e-12
 Identities = 59/402 (14%), Positives = 109/402 (27%), Gaps = 50/402 (12%)

Query: 178 GYLSKANRML--GRLEE-EGLGGSVEDIKPIMHAVHLELANVKTAMGRREEALEHLQKCL 234
           G +  A+R    G  E  E     +   +P    V L L+++     R + +       +
Sbjct: 1   GPMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAI 60

Query: 235 EIKE------------LILEEDSRELGVANRDLAEAFVAVLNFKEALPFGLKALEIHKKG 282
           +                      +E     R         ++    L   L A    +  
Sbjct: 61  KQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGA 120

Query: 283 LGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSELLRAEIDAANMQI 342
           +      + ++  L  V        +      E     LK          A  +   +  
Sbjct: 121 VQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFN 180

Query: 343 ALGKFEEAINTLKGVVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGILDKK 402
           A G+   AI+  +  V       +     +I++G  L     F  A      A  +    
Sbjct: 181 AQGEIWLAIHHFEKAVTLDPNFLD----AYINLGNVLKEARIFDRAVAAYLRALSL---- 232

Query: 403 ETISPEEVADAYSEISMQYESMNEFETAISLLKRTLALLEKLPQAQHSEGSVSARIGWLL 462
                   A  +  ++  Y      + AI   +R + L    P A  +       +   L
Sbjct: 233 ----SPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCN-------LANAL 281

Query: 463 LLTGKVPQAIPYLESAAERLKESFGPKHFGVGYIYNNLGAAYLELDRPQSAAQVFAFAKD 522
              G V +A     +A                   NNL     E    + A +++  A +
Sbjct: 282 KEKGSVAEAEDCYNTAL--------RLCPTHADSLNNLANIKREQGNIEEAVRLYRKALE 333

Query: 523 IMDVSLGPHHADSIEACQNLSKAYSSMGSYTLAIEFQQRAID 564
           +          +   A  NL+      G    A+   + AI 
Sbjct: 334 V--------FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR 367


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query630
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.97
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.94
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.92
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.9
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.81
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.8
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.78
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.76
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.73
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.71
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.7
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.69
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.45
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.4
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.4
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.39
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.36
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.34
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.33
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.31
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.31
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.3
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.3
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.24
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.24
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.23
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.23
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.22
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.22
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.21
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.21
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.2
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.18
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.14
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.04
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.04
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.01
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.0
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.8
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.78
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.56
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.53
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.28
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.26
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.16
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.92
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.28
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.79
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.53
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 94.22
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 93.86
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 92.32
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 91.36
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 90.85
d3efza1223 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ 89.0
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 86.8
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 82.4
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 81.6
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 81.33
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 80.85
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 80.6
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.5e-31  Score=261.77  Aligned_cols=360  Identities=18%  Similarity=0.191  Sum_probs=294.0

Q ss_pred             HHHHHHHHHhCCChHHHHHHHHHHHHHHHHhhhCCCCChhHHHHHHHhhHHHhhccChHHHHHHHHHHHHHHhHhhhcCC
Q 006812          116 LKIALKLDQEGGDPEMTLSFANRALNVLDKDERNNRPSLLVAMCLQVMGSANYSFKRFSDSLGYLSKANRMLGRLEEEGL  195 (630)
Q Consensus       116 ~~~g~~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~  195 (630)
                      +.+|..++..| ++++|+..|+++++..+          ....++..+|.+|...|++++|+.+|++++++         
T Consensus         3 l~la~~~~~~G-~~~~A~~~~~~~l~~~p----------~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~---------   62 (388)
T d1w3ba_           3 MELAHREYQAG-DFEAAERHCMQLWRQEP----------DNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ---------   62 (388)
T ss_dssp             CTHHHHHHHHT-CHHHHHHHHHHHHHHCT----------TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH---------
T ss_pred             HHHHHHHHHcC-CHHHHHHHHHHHHHhCC----------CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh---------
Confidence            45788888888 99999999999987642          33567889999999999999999999999988         


