Citrus Sinensis ID: 006864


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63
MAASSSSSSSIKPIFTTRSKSSNSSKSSLLSFLHNTKPKPISLKFSSHNSNYTTPPSFTISNSLQTALETSELHVSKFQDDLNVQAVTPKPTILVSEKLGEAGLAILRSFGNVECLYDLSPEALCEKISQCDALIVRSGTKVTRSVFEAANGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPIANTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGMNVIAHDPYAPADKARAVGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEALVRALDSGVVAQAALDVFTEEPPAKDSKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAVVGALRGELSATAINAPMVPSEVLSELAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSARDPDDLDTRILRAMITKGIIEPISASFINLVNADFTAKQKGLRISEERVVADSSPEFPIDSIQVQLSNVDSKFAAAVSENGEISIEGKVKFGIPHLTRVGSFGVDASLEGNLILCRQVDQPGMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAIGVDEEPNQDSLKEIGKVHFVARIL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccEEEEcccccHHHHHHHHccccEEEEccccHHHHHHHcccccEEEEcccccccHHHHHHcccccEEEEEcccccccccHHHHHHcccEEEcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccEEEcccccEEEEEcccHHHHHHHHHHHccccEEEEEcccccHHHHHHcccEEEcHHHHHHcccEEEEcccccccccccccHHHHHHcccccEEEEccccccccHHHHHHHHHcccEEEEEEcccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHcccHHHHHHHHHHHHHHHHccccccEEEEEEEEEccccccccHHHHHHHHHHHHccccccccccEEcHHHHHHHcccEEEEEEEEcccccccccEEEEEEEEccccccEEEEccccEEEEEEEEEcccEEEEEEccEEEEEEEccEEEEEEEccccccHHHHHHHHHcccccccEEEEccccccccEEEEEEccccccHHHHHHHHcccccEEcc
cccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccHHEEcccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHcccEEEcccccHHHHHHHHHcccEEEEEcccccHHHHHHHHccccEEEEEcccccccccHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccEEEEEEcccEEEEEcccHHHHHHHHHHHccccEEEEEcccccccHHHHcccEEcccHHHHHHccEEEEcccccccccccEcHHHHccccccEEEEEcccHHHEcHHHHHHHHHcccEEEEEEcccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccccEccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccHcccccHHHHHHHHHHHHHHHHHccccEEcHHHHHHHcccEEEEEEEcccccccccEEEEEEEEEccccEEEEEEEcccEEEEEEEEEcccEEEEEEccEEEEEccccEEEEEEccccccEEEEEEEEEccccEEEEEEEEccccccccEEEEEEccccccHHHHHHHHccccccEcc
maasssssssikpifttrskssnssksSLLSFlhntkpkpislkfsshnsnyttppsftisNSLQTALETSELHVSKfqddlnvqavtpkptilVSEKLGEAGLAILRSFGnveclydlspealcekISQCDALIVRSGTKVTRSVFEAANGKLKvvgragvgidnvdlqaatefgclvvnapianTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGlgmnviahdpyapadkaRAVGVELVSFDQALATADFislhmplnpttskifndETFAKMKKGVRIVNvarggvideEALVRALDSGVVAQAALDvfteeppakdsklvqhenvtvtphlgastkEAQEGVAIEIAEAVVGALRGElsatainapmvpsevlseLAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRsardpddlDTRILRAMITKGIIEPISASFINlvnadftakqkglriseervvadsspefpidsiqvQLSNVDSKFAAAVsengeisiegkvkfgiphltrvgsfgvdaslegnlilcrqvdqpgmigkvgnILGEHNVNVNFMSVgrtfrrnhgimaigvdeepnqdslkeIGKVHFVARIL
maasssssssikpifttrskssnsskSSLLSFLHNTKPKPISLKFSSHNSNYTTPPSFTISNSLQTALETSELHVSKFQDDLNVQAVTPKPTILVSEKLGEAGLAILRSFGNVECLYDLSPEALCEKISQCDALIVRSGTKVTRSVFEaangklkvvgrAGVGIDNVDLQAATEFGCLVVNAPIANTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGMNVIAHDPYAPADKARAVGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEALVRALDSGVVAQAALDVFTeeppakdsklvqhENVTVTPHLGASTKEAQEGVAIEIAEAVVGALRGELSATAINAPMVPSEVLSELAPYVVLAKKLGRLAVQlvsggsgiksvkliyrsardpddldTRILRAMITKGIIEPISASFINLVNADFTAKQKGLRISEERVVADSSPEFPIDSIQVQLSNVDSKFAAAVSENGEISIEGKVKFGIPHLTRVGSFGVDASLEGNLILCRQVDQPGMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAigvdeepnqdslkeigkvhfvaril
MAAsssssssIKPIFTTRskssnsskssllsFLHNTKPKPISLKFSSHNSNYTTPPSFTISNSLQTALETSELHVSKFQDDLNVQAVTPKPTILVSEKLGEAGLAILRSFGNVECLYDLSPEALCEKISQCDALIVRSGTKVTRSVFEAANGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPIANTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGMNVIAHDPYAPADKARAVGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEALVRALDSGVVAQAALDVFTEEPPAKDSKLVQHENVTVTPHLGASTKeaqegvaieiaeavvgaLRGELSATAINAPMVPSEVLSELAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSARDPDDLDTRILRAMITKGIIEPISASFINLVNADFTAKQKGLRISEERVVADSSPEFPIDSIQVQLSNVDSKFAAAVSENGEISIEGKVKFGIPHLTRVGSFGVDASLEGNLILCRQVDQPGMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAIGVDEEPNQDSLKEIGKVHFVARIL
*************************************************************************HVSKFQDDLNVQAVTPKPTILVSEKLGEAGLAILRSFGNVECLYDLSPEALCEKISQCDALIVRSGTKVTRSVFEAANGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPIANTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGMNVIAHDPYAPADKARAVGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEALVRALDSGVVAQAALDVFT******************************EGVAIEIAEAVVGALRGELSATAINAPMVPSEVLSELAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSARDPDDLDTRILRAMITKGIIEPISASFINLVNADFTAKQKGLRIS*************IDSIQVQLSNVDSKFAAAVSENGEISIEGKVKFGIPHLTRVGSFGVDASLEGNLILCRQVDQPGMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAIGVD***********GKVHFV****
*******************************************************************************************TILVSEKLGEAGLAILRSFGNVECLYDLSPEALCEKISQCDALIVRSGTKVTRSVFEAANGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPIANTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGMNVIAHDPYAPADKARAVGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEALVRALDSGVVAQAALDVFTEEPPAKDSKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAVVGALRGELSATAINAPMVPSEVLSELAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSARDPDDLDTRILRAMITKGIIEPISASFINLVNADFTAKQKGLRISE*************DSIQVQLSNVDSKFAAAVSENGEISIEGKVKFGIPHLTRVGSFGVDASLEGNLILCRQVDQPGMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAIGVDEEPNQDSLKEIGKVHFVARIL
*****************************LSFLHNTKPKPISLKFSSHNSNYTTPPSFTISNSLQTALETSELHVSKFQDDLNVQAVTPKPTILVSEKLGEAGLAILRSFGNVECLYDLSPEALCEKISQCDALIVRSGTKVTRSVFEAANGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPIANTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGMNVIAHDPYAPADKARAVGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEALVRALDSGVVAQAALDVFTEEPPAKDSKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAVVGALRGELSATAINAPMVPSEVLSELAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSARDPDDLDTRILRAMITKGIIEPISASFINLVNADFTAKQKGLRISEERVVADSSPEFPIDSIQVQLSNVDSKFAAAVSENGEISIEGKVKFGIPHLTRVGSFGVDASLEGNLILCRQVDQPGMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAIGVDEEPNQDSLKEIGKVHFVARIL
**************************************KPISLKFSSHN*************************************VTPKPTILVSEKLGEAGLAILRSFGNVECLYDLSPEALCEKISQCDALIVRSGTKVTRSVFEAANGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPIANTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGMNVIAHDPYAPADKARAVGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEALVRALDSGVVAQAALDVFTEEPPAKDSKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAVVGALRGELSATAINAPMVPSEVLSELAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSARDPDDLDTRILRAMITKGIIEPISASFINLVNADFTAKQKGLRISEERVVADSSPEFPIDSIQVQLSNVDSKFAAAVSENGEISIEGKVKFGIPHLTRVGSFGVDASLEGNLILCRQVDQPGMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAIGVDEEPNQDSLKEIGKVHFVARIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASSSSSSSIKPIFTTRSKSSNSSKSSLLSFLHNTKPKPISLKFSSHNSNYTTPPSFTISNSLQTALETSELHVSKFQDDLNVQAVTPKPTILVSEKLGEAGLAILRSFGNVECLYDLSPEALCEKISQCDALIVRSGTKVTRSVFEAANGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPIANTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGMNVIAHDPYAPADKARAVGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEALVRALDSGVVAQAALDVFTEEPPAKDSKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAVVGALRGELSATAINAPMVPSEVLSELAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSARDPDDLDTRILRAMITKGIIEPISASFINLVNADFTAKQKGLRISEERVVADSSPEFPIDSIQVQLSNVDSKFAAAVSENGEISIEGKVKFGIPHLTRVGSFGVDASLEGNLILCRQVDQPGMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAIGVDEEPNQDSLKEIGKVHFVARIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query628 2.2.26 [Sep-21-2011]
O04130624 D-3-phosphoglycerate dehy yes no 0.961 0.967 0.733 0.0
Q58424524 D-3-phosphoglycerate dehy yes no 0.816 0.979 0.428 1e-108
P73821554 D-3-phosphoglycerate dehy N/A no 0.812 0.920 0.386 8e-98
O29445527 D-3-phosphoglycerate dehy yes no 0.805 0.960 0.396 1e-97
O27051525 D-3-phosphoglycerate dehy yes no 0.815 0.975 0.372 4e-96
P35136525 D-3-phosphoglycerate dehy yes no 0.805 0.963 0.380 2e-95
O08651533 D-3-phosphoglycerate dehy yes no 0.614 0.724 0.429 1e-81
Q5EAD2533 D-3-phosphoglycerate dehy yes no 0.613 0.722 0.430 2e-81
Q61753533 D-3-phosphoglycerate dehy yes no 0.614 0.724 0.422 5e-81
Q60HD7533 D-3-phosphoglycerate dehy N/A no 0.613 0.722 0.421 8e-81
>sp|O04130|SERA_ARATH D-3-phosphoglycerate dehydrogenase, chloroplastic OS=Arabidopsis thaliana GN=At1g17745 PE=1 SV=2 Back     alignment and function desciption
 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/627 (73%), Positives = 528/627 (84%), Gaps = 23/627 (3%)

Query: 3   ASSSSSSSIKPI---FTTRSKSSNSSKSSLLSFLHNTKPKPISLKFSSHNSNYTTPPSFT 59
           A SSS SS+K +   +T+ S S +S  + L +FLH                 Y T    T
Sbjct: 2   AFSSSCSSVKAVNSRWTSPSPSPSSRFAVLPAFLHR---------------RYATSVKLT 46

Query: 60  -ISNSLQTALETSELHVSKFQ----DDLNVQAVTPKPTILVSEKLGEAGLAILRSFGNVE 114
            IS +L+T  +T+    ++F     D        PKP ILV+EKLGEAG+ +LR FG+V+
Sbjct: 47  AISAALKTVEQTTLTEDNRFSTVGSDSDEYNPTLPKPRILVTEKLGEAGVNLLREFGDVD 106

Query: 115 CLYDLSPEALCEKISQCDALIVRSGTKVTRSVFEAANGKLKVVGRAGVGIDNVDLQAATE 174
           C YDLSPE L +K+++ DALIVRSGTKVTR VFEAA G+LKVVGRAGVGIDNVDLQAATE
Sbjct: 107 CSYDLSPEDLKKKVAESDALIVRSGTKVTREVFEAAKGRLKVVGRAGVGIDNVDLQAATE 166

Query: 175 FGCLVVNAPIANTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAV 234
            GCLVVNAP ANTVAAAEHGIALLASMARNV+QADASIKAGKW RSKYVGVSLVGKTLAV
Sbjct: 167 HGCLVVNAPTANTVAAAEHGIALLASMARNVAQADASIKAGKWERSKYVGVSLVGKTLAV 226

Query: 235 MGFGKVGSEVARRAKGLGMNVIAHDPYAPADKARAVGVELVSFDQALATADFISLHMPLN 294
           MGFGKVG+EVARRAKGLGM VI+HDPYAPAD+ARA+GV+LVSFDQA++TADF+SLHMPL 
Sbjct: 227 MGFGKVGTEVARRAKGLGMTVISHDPYAPADRARALGVDLVSFDQAISTADFVSLHMPLT 286

Query: 295 PTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEALVRALDSGVVAQAALDVFTEEPPAKD 354
           P T K+FNDETF+KMKKGVR++NVARGGVIDE+ALVRALD+G+VAQAALDVF EEPP+KD
Sbjct: 287 PATKKVFNDETFSKMKKGVRLINVARGGVIDEDALVRALDAGIVAQAALDVFCEEPPSKD 346

Query: 355 SKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAVVGALRGELSATAINAPMVPSEVLSEL 414
           S+L+QHENVTVTPHLGASTKEAQEGVAIEIAEAV GAL+GELSATA+NAPMV  EVLSEL
Sbjct: 347 SRLIQHENVTVTPHLGASTKEAQEGVAIEIAEAVAGALKGELSATAVNAPMVAPEVLSEL 406

Query: 415 APYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSARDPDDLDTRILRAMITKGIIEPISAS 474
            PY+VLA+KLGRLAVQL SGG G++S++++YRSARD DDLDTR+LRAMITKGIIEPIS S
Sbjct: 407 TPYIVLAEKLGRLAVQLASGGKGVQSIRVVYRSARDRDDLDTRLLRAMITKGIIEPISDS 466

Query: 475 FINLVNADFTAKQKGLRISEERVVADSSPEFPIDSIQVQLSNVDSKFAAAVSENGEISIE 534
           ++NLVNADF AKQKGLRISEER+V DSSPE+P+DSIQVQ+ NV+S FA AVS+ G+ISIE
Sbjct: 467 YVNLVNADFIAKQKGLRISEERMVVDSSPEYPVDSIQVQILNVESNFAGAVSDAGDISIE 526

Query: 535 GKVKFGIPHLTRVGSFGVDASLEGNLILCRQVDQPGMIGKVGNILGEHNVNVNFMSVGRT 594
           GKVK+G+PHLT VGSFGVD SLEGNLILCRQVDQPGMIG+VGNILGE NVNVNFMSVGRT
Sbjct: 527 GKVKYGVPHLTCVGSFGVDVSLEGNLILCRQVDQPGMIGQVGNILGEQNVNVNFMSVGRT 586

Query: 595 FRRNHGIMAIGVDEEPNQDSLKEIGKV 621
             R   IMAIGVDEEP+  +L+ IG V
Sbjct: 587 VLRKQAIMAIGVDEEPDNKTLERIGGV 613





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 9EC: 5
>sp|Q58424|SERA_METJA D-3-phosphoglycerate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=serA PE=3 SV=1 Back     alignment and function description
>sp|P73821|SERA_SYNY3 D-3-phosphoglycerate dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=serA PE=3 SV=1 Back     alignment and function description
>sp|O29445|SERA_ARCFU D-3-phosphoglycerate dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=serA PE=3 SV=1 Back     alignment and function description
>sp|O27051|SERA_METTH D-3-phosphoglycerate dehydrogenase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=serA PE=3 SV=1 Back     alignment and function description
>sp|P35136|SERA_BACSU D-3-phosphoglycerate dehydrogenase OS=Bacillus subtilis (strain 168) GN=serA PE=3 SV=3 Back     alignment and function description
>sp|O08651|SERA_RAT D-3-phosphoglycerate dehydrogenase OS=Rattus norvegicus GN=Phgdh PE=1 SV=3 Back     alignment and function description
>sp|Q5EAD2|SERA_BOVIN D-3-phosphoglycerate dehydrogenase OS=Bos taurus GN=PHGDH PE=2 SV=3 Back     alignment and function description
>sp|Q61753|SERA_MOUSE D-3-phosphoglycerate dehydrogenase OS=Mus musculus GN=Phgdh PE=1 SV=3 Back     alignment and function description
>sp|Q60HD7|SERA_MACFA D-3-phosphoglycerate dehydrogenase OS=Macaca fascicularis GN=PHGDH PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query628
224100535637 predicted protein [Populus trichocarpa] 0.985 0.971 0.788 0.0
224113315633 predicted protein [Populus trichocarpa] 0.971 0.963 0.781 0.0
357467711630 Phosphoglycerate dehydrogenase [Medicago 0.972 0.969 0.769 0.0
356521735623 PREDICTED: d-3-phosphoglycerate dehydrog 0.964 0.972 0.772 0.0
356526328621 PREDICTED: d-3-phosphoglycerate dehydrog 0.968 0.979 0.768 0.0
225443272624 PREDICTED: d-3-phosphoglycerate dehydrog 0.847 0.852 0.862 0.0
255568067633 d-3-phosphoglycerate dehydrogenase, puta 0.977 0.969 0.747 0.0
449461667631 PREDICTED: d-3-phosphoglycerate dehydrog 0.982 0.977 0.766 0.0
449533397594 PREDICTED: d-3-phosphoglycerate dehydrog 0.898 0.949 0.808 0.0
18394525624 D-3-phosphoglycerate dehydrogenase [Arab 0.961 0.967 0.733 0.0
>gi|224100535|ref|XP_002311914.1| predicted protein [Populus trichocarpa] gi|222851734|gb|EEE89281.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/628 (78%), Positives = 550/628 (87%), Gaps = 9/628 (1%)

Query: 1   MAASSSSSSSIKPIFTT-RSKSSNSSKSSLLSFLHNTKPKPISLKFSSHNSNY-----TT 54
           MA+SS+   S  P  TT  S S  S++SSLLSFL NT P PISLK S   +++     ++
Sbjct: 1   MASSSTKPISTPPFTTTISSSSQPSTRSSLLSFLRNTTPTPISLKLSHSRNSFLNSHSSS 60

Query: 55  PPSFTISNSLQTALETSELHVSKFQ-DDLNVQAVTPKPTILVSEKLGEAGLAILRSFGNV 113
             S +I N+ +T        VSK    D + Q    KPTILVSEKLGEAGL +LRSFG+V
Sbjct: 61  SRSLSIKNATKTIESAETSRVSKVGGQDADSQET--KPTILVSEKLGEAGLELLRSFGDV 118

Query: 114 ECLYDLSPEALCEKISQCDALIVRSGTKVTRSVFEAANGKLKVVGRAGVGIDNVDLQAAT 173
           +C YDLS E LC+KI+ CDALIVRSGTKVTR VFEAA GKLKVVGRAGVGIDNVDLQAAT
Sbjct: 119 DCSYDLSQEDLCKKIASCDALIVRSGTKVTRQVFEAAKGKLKVVGRAGVGIDNVDLQAAT 178

Query: 174 EFGCLVVNAPIANTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLA 233
           EFGCLVVNAP ANTVAAAEHGIALLA+MARNV+QADAS+KAG+W R+KYVGVSLVGKTLA
Sbjct: 179 EFGCLVVNAPTANTVAAAEHGIALLAAMARNVAQADASMKAGQWQRNKYVGVSLVGKTLA 238

Query: 234 VMGFGKVGSEVARRAKGLGMNVIAHDPYAPADKARAVGVELVSFDQALATADFISLHMPL 293
           VMGFGKVGSEVARRAKGLGM VIAHDPYAPAD+ARA+GVELVSFDQA++TADFISLHMPL
Sbjct: 239 VMGFGKVGSEVARRAKGLGMQVIAHDPYAPADRARAIGVELVSFDQAISTADFISLHMPL 298

Query: 294 NPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEALVRALDSGVVAQAALDVFTEEPPAK 353
            P+T K+FND+TFAK+K GVRI+NVARGGVIDE+ALVRALDSG VAQAALDVFTEEPP K
Sbjct: 299 TPSTEKVFNDDTFAKVKTGVRIINVARGGVIDEDALVRALDSGKVAQAALDVFTEEPPPK 358

Query: 354 DSKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAVVGALRGELSATAINAPMVPSEVLSE 413
           DSKLVQHE VTVTPHLGASTKEAQEGVAIEIAEAVVGAL+GEL+ATA+NAPMVP+EVLSE
Sbjct: 359 DSKLVQHERVTVTPHLGASTKEAQEGVAIEIAEAVVGALQGELAATAVNAPMVPAEVLSE 418

Query: 414 LAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSARDPDDLDTRILRAMITKGIIEPISA 473
           LAPYVVLA+KLGRLAVQLV+GGSGIKS K++YRS+RDPDDLDTR+LRAMITKGIIEPIS 
Sbjct: 419 LAPYVVLAEKLGRLAVQLVAGGSGIKSAKVVYRSSRDPDDLDTRLLRAMITKGIIEPISD 478

Query: 474 SFINLVNADFTAKQKGLRISEERVVADSSPEFPIDSIQVQLSNVDSKFAAAVSENGEISI 533
           SFINLVNADFTAKQKGLRISEERVV D+SPEFPI SIQVQLSNVDSKF + VSE G+ISI
Sbjct: 479 SFINLVNADFTAKQKGLRISEERVVVDTSPEFPIHSIQVQLSNVDSKFGSGVSEGGDISI 538

Query: 534 EGKVKFGIPHLTRVGSFGVDASLEGNLILCRQVDQPGMIGKVGNILGEHNVNVNFMSVGR 593
           EG+VK+G PHLTRVGSF VD SLEGNLILCRQVDQPGMIG+VGNILGE NVNV+FMSVGR
Sbjct: 539 EGRVKYGKPHLTRVGSFSVDVSLEGNLILCRQVDQPGMIGQVGNILGEQNVNVSFMSVGR 598

Query: 594 TFRRNHGIMAIGVDEEPNQDSLKEIGKV 621
           T +R   IMAIGVDEEPNQ++LK+IG+V
Sbjct: 599 TVQRRKAIMAIGVDEEPNQETLKKIGEV 626




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224113315|ref|XP_002316453.1| predicted protein [Populus trichocarpa] gi|222865493|gb|EEF02624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357467711|ref|XP_003604140.1| Phosphoglycerate dehydrogenase [Medicago truncatula] gi|355505195|gb|AES86337.1| Phosphoglycerate dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356521735|ref|XP_003529507.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|356526328|ref|XP_003531770.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|225443272|ref|XP_002273552.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255568067|ref|XP_002525010.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis] gi|223535718|gb|EEF37382.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449461667|ref|XP_004148563.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449533397|ref|XP_004173662.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|18394525|ref|NP_564034.1| D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana] gi|3122858|sp|O04130.2|SERA_ARATH RecName: Full=D-3-phosphoglycerate dehydrogenase, chloroplastic; Short=3-PGDH; Flags: Precursor gi|9802747|gb|AAF99816.1|AC034257_8 D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana] gi|2189964|dbj|BAA20405.1| Phosphoglycerate dehydrogenase [Arabidopsis thaliana] gi|2804258|dbj|BAA24440.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana] gi|15215740|gb|AAK91415.1| At1g17740/F11A6_16 [Arabidopsis thaliana] gi|20466083|gb|AAM19963.1| At1g17740/F11A6_16 [Arabidopsis thaliana] gi|21554130|gb|AAM63210.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana] gi|332191509|gb|AEE29630.1| D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query628
TAIR|locus:2124266603 EDA9 "embryo sac development a 0.847 0.882 0.75 8.9e-212
TAIR|locus:2090649588 AT3G19480 [Arabidopsis thalian 0.847 0.904 0.723 3e-204
TIGR_CMR|DET_0599526 DET_0599 "D-3-phosphoglycerate 0.794 0.948 0.375 3.2e-88
TIGR_CMR|CHY_2698525 CHY_2698 "D-3-phosphoglycerate 0.686 0.820 0.407 1.5e-83
TIGR_CMR|GSU_1198542 GSU_1198 "D-3-phosphoglycerate 0.807 0.935 0.353 6e-80
TIGR_CMR|SPO_3355531 SPO_3355 "D-3-phosphoglycerate 0.692 0.819 0.402 1.7e-75
UNIPROTKB|E1C7Y3525 PHGDH "Uncharacterized protein 0.679 0.813 0.393 6.5e-74
RGD|61987533 Phgdh "phosphoglycerate dehydr 0.630 0.742 0.415 3.6e-73
MGI|MGI:1355330533 Phgdh "3-phosphoglycerate dehy 0.630 0.742 0.407 1.2e-72
UNIPROTKB|O43175533 PHGDH "D-3-phosphoglycerate de 0.630 0.742 0.412 2e-72
TAIR|locus:2124266 EDA9 "embryo sac development arrest 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2047 (725.6 bits), Expect = 8.9e-212, P = 8.9e-212
 Identities = 399/532 (75%), Positives = 467/532 (87%)

Query:    90 KPTILVSEKLGEAGLAILRSFGNVECLYDLSPEALCEKISQCDALIVRSGTKVTRSVFEA 149
             KPTILV+EKLG+AG+ +L    NV+C Y+++PE L  KIS CDALIVRSGTKV R VFE+
Sbjct:    61 KPTILVAEKLGDAGIKLLEDVANVDCSYNMTPEELNIKISLCDALIVRSGTKVGREVFES 120

Query:   150 ANGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPIANTVAAAEHGIALLASMARNVSQAD 209
             ++G+LKVVGRAGVGIDNVDL AATEFGCLVVNAP ANT+AAAEHGIAL+A+MARNV+QAD
Sbjct:   121 SHGRLKVVGRAGVGIDNVDLSAATEFGCLVVNAPTANTIAAAEHGIALMAAMARNVAQAD 180

Query:   210 ASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGMNVIAHDPYAPADKARA 269
             AS+KAG+W R+KYVGVSLVGKTLAV+GFGKVG+EVARRAKGLGM VIAHDPYAPAD+A A
Sbjct:   181 ASVKAGEWKRNKYVGVSLVGKTLAVLGFGKVGTEVARRAKGLGMRVIAHDPYAPADRAHA 240

Query:   270 VGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEAL 329
             +GV+LVSFD+ALATADFISLHMPL PTTSKI NDETFAKMKKGVRIVNVARGGVIDE+AL
Sbjct:   241 IGVDLVSFDEALATADFISLHMPLTPTTSKILNDETFAKMKKGVRIVNVARGGVIDEDAL 300

Query:   330 VRALDSGVVAQAALDVFTEEPPAKDSKLVQHENVTVTPHLGASTKXXXXXXXXXXXXXXX 389
             VRALD+G+VAQAALDVFT+EPPAKDSKLVQHE VTVTPHLGAST                
Sbjct:   301 VRALDAGIVAQAALDVFTKEPPAKDSKLVQHERVTVTPHLGASTMEAQEGVAIEIAEAVV 360

Query:   390 XXLRGELSATAINAPMVPSEVLSELAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSAR 449
               L GEL+ATA+NAPMV +EVL+EL PYVVLA+KLGRLAVQLV+GGSG+K+ K+ Y SAR
Sbjct:   361 GALNGELAATAVNAPMVSAEVLTELKPYVVLAEKLGRLAVQLVAGGSGVKNAKITYASAR 420

Query:   450 DPDDLDTRILRAMITKGIIEPISASFINLVNADFTAKQKGLRISEERVVADSSPEFPIDS 509
               DDLDTR+LRAMITKGIIEPIS  ++NLVNADFTAKQ+GLR+SEERV+ D SPE P+++
Sbjct:   421 ATDDLDTRLLRAMITKGIIEPISDVYVNLVNADFTAKQRGLRLSEERVLLDGSPESPLET 480

Query:   510 IQVQLSNVDSKFAAAVSENGEISIEGKVKFGIPHLTRVGSFGVDASLEGNLILCRQVDQP 569
             I VQLSNV+SKFA+++SE+GE+ +EGKVK G+PHLT+VGSF VD +LEG++ILCRQVDQP
Sbjct:   481 ITVQLSNVESKFASSLSESGEVKVEGKVKDGVPHLTKVGSFEVDVTLEGSIILCRQVDQP 540

Query:   570 GMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAIGVDEEPNQDSLKEIGKV 621
             GMIG VG+ILGE NVNVNFMSVGR   R   IMAIGVD+ P++++LK+IG++
Sbjct:   541 GMIGTVGSILGESNVNVNFMSVGRIAPRKQAIMAIGVDDIPSKETLKKIGEI 592




GO:0000166 "nucleotide binding" evidence=IEA
GO:0004617 "phosphoglycerate dehydrogenase activity" evidence=IEA
GO:0006564 "L-serine biosynthetic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016597 "amino acid binding" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0048037 "cofactor binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009561 "megagametogenesis" evidence=IMP
GO:0005524 "ATP binding" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0009536 "plastid" evidence=IDA
TAIR|locus:2090649 AT3G19480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0599 DET_0599 "D-3-phosphoglycerate dehydrogenase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2698 CHY_2698 "D-3-phosphoglycerate dehydrogenase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1198 GSU_1198 "D-3-phosphoglycerate dehydrogenase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3355 SPO_3355 "D-3-phosphoglycerate dehydrogenase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7Y3 PHGDH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|61987 Phgdh "phosphoglycerate dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1355330 Phgdh "3-phosphoglycerate dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O43175 PHGDH "D-3-phosphoglycerate dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O29445SERA_ARCFU1, ., 1, ., 1, ., 9, 50.39660.80570.9601yesno
O04130SERA_ARATH1, ., 1, ., 1, ., 9, 50.73360.96170.9679yesno
P35136SERA_BACSU1, ., 1, ., 1, ., 9, 50.38080.80570.9638yesno
O27051SERA_METTH1, ., 1, ., 1, ., 9, 50.37210.81520.9752yesno
Q58424SERA_METJA1, ., 1, ., 1, ., 9, 50.42880.81680.9790yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.983
4th Layer1.1.1.950.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.VIII.1454.1
hypothetical protein (544 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.V.3607.1
phosphoserine transaminase (EC-2.6.1.52) (378 aa)
    0.966
fgenesh4_pg.C_scaffold_1557000001
Predicted protein (206 aa)
      0.448
gw1.1441.1.1
annotation not avaliable (142 aa)
       0.427

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query628
PRK13581526 PRK13581, PRK13581, D-3-phosphoglycerate dehydroge 0.0
TIGR01327525 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenas 1e-179
cd12173304 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, 1e-165
COG0111324 COG0111, SerA, Phosphoglycerate dehydrogenase and 1e-116
cd05303301 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P 1e-115
cd12172306 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerat 1e-112
cd05198302 cd05198, formate_dh_like, Formate/glycerate and re 3e-98
pfam00389312 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxy 5e-98
cd05301309 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyr 1e-96
cd05299312 cd05299, CtBP_dh, C-terminal binding protein (CtBP 5e-95
COG1052324 COG1052, LdhA, Lactate dehydrogenase and related d 7e-92
cd12175311 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 1e-91
cd12171310 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 9e-87
cd12177321 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 3e-84
cd12178317 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 1e-82
cd12174305 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerat 7e-81
pfam02826175 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro 3e-79
cd12162307 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2e-78
cd12176304 cd12176, PGDH_3, Phosphoglycerate dehydrogenases, 9e-75
PRK13243333 PRK13243, PRK13243, glyoxylate reductase; Reviewed 3e-73
cd12169308 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerat 2e-72
cd12168321 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-l 1e-71
cd01619323 cd01619, LDH_like, D-Lactate and related Dehydroge 4e-70
cd12167330 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 3e-65
PRK11790409 PRK11790, PRK11790, D-3-phosphoglycerate dehydroge 4e-65
cd12187329 cd12187, LDH_like_1, D-Lactate and related Dehydro 3e-62
cd12179306 cd12179, 2-Hacid_dh_14, Putative D-isomer specific 2e-61
cd12157318 cd12157, PTDH, Thermostable Phosphite Dehydrogenas 9e-61
cd12183328 cd12183, LDH_like_2, D-Lactate and related Dehydro 1e-58
cd12161315 cd12161, GDH_like_1, Putative glycerate dehydrogen 2e-58
cd05300313 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 3e-58
cd12186329 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydr 4e-58
cd12165314 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 6e-50
cd12156301 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, 8e-50
PRK06487317 PRK06487, PRK06487, glycerate dehydrogenase; Provi 5e-49
PRK15409323 PRK15409, PRK15409, bifunctional glyoxylate/hydrox 1e-47
PRK06932314 PRK06932, PRK06932, glycerate dehydrogenase; Provi 3e-47
PRK08410311 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; P 5e-47
cd12158343 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Deh 2e-46
cd12185322 cd12185, HGDH_LDH_like, Putative Lactate dehydroge 6e-45
cd12155314 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2 2e-44
cd05302348 cd05302, FDH, NAD-dependent Formate Dehydrogenase 2e-44
PLN02928347 PLN02928, PLN02928, oxidoreductase family protein 2e-42
PRK07574385 PRK07574, PRK07574, formate dehydrogenase; Provisi 2e-41
PLN02306386 PLN02306, PLN02306, hydroxypyruvate reductase 2e-39
cd12184330 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydro 5e-39
cd12164306 cd12164, GDH_like_2, Putative glycerate dehydrogen 2e-37
cd12180308 cd12180, 2-Hacid_dh_15, Putative D-isomer specific 9e-37
PRK00257381 PRK00257, PRK00257, erythronate-4-phosphate dehydr 2e-34
PLN03139386 PLN03139, PLN03139, formate dehydrogenase; Provisi 4e-32
PRK08605332 PRK08605, PRK08605, D-lactate dehydrogenase; Valid 4e-31
cd12159303 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 2e-30
cd12166300 cd12166, 2-Hacid_dh_7, Putative D-isomer specific 5e-30
PRK06436303 PRK06436, PRK06436, glycerate dehydrogenase; Provi 9e-28
PRK12480330 PRK12480, PRK12480, D-lactate dehydrogenase; Provi 1e-27
cd12163334 cd12163, 2-Hacid_dh_5, Putative D-isomer specific 8e-26
cd12160310 cd12160, 2-Hacid_dh_3, Putative D-isomer specific 1e-24
cd12154310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 7e-21
PRK15438378 PRK15438, PRK15438, erythronate-4-phosphate dehydr 3e-19
cd0490273 cd04902, ACT_3PGDH-xct, C-terminal ACT (regulatory 6e-19
cd0487971 cd04879, ACT_3PGDH-like, ACT_3PGDH-like CD include 8e-17
PRK15469312 PRK15469, ghrA, bifunctional glyoxylate/hydroxypyr 2e-16
cd0490371 cd04903, ACT_LSD, C-terminal ACT domain of the L-s 2e-11
smart00997162 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocystei 5e-09
cd12170294 cd12170, 2-Hacid_dh_9, Putative D-isomer specific 6e-08
PRK05476425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 1e-06
COG0499420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 2e-06
cd0211660 cd02116, ACT, ACT domains are commonly involved in 1e-05
cd00401402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 1e-05
TIGR00936407 TIGR00936, ahcY, adenosylhomocysteinase 2e-05
pfam0184266 pfam01842, ACT, ACT domain 2e-04
cd05211217 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding 0.002
cd01076227 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain 0.002
>gnl|CDD|237436 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
 Score =  635 bits (1642), Expect = 0.0
 Identities = 257/535 (48%), Positives = 342/535 (63%), Gaps = 24/535 (4%)

Query: 91  PTILVSEKLGEAGLAILRSFGNVECLY--DLSPEALCEKISQCDALIVRSGTKVTRSVFE 148
             +LVS+ +  AGL IL+    VE      L  E L E I   DALIVRS TKVT  V E
Sbjct: 1   MKVLVSDPISPAGLEILKDAPGVEVDVKTGLDKEELLEIIGDYDALIVRSATKVTAEVLE 60

Query: 149 AANGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPIANTVAAAEHGIALLASMARNVSQA 208
           AA   LKV+GRAGVG+DNVD+ AAT  G +VVNAP  NT++AAEH IAL+ ++ARN+ QA
Sbjct: 61  AA-KNLKVIGRAGVGVDNVDVPAATRRGIIVVNAPTGNTISAAEHTIALMLALARNIPQA 119

Query: 209 DASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGMNVIAHDPYAPADKAR 268
            AS+KAGKW R K++GV L GKTL ++G G++GSEVA+RAK  GM VIA+DPY   ++A 
Sbjct: 120 HASLKAGKWERKKFMGVELYGKTLGIIGLGRIGSEVAKRAKAFGMKVIAYDPYISPERAA 179

Query: 269 AVGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEA 328
            +GVELVS D+ LA ADFI+LH PL P T  +   E  AKMK GVRI+N ARGG+IDE A
Sbjct: 180 QLGVELVSLDELLARADFITLHTPLTPETRGLIGAEELAKMKPGVRIINCARGGIIDEAA 239

Query: 329 LVRALDSGVVAQAALDVFTEEPPAKDSKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAV 388
           L  AL SG VA AALDVF +EPP  DS L +  NV VTPHLGAST EAQE VAI++AE V
Sbjct: 240 LAEALKSGKVAGAALDVFEKEPP-TDSPLFELPNVVVTPHLGASTAEAQENVAIQVAEQV 298

Query: 389 VGALRGELSATAINAPMVPSEVLSELAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSA 448
           + ALRG     A+N P + +E   +L PY+ LA+KLG LA QL      IKSV++ YR  
Sbjct: 299 IDALRGGPVPNAVNLPSITAEEAEKLKPYLDLAEKLGSLAAQLA--DGPIKSVEITYRG- 355

Query: 449 RDPDDLDTRILRAMITKGIIEPISASFINLVNADFTAKQKGLRISEERVVADSSPEFPID 508
            +  + DT  L A   KG++ P+    +N VNA   AK++G+ + E +  ++ SP++  +
Sbjct: 356 -ELAEEDTEPLTAAALKGLLSPVLGERVNYVNAPLLAKERGIEVEESK--SEESPDYS-N 411

Query: 509 SIQVQLSNVDSKFAAAVSENGEISIEGKVKFG--IPHLTRVGSFGVDASLEGNLILCRQV 566
            I V             +++GE S+ G V FG   P +  +  + VDA  EG++++ R  
Sbjct: 412 LITVT----------VTTDDGERSVAGTV-FGDGEPRIVEIDGYRVDAKPEGHMLIIRNR 460

Query: 567 DQPGMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAIGVDEEPNQDSLKEIGKV 621
           D+PG+IGKVG +LGE  +N+  M +GR       +M + VD+   ++ L+E+  +
Sbjct: 461 DRPGVIGKVGTLLGEAGINIAGMQLGRREAGGEALMVLSVDDPVPEEVLEELRAL 515


Length = 526

>gnl|CDD|233358 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>gnl|CDD|240650 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240649 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family Back     alignment and domain information
>gnl|CDD|215893 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain Back     alignment and domain information
>gnl|CDD|240626 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH) Back     alignment and domain information
>gnl|CDD|240624 cd05299, CtBP_dh, C-terminal binding protein (CtBP), D-isomer-specific 2-hydroxyacid dehydrogenases related repressor Back     alignment and domain information
>gnl|CDD|223980 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|240652 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240654 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240655 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240651 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240639 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240653 cd12176, PGDH_3, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|183914 PRK13243, PRK13243, glyoxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|240646 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases Back     alignment and domain information
>gnl|CDD|240645 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-like dehydrogenases Back     alignment and domain information
>gnl|CDD|240620 cd01619, LDH_like, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240644 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|236985 PRK11790, PRK11790, D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240663 cd12187, LDH_like_1, D-Lactate and related Dehydrogenase like proteins, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240656 cd12179, 2-Hacid_dh_14, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240634 cd12157, PTDH, Thermostable Phosphite Dehydrogenase Back     alignment and domain information
>gnl|CDD|240659 cd12183, LDH_like_2, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240638 cd12161, GDH_like_1, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family Back     alignment and domain information
>gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase Back     alignment and domain information
>gnl|CDD|240662 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydroxyisocaproic acid dehydrogenase (D-HicDH), NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240633 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, D-isomer-specific 2-hydroxyacid-related dehydrogenase Back     alignment and domain information
>gnl|CDD|180588 PRK06487, PRK06487, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185307 PRK15409, PRK15409, bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|235890 PRK06932, PRK06932, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181414 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240635 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Dehydrogenase NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240661 cd12185, HGDH_LDH_like, Putative Lactate dehydrogenase and (R)-2-Hydroxyglutarate Dehydrogenase-like proteins, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240632 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2-hydroxyacid dehydrogenase family Back     alignment and domain information
>gnl|CDD|240627 cd05302, FDH, NAD-dependent Formate Dehydrogenase (FDH) Back     alignment and domain information
>gnl|CDD|215501 PLN02928, PLN02928, oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|181041 PRK07574, PRK07574, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177941 PLN02306, PLN02306, hydroxypyruvate reductase Back     alignment and domain information
>gnl|CDD|240660 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydrogenase and related dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240641 cd12164, GDH_like_2, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family Back     alignment and domain information
>gnl|CDD|240657 cd12180, 2-Hacid_dh_15, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|166874 PRK00257, PRK00257, erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|178684 PLN03139, PLN03139, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181499 PRK08605, PRK08605, D-lactate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|240636 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240643 cd12166, 2-Hacid_dh_7, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|235800 PRK06436, PRK06436, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183550 PRK12480, PRK12480, D-lactate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240640 cd12163, 2-Hacid_dh_5, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240637 cd12160, 2-Hacid_dh_3, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|185335 PRK15438, PRK15438, erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>gnl|CDD|153174 cd04902, ACT_3PGDH-xct, C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>gnl|CDD|153151 cd04879, ACT_3PGDH-like, ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>gnl|CDD|185366 PRK15469, ghrA, bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|153175 cd04903, ACT_LSD, C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>gnl|CDD|198065 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240647 cd12170, 2-Hacid_dh_9, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|190133 pfam01842, ACT, ACT domain Back     alignment and domain information
>gnl|CDD|133450 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>gnl|CDD|133445 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 628
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 100.0
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 100.0
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 100.0
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 100.0
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 100.0
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 100.0
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 100.0
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 100.0
PRK13243333 glyoxylate reductase; Reviewed 100.0
PRK06487317 glycerate dehydrogenase; Provisional 100.0
PLN02306386 hydroxypyruvate reductase 100.0
PRK06932314 glycerate dehydrogenase; Provisional 100.0
PLN02928347 oxidoreductase family protein 100.0
PLN03139386 formate dehydrogenase; Provisional 100.0
PRK07574385 formate dehydrogenase; Provisional 100.0
PRK08605332 D-lactate dehydrogenase; Validated 100.0
PRK12480330 D-lactate dehydrogenase; Provisional 100.0
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 100.0
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 100.0
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 100.0
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 100.0
PRK06436303 glycerate dehydrogenase; Provisional 100.0
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 100.0
TIGR00719208 sda_beta L-serine dehydratase, iron-sulfur-depende 100.0
KOG0067435 consensus Transcription factor CtBP [Transcription 99.97
PF00389133 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydr 99.88
PTZ00075476 Adenosylhomocysteinase; Provisional 99.86
PRK06545359 prephenate dehydrogenase; Validated 99.83
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 99.79
PRK08818370 prephenate dehydrogenase; Provisional 99.75
PRK08306296 dipicolinate synthase subunit A; Reviewed 99.61
PLN02494477 adenosylhomocysteinase 99.58
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 99.49
PRK13403335 ketol-acid reductoisomerase; Provisional 99.47
COG1760262 SdaA L-serine deaminase [Amino acid transport and 99.44
PRK07417279 arogenate dehydrogenase; Reviewed 99.4
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 99.38
PLN02256304 arogenate dehydrogenase 99.37
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.33
PLN02712667 arogenate dehydrogenase 99.27
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.26
PRK08655437 prephenate dehydrogenase; Provisional 99.24
PRK08507275 prephenate dehydrogenase; Validated 99.2
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 99.2
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.19
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.17
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 99.15
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.13
PRK05479330 ketol-acid reductoisomerase; Provisional 99.06
PLN02712 667 arogenate dehydrogenase 99.04
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 99.04
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 99.03
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 99.02
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 99.01
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 98.99
PF03315157 SDH_beta: Serine dehydratase beta chain; InterPro: 98.97
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 98.93
PRK15059292 tartronate semialdehyde reductase; Provisional 98.89
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 98.83
PRK15040 454 L-serine dehydratase TdcG; Provisional 98.82
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 98.79
PRK05225487 ketol-acid reductoisomerase; Validated 98.74
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 98.74
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 98.71
PLN02858 1378 fructose-bisphosphate aldolase 98.7
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 98.68
PLN02858 1378 fructose-bisphosphate aldolase 98.68
PRK15023 454 L-serine deaminase; Provisional 98.68
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 98.67
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.66
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 98.65
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.64
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 98.63
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 98.63
KOG0409327 consensus Predicted dehydrogenase [General functio 98.61
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.6
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.59
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 98.55
PLN02688266 pyrroline-5-carboxylate reductase 98.53
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 98.53
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.53
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.52
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 98.51
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 98.49
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 98.45
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.45
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.44
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 98.43
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.42
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.4
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.37
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.35
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 98.35
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 98.31
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.31
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 98.3
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.28
PRK13302271 putative L-aspartate dehydrogenase; Provisional 98.28
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 98.27
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 98.26
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 98.26
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 98.25
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 98.24
TIGR00720 455 sda_mono L-serine dehydratase, iron-sulfur-depende 98.24
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 98.23
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 98.21
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 98.21
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.21
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.18
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.17
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 98.13
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.12
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 98.09
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 98.08
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 98.02
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 98.02
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 98.0
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.99
PRK07680273 late competence protein ComER; Validated 97.97
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.97
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 97.96
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 97.96
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 97.96
PRK08229341 2-dehydropantoate 2-reductase; Provisional 97.94
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.93
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 97.93
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 97.92
KOG2380480 consensus Prephenate dehydrogenase (NADP+) [Amino 97.9
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.89
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.89
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.85
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 97.78
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 97.77
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.76
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 97.76
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 97.74
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.74
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.72
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.71
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.71
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 97.71
PRK09287459 6-phosphogluconate dehydrogenase; Validated 97.7
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 97.69
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 97.67
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 97.66
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 97.65
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.65
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.64
PRK06349426 homoserine dehydrogenase; Provisional 97.63
PRK12921305 2-dehydropantoate 2-reductase; Provisional 97.62
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.62
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 97.6
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.59
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.59
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.58
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 97.55
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.54
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 97.53
PLN00203519 glutamyl-tRNA reductase 97.52
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 97.49
PTZ00431260 pyrroline carboxylate reductase; Provisional 97.46
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.46
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 97.45
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.45
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 97.44
PRK14982340 acyl-ACP reductase; Provisional 97.43
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.43
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 97.42
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 97.41
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.37
PRK06249313 2-dehydropantoate 2-reductase; Provisional 97.36
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.36
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.36
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.35
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 97.34
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 97.33
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 97.31
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 97.3
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 97.3
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.3
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 97.29
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 97.29
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 97.28
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.24
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 97.24
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 97.23
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.22
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 97.22
PRK06444197 prephenate dehydrogenase; Provisional 97.22
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 97.22
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.21
PRK08577136 hypothetical protein; Provisional 97.21
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 97.21
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 97.21
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.2
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.19
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.18
PRK06141314 ornithine cyclodeaminase; Validated 97.17
PLN02353473 probable UDP-glucose 6-dehydrogenase 97.17
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.16
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.14
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 97.12
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.1
PRK14031444 glutamate dehydrogenase; Provisional 97.08
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.04
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.03
PRK09414445 glutamate dehydrogenase; Provisional 97.0
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 96.99
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.99
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.98
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 96.98
PRK0019490 hypothetical protein; Validated 96.98
PRK14030445 glutamate dehydrogenase; Provisional 96.97
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 96.96
PRK07340304 ornithine cyclodeaminase; Validated 96.95
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 96.94
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.94
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 96.93
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 96.91
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.91
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.9
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 96.88
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.84
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.8
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.8
PRK13940414 glutamyl-tRNA reductase; Provisional 96.79
PLN02477410 glutamate dehydrogenase 96.79
PTZ00117319 malate dehydrogenase; Provisional 96.78
PRK11730715 fadB multifunctional fatty acid oxidation complex 96.78
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.76
COG0362473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 96.75
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 96.71
CHL00100174 ilvH acetohydroxyacid synthase small subunit 96.7
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.63
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 96.63
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 96.63
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 96.6
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 96.6
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 96.6
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.58
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 96.58
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.57
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 96.57
PRK08618325 ornithine cyclodeaminase; Validated 96.56
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.54
PRK11154708 fadJ multifunctional fatty acid oxidation complex 96.53
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 96.52
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 96.52
PRK13301267 putative L-aspartate dehydrogenase; Provisional 96.52
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.51
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 96.49
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 96.44
PRK06046326 alanine dehydrogenase; Validated 96.41
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.41
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 96.39
COG2150167 Predicted regulator of amino acid metabolism, cont 96.39
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.38
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 96.37
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 96.37
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 96.36
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 96.36
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 96.35
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 96.34
PRK01713334 ornithine carbamoyltransferase; Provisional 96.33
COG4747142 ACT domain-containing protein [General function pr 96.31
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.29
PRK00676338 hemA glutamyl-tRNA reductase; Validated 96.28
PRK00779304 ornithine carbamoyltransferase; Provisional 96.28
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 96.27
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 96.26
PRK08291330 ectoine utilization protein EutC; Validated 96.23
PRK06719157 precorrin-2 dehydrogenase; Validated 96.22
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 96.22
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 96.21
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 96.21
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 96.15
PRK13303265 L-aspartate dehydrogenase; Provisional 96.14
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 96.13
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 96.13
PRK06823315 ornithine cyclodeaminase; Validated 96.12
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subu 96.11
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 96.11
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 96.1
PRK06199379 ornithine cyclodeaminase; Validated 96.09
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 96.09
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 96.07
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 96.06
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 96.06
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 96.03
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.97
PRK06223307 malate dehydrogenase; Reviewed 95.96
PRK02255338 putrescine carbamoyltransferase; Provisional 95.95
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 95.94
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 95.93
PLN02353473 probable UDP-glucose 6-dehydrogenase 95.93
PLN02527306 aspartate carbamoyltransferase 95.93
PRK03515336 ornithine carbamoyltransferase subunit I; Provisio 95.79
PRK04284332 ornithine carbamoyltransferase; Provisional 95.78
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.77
PRK04435147 hypothetical protein; Provisional 95.75
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 95.69
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 95.68
PTZ00082321 L-lactate dehydrogenase; Provisional 95.68
PRK06407301 ornithine cyclodeaminase; Provisional 95.68
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.65
PRK07589346 ornithine cyclodeaminase; Validated 95.63
PRK11891429 aspartate carbamoyltransferase; Provisional 95.62
PRK02102331 ornithine carbamoyltransferase; Validated 95.62
TIGR03316357 ygeW probable carbamoyltransferase YgeW. Members o 95.6
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 95.55
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 95.55
PRK00048257 dihydrodipicolinate reductase; Provisional 95.51
PLN02342348 ornithine carbamoyltransferase 95.44
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 95.43
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 95.4
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.38
COG5322351 Predicted dehydrogenase [General function predicti 95.35
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 95.34
PRK14804311 ornithine carbamoyltransferase; Provisional 95.34
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.34
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.32
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 95.32
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 95.31
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 95.29
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 95.27
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.26
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.26
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 95.26
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 95.25
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.21
PRK01390460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.2
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 95.19
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.18
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 95.16
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.14
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 95.12
PRK12562334 ornithine carbamoyltransferase subunit F; Provisio 95.1
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 95.1
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.09
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 95.06
PRK09496453 trkA potassium transporter peripheral membrane com 95.05
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 95.04
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 95.04
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 95.02
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.01
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 95.0
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 94.99
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.94
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 94.87
PRK13376525 pyrB bifunctional aspartate carbamoyltransferase c 94.86
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 94.84
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 94.84
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 94.79
cd0211660 ACT ACT domains are commonly involved in specifica 94.79
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.77
PRK08300302 acetaldehyde dehydrogenase; Validated 94.77
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 94.75
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 94.75
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 94.64
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 94.63
PRK06270341 homoserine dehydrogenase; Provisional 94.58
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 94.57
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.55
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 94.55
COG0281432 SfcA Malic enzyme [Energy production and conversio 94.54
PRK11589190 gcvR glycine cleavage system transcriptional repre 94.47
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 94.46
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 94.43
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 94.41
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 94.41
PRK07200395 aspartate/ornithine carbamoyltransferase family pr 94.38
PRK11579346 putative oxidoreductase; Provisional 94.33
PRK09880343 L-idonate 5-dehydrogenase; Provisional 94.31
PRK12862 763 malic enzyme; Reviewed 94.29
PRK05708305 2-dehydropantoate 2-reductase; Provisional 94.26
KOG2653487 consensus 6-phosphogluconate dehydrogenase [Carboh 94.26
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 94.25
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 94.24
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 94.19
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.15
COG1707 218 ACT domain-containing protein [General function pr 94.09
PRK08192338 aspartate carbamoyltransferase; Provisional 94.07
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 94.06
PRK10669558 putative cation:proton antiport protein; Provision 94.02
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 93.96
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 93.96
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.95
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 93.94
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 93.85
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 93.76
PRK05562223 precorrin-2 dehydrogenase; Provisional 93.76
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 93.73
PRK03659601 glutathione-regulated potassium-efflux system prot 93.67
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 93.57
PRK05086312 malate dehydrogenase; Provisional 93.52
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.51
PRK10637457 cysG siroheme synthase; Provisional 93.51
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.5
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 93.49
PLN02948 577 phosphoribosylaminoimidazole carboxylase 93.44
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 93.44
COG0673342 MviM Predicted dehydrogenases and related proteins 93.43
COG0440163 IlvH Acetolactate synthase, small (regulatory) sub 93.43
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 93.39
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 93.33
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.33
PRK14027283 quinate/shikimate dehydrogenase; Provisional 93.31
PRK04148134 hypothetical protein; Provisional 93.09
PRK12861 764 malic enzyme; Reviewed 93.06
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 92.95
TIGR00036266 dapB dihydrodipicolinate reductase. 92.89
TIGR01087433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 92.84
COG2716176 GcvR Glycine cleavage system regulatory protein [A 92.82
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 92.81
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 92.77
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 92.75
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 92.72
TIGR01161352 purK phosphoribosylaminoimidazole carboxylase, Pur 92.71
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 92.69
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 92.68
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 92.66
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.63
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 92.58
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 92.57
cd01483143 E1_enzyme_family Superfamily of activating enzymes 92.55
PRK03562621 glutathione-regulated potassium-efflux system prot 92.53
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 92.48
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 92.4
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 92.31
PTZ00325321 malate dehydrogenase; Provisional 92.29
COG383090 ACT domain-containing protein [Signal transduction 92.25
PLN02272421 glyceraldehyde-3-phosphate dehydrogenase 92.22
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.21
PLN02602350 lactate dehydrogenase 92.17
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 92.13
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 92.0
PRK09496453 trkA potassium transporter peripheral membrane com 91.9
PLN02586360 probable cinnamyl alcohol dehydrogenase 91.85
PF04016147 DUF364: Domain of unknown function (DUF364); Inter 91.81
PRK07877 722 hypothetical protein; Provisional 91.79
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 91.76
KOG2663 309 consensus Acetolactate synthase, small subunit [Am 91.74
PRK14805302 ornithine carbamoyltransferase; Provisional 91.74
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Ener 91.72
cd0490685 ACT_ThrD-I_1 First of two tandem C-terminal ACT do 91.6
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 91.59
PRK08223287 hypothetical protein; Validated 91.48
PRK10206344 putative oxidoreductase; Provisional 91.39
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 91.36
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 91.23
CHL00194317 ycf39 Ycf39; Provisional 91.23
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid tr 91.22
PRK11589 190 gcvR glycine cleavage system transcriptional repre 91.08
PLN02178375 cinnamyl-alcohol dehydrogenase 91.05
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 90.93
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 90.93
PRK15076431 alpha-galactosidase; Provisional 90.87
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 90.87
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 90.81
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 90.8
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 90.79
PRK12550272 shikimate 5-dehydrogenase; Reviewed 90.78
PLN00106323 malate dehydrogenase 90.45
PRK13529563 malate dehydrogenase; Provisional 90.42
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.38
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.36
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 90.36
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 90.33
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 90.32
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 90.32
PRK05600370 thiamine biosynthesis protein ThiF; Validated 90.21
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 90.2
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 90.19
PRK06382406 threonine dehydratase; Provisional 90.05
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 89.96
PF05222136 AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal 89.93
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 89.92
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 89.92
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 89.8
PRK06182273 short chain dehydrogenase; Validated 89.76
TIGR01082448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 89.72
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 89.71
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 89.7
PRK07411390 hypothetical protein; Validated 89.69
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 89.37
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 89.18
PRK12814652 putative NADPH-dependent glutamate synthase small 89.05
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 89.03
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 88.85
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 88.82
PRK06392326 homoserine dehydrogenase; Provisional 88.79
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 88.78
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 88.71
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 88.63
PLN02740381 Alcohol dehydrogenase-like 88.52
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 88.51
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.37
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 88.29
PRK06128300 oxidoreductase; Provisional 88.25
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 88.19
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
Probab=100.00  E-value=8.2e-113  Score=956.43  Aligned_cols=517  Identities=44%  Similarity=0.712  Sum_probs=487.9

Q ss_pred             eEEEeCCCCHhHHHHhhcC-CcEEEecCCCHhHHHhhcCCCeEEEEcCCCCCCHHHHHhcCCcceeEEecccccCcccHh
Q 006864           92 TILVSEKLGEAGLAILRSF-GNVECLYDLSPEALCEKISQCDALIVRSGTKVTRSVFEAANGKLKVVGRAGVGIDNVDLQ  170 (628)
Q Consensus        92 ~vlv~~~l~~~~~~~l~~~-~~v~~~~~~~~~el~~~~~~~d~liv~~~~~v~~~~l~~~~~~Lk~I~~~g~G~D~iDl~  170 (628)
                      |||+++++.++.++.|++. .++......+++++.+.++++|++++++.+++++++++++ |+||||+++|+||||||++
T Consensus         1 ~vli~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~d~li~~~~~~~~~~~l~~~-~~Lk~I~~~~~G~d~id~~   79 (525)
T TIGR01327         1 KVLIADPISPDGIDILEDVGVEVDVQTGLSREELLEIIPDYDALIVRSATKVTEEVIAAA-PKLKVIGRAGVGVDNIDIE   79 (525)
T ss_pred             CEEEeCCCCHHHHHHHHhcCcEEEeCCCCCHHHHHHHhcCCCEEEEcCCCCcCHHHHhhC-CCceEEEECCcccchhcHH
Confidence            4889999999999888765 3666544567889999999999999998889999999988 5999999999999999999


Q ss_pred             HHHhcCceEEcCCCCChhhHHHHHHHHHHHHHHchhHHHHHHHcCcccccccceeeecCCeEEEEecChhHHHHHHHHHc
Q 006864          171 AATEFGCLVVNAPIANTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKG  250 (628)
Q Consensus       171 aa~~~GI~V~n~p~~~~~avAE~~l~l~L~~~R~i~~~~~~~~~g~W~~~~~~g~~l~GktiGIIGlG~IG~~vA~~l~~  250 (628)
                      +|+++||.|+|+|++|+.+||||+++|||+++|+++++++.+++|+|.+..+.|.+|+|||+||||+|+||+.+|++|++
T Consensus        80 ~~~~~gI~V~n~pg~~~~~vAE~~~~l~L~~~R~~~~~~~~~~~g~W~~~~~~g~~l~gktvgIiG~G~IG~~vA~~l~~  159 (525)
T TIGR01327        80 AATARGILVVNAPTGNTISAAEHALAMLLAAARNIPQADASLKEGEWDRKAFMGTELYGKTLGVIGLGRIGSIVAKRAKA  159 (525)
T ss_pred             HHHHCCCEEEeCCCcChHHHHHHHHHHHHHHhcCHHHHHHHHHcCCccccccCccccCCCEEEEECCCHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999986677899999999999999999999999999


Q ss_pred             CCCEEEEECCCCChhHHHHcCCccc-CHHHHhccCCEEEEcCCCCccccccccHHHHhcCCCCcEEEEcCCCchhcHHHH
Q 006864          251 LGMNVIAHDPYAPADKARAVGVELV-SFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEAL  329 (628)
Q Consensus       251 ~G~~V~~~d~~~~~~~a~~~g~~~~-sl~ell~~aDvV~l~~Plt~~t~~li~~~~l~~mk~gailIN~aRg~~vde~aL  329 (628)
                      |||+|++|||+.+.+.+...++..+ ++++++++||+|++|+|++++|+++||++.|++||+|++|||||||++||++||
T Consensus       160 fG~~V~~~d~~~~~~~~~~~g~~~~~~l~ell~~aDvV~l~lPlt~~T~~li~~~~l~~mk~ga~lIN~aRG~~vde~aL  239 (525)
T TIGR01327       160 FGMKVLAYDPYISPERAEQLGVELVDDLDELLARADFITVHTPLTPETRGLIGAEELAKMKKGVIIVNCARGGIIDEAAL  239 (525)
T ss_pred             CCCEEEEECCCCChhHHHhcCCEEcCCHHHHHhhCCEEEEccCCChhhccCcCHHHHhcCCCCeEEEEcCCCceeCHHHH
Confidence            9999999999866666667787766 899999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhCCCeeEEEeeccCCCCCCCCCccccCCcEEEcCCCCCCcHHHHHHHHHHHHHHHHHHHcCCCCCCcccCCCCCcc
Q 006864          330 VRALDSGVVAQAALDVFTEEPPAKDSKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAVVGALRGELSATAINAPMVPSE  409 (628)
Q Consensus       330 ~~aL~~g~i~ga~lDV~~~EP~~~~~~L~~~~nvilTPHig~~T~ea~~~~~~~~~~~i~~~l~g~~~~~~vn~p~~~~~  409 (628)
                      ++||++|+|+||+||||+.||+ .++|||++|||++|||+|++|.|++++++..+++|+.+|++|+++.+.||.|.++++
T Consensus       240 ~~aL~~g~i~gAaLDVf~~EP~-~~~pL~~~~nvi~TPHia~~t~e~~~~~~~~~~~ni~~~~~g~~~~~~vn~~~~~~~  318 (525)
T TIGR01327       240 YEALEEGHVRAAALDVFEKEPP-TDNPLFDLDNVIATPHLGASTREAQENVATQVAEQVLDALKGLPVPNAVNAPGIDAD  318 (525)
T ss_pred             HHHHHcCCeeEEEEecCCCCCC-CCChhhcCCCeEECCCccccHHHHHHHHHHHHHHHHHHHHcCCCCCceeeCCCCCch
Confidence            9999999999999999999996 589999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccHHHHHHHHhHHHHHHhcCCCCceEEEEEEeecCCCCCCCcccchHHHHHhhccccccCcccccchHhHHhhcC
Q 006864          410 VLSELAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSARDPDDLDTRILRAMITKGIIEPISASFINLVNADFTAKQKG  489 (628)
Q Consensus       410 ~~~~~~p~~~lAerlG~la~qL~~g~~~~~~v~i~~~Gs~a~~~~~~~~~~~a~l~GlL~~~~~~~vnlvNA~~iAke~G  489 (628)
                      .+++++||++||+|||++++||+++  .+++++|+|+|||+ . +++|++++|+++|+|+...++++|++||+.+|||+|
T Consensus       319 ~~~~~~~~~~la~riG~~a~ql~~~--~~~~v~i~~~GsfA-~-~~~~~~~~a~l~GlL~~~~~~d~~~~nA~~iA~e~G  394 (525)
T TIGR01327       319 VMEKLKPYLDLAEKLGKLAGQLLDG--AVQSVEVTYRGELA-T-ENSEPLTRAALKGLLSPVLDDEVNMVNAPAVAKERG  394 (525)
T ss_pred             hhhhhhhHHHHHHHHHHHHHHHcCC--CceEEEEEEEcchh-c-ccccHHHHHHHHHhCccccCCCccccCHHHHHHHcC
Confidence            9999999999999999999999988  89999999999998 4 599999999999999887776899999999999999


Q ss_pred             ceEEEEEeecCCCCCCCCceEEEEEEecccccceeeCCCcEEEEEEEEEC-CeeEEEEECceeEEeecCCcEEEEeccCC
Q 006864          490 LRISEERVVADSSPEFPIDSIQVQLSNVDSKFAAAVSENGEISIEGKVKF-GIPHLTRVGSFGVDASLEGNLILCRQVDQ  568 (628)
Q Consensus       490 I~i~~~~~~~~~~~~~~~ntv~v~l~~~~~~~~~~~~~~~~~~v~Gt~~g-G~~~I~~Idgf~Vd~~~~~~~Llv~~~D~  568 (628)
                      |+|.|.+.+..   ..|||+++++++          +++++++|.|+|+| |.++|++||||+|++.|++|+|++.|.|+
T Consensus       395 I~v~~~~~~~~---~~hpNtv~i~l~----------~~~~~~~v~G~s~gGg~~~I~~ing~~v~~~~~~~~li~~~~D~  461 (525)
T TIGR01327       395 ITVEESKSESS---PDYKNYLSVTVT----------GDSGTVSVAGTVFGGFSPRIVEIDGFHVDLEPEGIMLIILHLDK  461 (525)
T ss_pred             CEEEEEEccCC---CCCCCEEEEEEE----------eCCcEEEEEEEEecCCcEEEEEECCEEEEEecCccEEEEEecCc
Confidence            99999877643   489999999997          45678999999997 79999999999999999999999999999


Q ss_pred             CCchhhHHhhhhcCCccccceEEeeeecCccEEEEEEeCCCCCHHHHHHHhcccCcccc
Q 006864          569 PGMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAIGVDEEPNQDSLKEIGKVHFVARI  627 (628)
Q Consensus       569 PGvIa~V~~iL~~~~INIa~m~v~R~~~gg~Al~~i~vD~~~~~~~l~~L~~l~~v~~v  627 (628)
                      ||+|++|+++|++++|||++|+++|..+|++|+|+|++|++++++++++|+++++|.++
T Consensus       462 pG~I~~v~~~L~~~~iNIa~m~~~R~~~g~~al~~i~~D~~v~~~~l~~i~~~~~i~~v  520 (525)
T TIGR01327       462 PGVIGKVGTLLGTAGINIASMQLGRKEKGGEALMLLSLDQPVPDEVLEEIKAIPDILSV  520 (525)
T ss_pred             CCcchHHHhHHhhcCCChHHcEeecCCCCCeEEEEEEcCCCCCHHHHHHHhcCCCccEE
Confidence            99999999999999999999999999999999999999999999999999999998875



This model represents a long form of D-3-phosphoglycerate dehydrogenase, the serA gene of one pathway of serine biosynthesis. Shorter forms, scoring between trusted and noise cutoff, include SerA from E. coli.

>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit Back     alignment and domain information
>KOG0067 consensus Transcription factor CtBP [Transcription] Back     alignment and domain information
>PF00389 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain; InterPro: IPR006139 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>COG1760 SdaA L-serine deaminase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PF03315 SDH_beta: Serine dehydratase beta chain; InterPro: IPR005131 L-serine dehydratase is found as a heterodimer of alpha and beta chain or as a fusion of the two chains in a single protein Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK15040 L-serine dehydratase TdcG; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK15023 L-serine deaminase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR00720 sda_mono L-serine dehydratase, iron-sulfur-dependent, single chain form Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1707 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PF04016 DUF364: Domain of unknown function (DUF364); InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14805 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information
>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PF05222 AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal domain; InterPro: IPR007886 Alanine dehydrogenases (1 Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query628
2g76_A335 Crystal Structure Of Human 3-Phosphoglycerate Dehyd 7e-74
3ddn_A528 Crystal Structure Of Hydroxypyruvic Acid Phosphate 7e-68
1ygy_A529 Crystal Structure Of D-3-Phosphoglycerate Dehydroge 7e-68
1wwk_A307 Crystal Structure Of Phosphoglycerate Dehydrogenase 2e-56
2ekl_A313 Structure Of St1218 Protein From Sulfolobus Tokodai 1e-42
2dbr_A334 Crystal Structure Of Glyoxylate Reductase (Ph0597) 3e-39
3k5p_A416 Crystal Structure Of Amino Acid-Binding Act: D-Isom 1e-38
2dbq_A334 Crystal Structure Of Glyoxylate Reductase (Ph0597) 3e-37
2d0i_A333 Crystal Structure Ph0520 Protein From Pyrococcus Ho 5e-33
2p9g_A410 Crystal Structure Of Serine Bound G336v,G337v Doubl 5e-33
2p9c_A410 Crystal Structure Of Serine Bound G336v Mutant Of E 6e-33
1psd_A409 The Allosteric Ligand Site In The Vmax-Type Coopera 1e-32
2ome_A336 Crystal Structure Of Human Ctbp2 Dehydrogenase Comp 6e-32
1mx3_A347 Crystal Structure Of Ctbp Dehydrogenase Core Holo F 9e-32
1hku_A358 CtbpBARS: A DUAL-Function Protein Involved In Trans 1e-31
1gdh_A320 Crystal Structure Of A Nad-Dependent D-Glycerate De 1e-31
1hl3_A358 CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK 1e-31
3ga0_A358 Ctbp1BARS GLY172->glu Mutant Structure: Impairing N 9e-31
1yba_A410 The Active Form Of Phosphoglycerate Dehydrogenase L 2e-30
2gcg_A330 Ternary Crystal Structure Of Human Glyoxylate Reduc 1e-29
1sc6_A404 Crystal Structure Of W139g D-3-Phosphoglycerate Deh 3e-29
4e5k_A329 Thermostable Phosphite Dehydrogenase In Complex Wit 3e-29
4e5n_A330 Thermostable Phosphite Dehydrogenase In Complex Wit 3e-29
3gg9_A352 Crystal Structure Of Putative D-3-Phosphoglycerate 5e-29
2h1s_A328 Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE RE 9e-29
4e5m_A329 Thermostable Phosphite Dehydrogenase E175aA176R IN 3e-28
4e5p_A332 Thermostable Phosphite Dehydrogenase A176r Variant 3e-28
4ebf_A334 Semet Thermostable Phosphite Dehydrogenase Glu175-A 4e-28
4g2n_A345 Crystal Structure Of Putative D-Isomer Specific 2-H 5e-28
1j49_A333 Insights Into Domain Closure, Substrate Specificity 8e-27
2dld_A337 D-Lactate Dehydrogenase Complexed With Nadh And Oxa 1e-26
3n7u_A351 Nad-Dependent Formate Dehydrogenase From Higher-Pla 4e-26
3naq_A357 Apo-Form Of Nad-Dependent Formate Dehydrogenase Fro 4e-26
1j4a_A333 Insights Into Domain Closure, Substrate Specificity 1e-25
3kb6_A334 Crystal Structure Of D-lactate Dehydrogenase From A 2e-25
2cuk_A311 Crystal Structure Of Tt0316 Protein From Thermus Th 3e-25
2w2l_D348 Crystal Structure Of The Holo Forms Of Rhodotorula 5e-24
2w2k_A348 Crystal Structure Of The Apo Forms Of Rhodotorula G 5e-24
1dxy_A333 Structure Of D-2-Hydroxyisocaproate Dehydrogenase L 6e-24
2w2k_B348 Crystal Structure Of The Apo Forms Of Rhodotorula G 7e-24
2nac_A393 High Resolution Structures Of Holo And Apo Formate 1e-22
2go1_A401 Nad-Dependent Formate Dehydrogenase From Pseudomona 2e-22
2gug_A401 Nad-dependent Formate Dehydrogenase From Pseudomona 2e-22
3ba1_A333 Structure Of Hydroxyphenylpyruvate Reductase From C 4e-22
3evt_A324 Crystal Structure Of Phosphoglycerate Dehydrogenase 4e-22
3fn4_A401 Apo-form Of Nad-dependent Formate Dehydrogenase Fro 7e-22
2gsd_A402 Nad-dependent Formate Dehydrogenase From Bacterium 7e-22
2o4c_A380 Crystal Structure Of D-erythronate-4-phosphate Dehy 1e-20
2yq4_A343 Crystal Structure Of D-isomer Specific 2-hydroxyaci 1e-20
4dgs_A340 The Crystals Structure Of Dehydrogenase From Rhizob 6e-20
2fss_A365 Candida Boidinii Formate Dehydrogenase (Fdh) K47e M 1e-18
2j6i_A364 Candida Boidinii Formate Dehydrogenase (Fdh) C-Term 1e-18
3oet_A381 D-Erythronate-4-Phosphate Dehydrogenase Complexed W 1e-17
3hg7_A324 Crystal Structure Of D-Isomer Specific 2-Hydroxyaci 2e-17
1xdw_A331 Nad+-Dependent (R)-2-Hydroxyglutarate Dehydrogenase 6e-16
4hy3_A365 Crystal Structure Of A Phosphoglycerate Oxidoreduct 9e-13
3gvx_A290 Crystal Structure Of Glycerate Dehydrogenase Relate 4e-11
3kbo_A315 2.14 Angstrom Crystal Structure Of Putative Oxidore 6e-11
1qp8_A303 Crystal Structure Of A Putative Formate Dehydrogena 7e-05
>pdb|2G76|A Chain A, Crystal Structure Of Human 3-Phosphoglycerate Dehydrogenase Length = 335 Back     alignment and structure

Iteration: 1

Score = 275 bits (702), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 144/296 (48%), Positives = 194/296 (65%), Gaps = 3/296 (1%) Query: 80 DDLNVQAVTPKPTILVSEKLGEAGLAILRSFG-NVECLYDLSPEALCEKISQCDALIVRS 138 ++L Q++ +L+S+ L IL+ G V +LS E L ++ C+ LIVRS Sbjct: 16 ENLYFQSMANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRS 75 Query: 139 GTKVTRSVFEAANGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPIANTVAAAEHGIALL 198 TKVT V AA KL+VVGRAG G+DNVDL+AAT G LV+N P N+++AAE ++ Sbjct: 76 ATKVTADVINAAE-KLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMI 134 Query: 199 ASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGMNVIAH 258 +AR + QA AS+K GKW R K++G L GKTL ++G G++G EVA R + GM I + Sbjct: 135 MCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGY 194 Query: 259 DPYAPADKARAVGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNV 318 DP + + + GV+ + ++ DFI++H PL P+T+ + ND TFA+ KKGVR+VN Sbjct: 195 DPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNC 254 Query: 319 ARGGVIDEEALVRALDSGVVAQAALDVFTEEPPAKDSKLVQHENVTVTPHLGASTK 374 ARGG++DE AL+RAL SG A AALDVFTEEPP +D LV HENV PHLGASTK Sbjct: 255 ARGGIVDEGALLRALQSGQCAGAALDVFTEEPP-RDRALVDHENVISCPHLGASTK 309
>pdb|3DDN|A Chain A, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound D-3- Phosphoglycerate Dehydrogenase In Mycobacterium Tuberculosis Length = 528 Back     alignment and structure
>pdb|1YGY|A Chain A, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase From Mycobacterium Tuberculosis Length = 529 Back     alignment and structure
>pdb|1WWK|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 307 Back     alignment and structure
>pdb|2EKL|A Chain A, Structure Of St1218 Protein From Sulfolobus Tokodaii Length = 313 Back     alignment and structure
>pdb|2DBR|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (P1) Length = 334 Back     alignment and structure
>pdb|3K5P|A Chain A, Crystal Structure Of Amino Acid-Binding Act: D-Isomer Specific 2- Hydroxyacid Dehydrogenase Catalytic Domain From Brucella Melitensis Length = 416 Back     alignment and structure
>pdb|2DBQ|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (I41) Length = 334 Back     alignment and structure
>pdb|2D0I|A Chain A, Crystal Structure Ph0520 Protein From Pyrococcus Horikoshii Ot3 Length = 333 Back     alignment and structure
>pdb|2P9G|A Chain A, Crystal Structure Of Serine Bound G336v,G337v Double Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>pdb|2P9C|A Chain A, Crystal Structure Of Serine Bound G336v Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>pdb|1PSD|A Chain A, The Allosteric Ligand Site In The Vmax-Type Cooperative Enzyme Phosphoglycerate Dehydrogenase Length = 409 Back     alignment and structure
>pdb|2OME|A Chain A, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed With Nad(H) Length = 336 Back     alignment and structure
>pdb|1MX3|A Chain A, Crystal Structure Of Ctbp Dehydrogenase Core Holo Form Length = 347 Back     alignment and structure
>pdb|1HKU|A Chain A, CtbpBARS: A DUAL-Function Protein Involved In Transcription Corepression And Golgi Membrane Fission Length = 358 Back     alignment and structure
>pdb|1GDH|A Chain A, Crystal Structure Of A Nad-Dependent D-Glycerate Dehydrogenase At 2.4 Angstroms Resolution Length = 320 Back     alignment and structure
>pdb|1HL3|A Chain A, CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK PEPTIDE Length = 358 Back     alignment and structure
>pdb|3GA0|A Chain A, Ctbp1BARS GLY172->glu Mutant Structure: Impairing Nad(H) Binding And Dimerization Length = 358 Back     alignment and structure
>pdb|1YBA|A Chain A, The Active Form Of Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>pdb|2GCG|A Chain A, Ternary Crystal Structure Of Human Glyoxylate ReductaseHYDROXYPYRUVATE REDUCTASE Length = 330 Back     alignment and structure
>pdb|1SC6|A Chain A, Crystal Structure Of W139g D-3-Phosphoglycerate Dehydrogenase Complexed With Nad+ Length = 404 Back     alignment and structure
>pdb|4E5K|A Chain A, Thermostable Phosphite Dehydrogenase In Complex With Nad And Sulfite Length = 329 Back     alignment and structure
>pdb|4E5N|A Chain A, Thermostable Phosphite Dehydrogenase In Complex With Nad Length = 330 Back     alignment and structure
>pdb|3GG9|A Chain A, Crystal Structure Of Putative D-3-Phosphoglycerate Dehydrogenase Oxidoreductase From Ralstonia Solanacearum Length = 352 Back     alignment and structure
>pdb|2H1S|A Chain A, Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE REDUCTASE FROM HOMO Sapiens Length = 328 Back     alignment and structure
>pdb|4E5M|A Chain A, Thermostable Phosphite Dehydrogenase E175aA176R IN COMPLEX WITH NADP Length = 329 Back     alignment and structure
>pdb|4E5P|A Chain A, Thermostable Phosphite Dehydrogenase A176r Variant In Complex With Nad Length = 332 Back     alignment and structure
>pdb|4EBF|A Chain A, Semet Thermostable Phosphite Dehydrogenase Glu175-Ala Mutant Length = 334 Back     alignment and structure
>pdb|4G2N|A Chain A, Crystal Structure Of Putative D-Isomer Specific 2-Hydroxyacid Dehydrogenase, Nad-Binding From Polaromonas Sp. Js6 66 Length = 345 Back     alignment and structure
>pdb|1J49|A Chain A, Insights Into Domain Closure, Substrate Specificity And Catalysis Of D-Lactate Dehydrogenase From Lactobacillus Bulgaricus Length = 333 Back     alignment and structure
>pdb|2DLD|A Chain A, D-Lactate Dehydrogenase Complexed With Nadh And Oxamate Length = 337 Back     alignment and structure
>pdb|3N7U|A Chain A, Nad-Dependent Formate Dehydrogenase From Higher-Plant Arabid Thaliana In Complex With Nad And Azide Length = 351 Back     alignment and structure
>pdb|3NAQ|A Chain A, Apo-Form Of Nad-Dependent Formate Dehydrogenase From Higher-Plant Arabidopsis Thaliana Length = 357 Back     alignment and structure
>pdb|1J4A|A Chain A, Insights Into Domain Closure, Substrate Specificity And Catalysis Of D-Lactate Dehydrogenase From Lactobacillus Bulgaricus Length = 333 Back     alignment and structure
>pdb|3KB6|A Chain A, Crystal Structure Of D-lactate Dehydrogenase From Aquifex Aeolicus Complexed With Nad And Lactic Acid Length = 334 Back     alignment and structure
>pdb|2CUK|A Chain A, Crystal Structure Of Tt0316 Protein From Thermus Thermophilus Hb8 Length = 311 Back     alignment and structure
>pdb|2W2L|D Chain D, Crystal Structure Of The Holo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 2.5a Length = 348 Back     alignment and structure
>pdb|2W2K|A Chain A, Crystal Structure Of The Apo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 1.8a. Length = 348 Back     alignment and structure
>pdb|1DXY|A Chain A, Structure Of D-2-Hydroxyisocaproate Dehydrogenase Length = 333 Back     alignment and structure
>pdb|2W2K|B Chain B, Crystal Structure Of The Apo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 1.8a Length = 348 Back     alignment and structure
>pdb|2NAC|A Chain A, High Resolution Structures Of Holo And Apo Formate Dehydrogenase Length = 393 Back     alignment and structure
>pdb|2GO1|A Chain A, Nad-Dependent Formate Dehydrogenase From Pseudomonas Sp.101 Length = 401 Back     alignment and structure
>pdb|2GUG|A Chain A, Nad-dependent Formate Dehydrogenase From Pseudomonas Sp.101 In Complex With Formate Length = 401 Back     alignment and structure
>pdb|3BA1|A Chain A, Structure Of Hydroxyphenylpyruvate Reductase From Coleus Blu Length = 333 Back     alignment and structure
>pdb|3EVT|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Lactobacillus Plantarum Length = 324 Back     alignment and structure
>pdb|3FN4|A Chain A, Apo-form Of Nad-dependent Formate Dehydrogenase From Bacterium Moraxella Sp.c-1 In Closed Conformation Length = 401 Back     alignment and structure
>pdb|2GSD|A Chain A, Nad-dependent Formate Dehydrogenase From Bacterium Moraxella Sp.c2 In Complex With Nad And Azide Length = 402 Back     alignment and structure
>pdb|2O4C|A Chain A, Crystal Structure Of D-erythronate-4-phosphate Dehydrogenase Complexed With Nad Length = 380 Back     alignment and structure
>pdb|2YQ4|A Chain A, Crystal Structure Of D-isomer Specific 2-hydroxyacid Dehydrogenase From Lactobacillus Delbrueckii Ssp. Bulgaricus Length = 343 Back     alignment and structure
>pdb|4DGS|A Chain A, The Crystals Structure Of Dehydrogenase From Rhizobium Meliloti Length = 340 Back     alignment and structure
>pdb|2FSS|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) K47e Mutant Length = 365 Back     alignment and structure
>pdb|2J6I|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) C-Terminal Mutant Length = 364 Back     alignment and structure
>pdb|3OET|A Chain A, D-Erythronate-4-Phosphate Dehydrogenase Complexed With Nad Length = 381 Back     alignment and structure
>pdb|3HG7|A Chain A, Crystal Structure Of D-Isomer Specific 2-Hydroxyacid Dehydrogenase Family Protein From Aeromonas Salmonicida Subsp. Salmonicida A449 Length = 324 Back     alignment and structure
>pdb|1XDW|A Chain A, Nad+-Dependent (R)-2-Hydroxyglutarate Dehydrogenase From Acidaminococcus Fermentans Length = 331 Back     alignment and structure
>pdb|4HY3|A Chain A, Crystal Structure Of A Phosphoglycerate Oxidoreductase From Rhizobium Etli Length = 365 Back     alignment and structure
>pdb|3GVX|A Chain A, Crystal Structure Of Glycerate Dehydrogenase Related Protein From Thermoplasma Acidophilum Length = 290 Back     alignment and structure
>pdb|3KBO|A Chain A, 2.14 Angstrom Crystal Structure Of Putative Oxidoreductase (ycdw) From Salmonella Typhimurium In Complex With Nadp Length = 315 Back     alignment and structure
>pdb|1QP8|A Chain A, Crystal Structure Of A Putative Formate Dehydrogenase From Pyrobaculum Aerophilum Length = 303 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query628
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 0.0
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 1e-173
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 1e-172
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 1e-168
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 1e-162
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 1e-161
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 1e-155
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 1e-154
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 1e-143
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 1e-143
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 1e-136
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 1e-136
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 1e-135
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 1e-133
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 1e-129
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 1e-125
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 1e-120
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 1e-114
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 1e-113
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 1e-112
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 1e-107
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 1e-106
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 1e-105
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 1e-103
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 1e-101
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 2e-94
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 9e-94
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 4e-90
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 7e-82
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 6e-81
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 1e-58
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 1e-53
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 3e-17
2rir_A300 Dipicolinate synthase, A chain; structural genomic 5e-08
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 8e-06
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 3e-05
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 4e-05
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 5e-05
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 6e-05
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 2e-04
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 2e-04
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 2e-04
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 2e-04
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 2e-04
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 2e-04
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 6e-04
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 9e-04
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Length = 529 Back     alignment and structure
 Score =  665 bits (1718), Expect = 0.0
 Identities = 185/535 (34%), Positives = 276/535 (51%), Gaps = 22/535 (4%)

Query: 89  PKPTILVSEKLGEAGLAILRSFGNVECLYDLSPEALCEKISQCDALIVRSGTKVTRSVFE 148
             P +L+++KL  + +A L     V  +     + L   + + DAL+VRS T V   V  
Sbjct: 3   SLPVVLIADKLAPSTVAALGDQVEVRWVDGPDRDKLLAAVPEADALLVRSATTVDAEVLA 62

Query: 149 AANGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPIANTVAAAEHGIALLASMARNVSQA 208
           AA  KLK+V RAGVG+DNVD+ AAT  G LVVNAP +N  +AAEH +ALL + +R +  A
Sbjct: 63  AAP-KLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIPAA 121

Query: 209 DASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGMNVIAHDPYAPADKAR 268
           DAS++   W RS + G  + GKT+ V+G G++G  VA+R    G  V+A+DPY    +A 
Sbjct: 122 DASLREHTWKRSSFSGTEIFGKTVGVVGLGRIGQLVAQRIAAFGAYVVAYDPYVSPARAA 181

Query: 269 AVGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEA 328
            +G+EL+S D  LA ADFIS+H+P  P T+ + + E  AK K GV IVN ARGG++DE A
Sbjct: 182 QLGIELLSLDDLLARADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAA 241

Query: 329 LVRALDSGVVAQAALDVFTEEPPAKDSKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAV 388
           L  A+  G V  A LDVF  EP   DS L +   V VTPHLGAST EAQ+    ++AE+V
Sbjct: 242 LADAITGGHVRAAGLDVFATEPC-TDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESV 300

Query: 389 VGALRGELSATAINAPMVPSEVLSELAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSA 448
             AL GE    A+N       V  E+AP++ L +KLG LA  L        S+ +  R  
Sbjct: 301 RLALAGEFVPDAVNVGGG--VVNEEVAPWLDLVRKLGVLAGVLS--DELPVSLSVQVRG- 355

Query: 449 RDPDDLDTRILRAMITKGIIEPISASFINLVNADFTAKQKGLRISEERVVADSSPEFPID 508
            +    +  +LR    +G+   +    +  VNA   A ++G+     +     SP     
Sbjct: 356 -ELAAEEVEVLRLSALRGLFSAVIEDAVTFVNAPALAAERGVTAEICKA--SESPNHR-S 411

Query: 509 SIQVQLSNVDSKFAAAVSENGEISIEGKV--KFGIPHLTRVGSFGVDASLEGNLILCRQV 566
            + V+            ++   +++ G +        + ++     D   +G  ++   V
Sbjct: 412 VVDVRAVG---------ADGSVVTVSGTLYGPQLSQKIVQINGRHFDLRAQGINLIIHYV 462

Query: 567 DQPGMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAIGVDEEPNQDSLKEIGKV 621
           D+PG +GK+G +LG   VN+    +          + + +D++   D    I   
Sbjct: 463 DRPGALGKIGTLLGTAGVNIQAAQLSEDAEGPGATILLRLDQDVPDDVRTAIAAA 517


>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Length = 307 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Length = 335 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Length = 416 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Length = 333 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Length = 313 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Length = 404 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Length = 347 Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Length = 351 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Length = 364 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Length = 380 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Length = 352 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Length = 393 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Length = 290 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Length = 330 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Length = 334 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Length = 333 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Length = 333 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Length = 331 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Length = 320 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Length = 311 Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Length = 303 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Length = 330 Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Length = 345 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Length = 348 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Length = 340 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Length = 333 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Length = 324 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Length = 315 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Length = 300 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Length = 286 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Length = 364 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Length = 355 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Length = 419 Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Length = 440 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Length = 421 Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Length = 424 Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Length = 421 Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Length = 501 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query628
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 100.0
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 100.0
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 100.0
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 100.0
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 100.0
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 100.0
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 100.0
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 100.0
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 100.0
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 100.0
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 100.0
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 100.0
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 100.0
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 100.0
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 100.0
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 100.0
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 100.0
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 100.0
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 100.0
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 100.0
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 100.0
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 100.0
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 100.0
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 100.0
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 100.0
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 100.0
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 100.0
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 100.0
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 100.0
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 100.0
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 100.0
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 100.0
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 100.0
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 100.0
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 100.0
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 100.0
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 100.0
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.95
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 99.94
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.93
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 99.91
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 99.81
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 99.8
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 99.79
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 99.75
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 99.72
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 99.68
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 99.65
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 99.6
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.51
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.44
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.3
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 99.24
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 99.24
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 99.22
3l6d_A306 Putative oxidoreductase; structural genomics, prot 99.2
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 99.19
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.18
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.17
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 99.16
4ezb_A317 Uncharacterized conserved protein; structural geno 99.16
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 99.15
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 99.15
3qha_A296 Putative oxidoreductase; seattle structural genomi 99.14
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 99.12
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.12
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.11
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.1
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 99.09
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.08
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 99.08
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.07
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.07
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.05
2iaf_A151 Hypothetical protein SDHL; MCSG, PSI2, MAD, struct 99.04
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 99.02
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 98.97
1vpd_A299 Tartronate semialdehyde reductase; structural geno 98.9
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 98.89
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 98.36
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 98.85
3fr7_A525 Putative ketol-acid reductoisomerase (OS05G057370 98.85
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 98.85
1yb4_A295 Tartronic semialdehyde reductase; structural genom 98.84
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 98.84
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 98.84
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 98.82
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 98.8
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 98.77
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 98.76
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 98.75
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.74
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.71
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 98.71
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 98.7
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 98.7
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 98.69
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 98.65
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 98.65
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 98.63
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 98.59
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 98.58
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 98.56
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 98.56
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.55
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 98.5
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 98.49
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 98.42
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 98.42
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 98.4
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 98.39
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 98.34
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 98.32
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.31
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 98.29
3p2o_A285 Bifunctional protein fold; structural genomics, ce 98.29
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 98.25
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 98.23
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 98.23
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 98.22
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 98.2
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 98.19
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 98.13
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 98.11
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 98.09
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 98.09
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 98.06
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 98.03
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 98.02
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 98.02
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 98.0
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 98.0
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 97.99
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 97.99
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 97.99
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 97.98
3ulk_A491 Ketol-acid reductoisomerase; branched-chain amino 97.98
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 97.98
3l07_A285 Bifunctional protein fold; structural genomics, ID 97.97
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 97.96
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.96
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 97.95
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 97.95
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 97.93
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 97.93
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.93
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 97.92
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 97.91
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 97.9
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.89
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 97.89
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.88
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 97.87
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.87
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.86
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 97.83
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 97.81
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.76
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 97.75
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.75
2duw_A145 Putative COA-binding protein; ligand binding prote 97.73
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.64
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 97.64
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 97.63
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 97.61
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.61
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.59
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 97.59
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 97.55
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.48
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.44
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.44
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 97.43
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.36
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.35
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 97.35
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.34
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.34
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.33
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 97.31
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 97.31
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.29
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 97.28
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 97.23
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 97.21
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.19
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 97.18
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 97.15
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 97.15
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 97.14
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.14
3euw_A344 MYO-inositol dehydrogenase; protein structure init 97.13
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 97.12
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 97.1
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 97.09
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.08
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.08
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 97.03
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 97.02
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.02
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.0
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.0
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 97.0
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 96.98
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 96.97
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.95
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 96.94
2pc6_A165 Probable acetolactate synthase isozyme III (small; 96.94
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 96.89
2f06_A144 Conserved hypothetical protein; structural genomic 96.89
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 96.88
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 96.83
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 96.81
1iuk_A140 Hypothetical protein TT1466; structural genomics, 96.8
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 96.79
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 96.79
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 96.78
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.78
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 96.76
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 96.76
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 96.76
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 96.76
2d59_A144 Hypothetical protein PH1109; COA binding, structur 96.75
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 96.75
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.69
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 96.67
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.67
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.67
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 96.64
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 96.63
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 96.63
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 96.62
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 96.6
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 96.6
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 96.57
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.56
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 96.55
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.54
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 96.53
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 96.5
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 96.5
4amu_A365 Ornithine carbamoyltransferase, catabolic; ornithi 96.49
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 96.49
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 96.48
1ydw_A362 AX110P-like protein; structural genomics, protein 96.47
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 96.43
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.43
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.43
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 96.42
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 96.41
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 96.4
1oth_A321 Protein (ornithine transcarbamoylase); transferase 96.39
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 96.38
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 96.37
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 96.33
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 96.31
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 96.31
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 96.27
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 96.25
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 96.25
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 96.25
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 96.22
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 96.22
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 96.21
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 96.19
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 96.19
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 96.18
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 96.18
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 96.16
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.15
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 96.14
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 96.1
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 96.1
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 96.03
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 96.02
4had_A350 Probable oxidoreductase protein; structural genomi 96.02
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 96.0
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 95.97
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 95.94
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 95.94
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 95.93
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 95.92
3tl2_A315 Malate dehydrogenase; center for structural genomi 95.91
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 95.91
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 95.89
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 95.88
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 95.87
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 95.86
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.86
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 95.85
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 95.84
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 95.82
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 95.81
3sds_A353 Ornithine carbamoyltransferase, mitochondrial; str 95.79
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 95.78
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 95.77
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 95.76
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.72
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 95.71
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 95.69
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 95.68
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 95.67
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 95.66
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 95.66
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 95.57
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 95.57
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 95.55
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 95.53
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 95.5
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 95.5
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 95.48
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 95.48
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 95.47
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 95.46
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 95.42
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 95.41
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 95.4
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 95.39
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 95.39
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 95.38
1js1_X324 Transcarbamylase; alpha/beta topology, two domains 95.34
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 95.33
4h31_A358 Otcase, ornithine carbamoyltransferase; structural 95.32
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta 95.3
3btv_A438 Galactose/lactose metabolism regulatory protein GA 95.3
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 95.27
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 95.24
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 95.23
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 95.22
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 95.19
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 95.18
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 95.18
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 95.18
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 95.16
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 95.15
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 95.13
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 95.13
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 95.12
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 95.12
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 95.09
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 95.07
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 95.04
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 95.03
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 95.02
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 94.98
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 94.97
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 94.96
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 94.94
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 94.91
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 94.91
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 94.91
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 94.88
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 94.88
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 94.87
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 94.87
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 94.87
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 94.86
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 94.85
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 94.83
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 94.83
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 94.83
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 94.81
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 94.81
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 94.8
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 94.79
2yfk_A418 Aspartate/ornithine carbamoyltransferase; transcar 94.79
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 94.78
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 94.75
2we8_A386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 94.73
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 94.7
4h3v_A390 Oxidoreductase domain protein; structural genomics 94.7
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 94.68
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 94.67
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 94.67
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 94.66
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 94.64
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 94.64
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 94.63
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 94.61
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 94.59
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 94.52
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 94.52
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 94.51
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 94.47
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 94.45
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 94.42
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 94.41
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 94.41
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 94.41
3q98_A399 Transcarbamylase; rossmann fold, transferase; 2.00 94.38
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 94.37
2nyi_A195 Unknown protein; protein structure initiative, PSI 94.37
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 94.34
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 94.34
1u8s_A 192 Glycine cleavage system transcriptional repressor, 94.32
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 94.31
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 94.27
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 94.26
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 94.25
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 94.22
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 94.21
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 94.21
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 94.2
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 94.19
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 94.13
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 94.11
4eye_A342 Probable oxidoreductase; structural genomics, niai 94.11
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 94.07
1lnq_A336 MTHK channels, potassium channel related protein; 94.06
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 94.05
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 93.94
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 93.92
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 93.81
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 93.75
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 93.73
3ius_A286 Uncharacterized conserved protein; APC63810, silic 93.71
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 93.69
3fbg_A346 Putative arginate lyase; structural genomics, unkn 93.63
2rir_A300 Dipicolinate synthase, A chain; structural genomic 93.62
3oqb_A383 Oxidoreductase; structural genomics, protein struc 93.6
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 93.54
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 93.52
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 93.5
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 93.48
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 93.37
3kzn_A359 Aotcase, N-acetylornithine carbamoyltransferase; t 93.34
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 93.34
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 93.34
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 93.28
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 93.28
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 93.27
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 93.27
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 93.26
3gms_A340 Putative NADPH:quinone reductase; structural genom 93.25
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 93.23
4hv4_A494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 93.23
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 93.15
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 93.15
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 93.12
3on5_A362 BH1974 protein; structural genomics, joint center 93.09
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 93.08
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 93.06
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 93.05
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 93.03
1u8s_A192 Glycine cleavage system transcriptional repressor, 93.02
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 92.92
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 92.89
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 92.88
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 92.84
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 92.83
1xq6_A253 Unknown protein; structural genomics, protein stru 92.81
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 92.78
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 92.77
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 92.77
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 92.73
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 92.71
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 92.61
3hn7_A524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 92.54
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 92.48
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 92.47
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 92.47
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 92.44
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 92.39
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 92.37
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 92.34
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 92.28
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 92.28
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 92.26
2nyi_A 195 Unknown protein; protein structure initiative, PSI 92.21
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 92.21
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 92.18
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 92.17
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 92.16
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 92.14
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 92.14
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 92.03
2wm3_A299 NMRA-like family domain containing protein 1; unkn 91.99
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 91.94
2f06_A144 Conserved hypothetical protein; structural genomic 91.89
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 91.82
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 91.8
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 91.77
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 91.76
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 91.67
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 91.58
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 91.57
4g65_A461 TRK system potassium uptake protein TRKA; structur 91.57
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 91.52
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 91.48
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 91.44
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 91.44
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 91.28
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 91.27
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 91.27
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 91.25
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 91.25
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 91.2
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 91.08
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 91.07
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 91.06
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-101  Score=867.87  Aligned_cols=520  Identities=35%  Similarity=0.532  Sum_probs=492.1

Q ss_pred             CCCCeEEEeCCCCHhHHHHhhcCCcEEEecCCCHhHHHhhcCCCeEEEEcCCCCCCHHHHHhcCCcceeEEecccccCcc
Q 006864           88 TPKPTILVSEKLGEAGLAILRSFGNVECLYDLSPEALCEKISQCDALIVRSGTKVTRSVFEAANGKLKVVGRAGVGIDNV  167 (628)
Q Consensus        88 ~~~~~vlv~~~l~~~~~~~l~~~~~v~~~~~~~~~el~~~~~~~d~liv~~~~~v~~~~l~~~~~~Lk~I~~~g~G~D~i  167 (628)
                      |.++|||+++++.++.++.|++..++++....+.+++.+.+++||++++++.+++++++++++ |+||||+++|+|||||
T Consensus         2 m~~~~vl~~~~~~~~~~~~l~~~~~v~~~~~~~~~~~~~~~~~~d~li~~~~~~~~~~~l~~~-~~Lk~i~~~~~G~d~i   80 (529)
T 1ygy_A            2 VSLPVVLIADKLAPSTVAALGDQVEVRWVDGPDRDKLLAAVPEADALLVRSATTVDAEVLAAA-PKLKIVARAGVGLDNV   80 (529)
T ss_dssp             -CCCEEEECSSCCGGGGTTSCSSSEEEECCTTSHHHHHHHGGGCSEEEECSSSCBCHHHHHTC-TTCCEEEESSSCCTTB
T ss_pred             CCCcEEEEeCCCCHHHHHHHhcCceEEEcCCCCHHHHHHHhcCCEEEEEcCCCCCCHHHHhhC-CCCcEEEECCcCcCcc
Confidence            457899999999999888887766777766678899999999999999998889999999987 5999999999999999


Q ss_pred             cHhHHHhcCceEEcCCCCChhhHHHHHHHHHHHHHHchhHHHHHHHcCcccccccceeeecCCeEEEEecChhHHHHHHH
Q 006864          168 DLQAATEFGCLVVNAPIANTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARR  247 (628)
Q Consensus       168 Dl~aa~~~GI~V~n~p~~~~~avAE~~l~l~L~~~R~i~~~~~~~~~g~W~~~~~~g~~l~GktiGIIGlG~IG~~vA~~  247 (628)
                      |+++|+++||.|+|+|++|+.+||||++++||+++|+++++++.+++|+|.+..+.|.+++|||+||||+|+||+++|++
T Consensus        81 d~~~~~~~gi~v~n~p~~~~~~vAE~~~~~~l~~~R~~~~~~~~~~~g~w~~~~~~~~~l~g~~vgIIG~G~IG~~vA~~  160 