Q ss_pred             CCCCccchhhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHhcc--------------------------chHHHH
Q 006812          196 GGSVEDIKPIMHAVHLELANVKTAMGRREEALEHLQKCLEIKELILEE--------------------------DSRELG  249 (630)
Q Consensus       196 ~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~--------------------------~~~~~~  249 (630)
                             .|....++..+|.+|..+|++++|+..+..+.+........                          ..+...
T Consensus        63 -------~p~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  135 (388)
T d1w3ba_          63 -------NPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLY  135 (388)
T ss_dssp             -------CTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCT
T ss_pred             -------CCCCHHHHHHHHHHhhhhccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence                   33345778899999999999999999999887643211000                          000001


Q ss_pred             HHHHHHHHHHHHhcCHHHHHHHHHHHHHHHhhhcCCCCHHHHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHHcCCChh
Q 006812          250 VANRDLAEAFVAVLNFKEALPFGLKALEIHKKGLGHNSVEVAHDRRLLGVIYSGLEEHQKALEQNELSQKVLKTWGLSSE  329 (630)
Q Consensus       250 ~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~  329 (630)
                      ......+......+....+...+.+.+..        .+....++..+|..+...|++++|...+++++.+      .|.
T Consensus       136 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~------~p~  201 (388)
T d1w3ba_         136 CVRSDLGNLLKALGRLEEAKACYLKAIET--------QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL------DPN  201 (388)
T ss_dssp             HHHHHHHHHHHTTSCHHHHHHHHHHHHHH--------CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHH------CTT
T ss_pred             cccccccccccccchhhhhHHHHHHhhcc--------CcchhHHHHhhcccccccCcHHHHHHHHHHHHHh------Ccc
Confidence            12333444555556666666666665543        2344567888999999999999999999999887      677


Q ss_pred             HHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHhhhcchHHHHHHHHHHHHHHhhccHHHHHHHHHHHHHHHHhhcCCCcHH
Q 006812          330 LLRAEIDAANMQIALGKFEEAINTLKGVVRQTEKESETRALVFISMGKALCNQEKFADAKRCLEIACGILDKKETISPEE  409 (630)
Q Consensus       330 ~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~a~~~~~~~~~~~~~~  409 (630)
                      ...++..+|.++...|++++|+..++++....+..    ...+..+|.++...|++++|+..+++++++.        |.
T Consensus       202 ~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~----~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~--------p~  269 (388)
T d1w3ba_         202 FLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNH----AVVHGNLACVYYEQGLIDLAIDTYRRAIELQ--------PH  269 (388)
T ss_dssp             CHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTC----HHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC--------SS
T ss_pred             cHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhH----HHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC--------CC
Confidence            88899999999999999999999999998865443    4578899999999999999999999998764        45


Q ss_pred             HHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhCCCCCCchhHHHHHHHHHHHHcCChhhHHHHHHHHHHHHHHhcCCC
Q 006812          410 VADAYSEISMQYESMNEFETAISLLKRTLALLEKLPQAQHSEGSVSARIGWLLLLTGKVPQAIPYLESAAERLKESFGPK  489 (630)
Q Consensus       410 ~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~  489 (630)
                      ...++..+|.++...|++++|+..+++++..     .  +.....+..+|.++...|++++|+.+|+++++        .
T Consensus       270 ~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~-----~--~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~--------~  334 (388)
T d1w3ba_         270 FPDAYCNLANALKEKGSVAEAEDCYNTALRL-----C--PTHADSLNNLANIKREQGNIEEAVRLYRKALE--------V  334 (388)
T ss_dssp             CHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH-----C--TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTT--------S
T ss_pred             CHHHHHHHHHHHHHcCCHHHHHHHHHhhhcc-----C--CccchhhhHHHHHHHHCCCHHHHHHHHHHHHH--------h
Confidence            5678999999999999999999999998875     2  22345789999999999999999999999987        3


Q ss_pred             CccHHHHHHHHHHHHHHcCChhHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHhcCC
Q 006812          490 HFGVGYIYNNLGAAYLELDRPQSAAQVFAFAKDIMDVSLGPHHADSIEACQNLSKAYSSMGS  551 (630)
Q Consensus       490 ~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~  551 (630)
                      +|....++.++|.+|...|++++|+.+|+++++        .+|+...++.+||.+|.++||
T Consensus       335 ~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~--------l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         335 FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR--------ISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT--------TCTTCHHHHHHHHHHHHHTCC
T ss_pred             CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH--------hCCCCHHHHHHHHHHHHHcCC
Confidence            567788999999999999999999999999998        456667899999999999986



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure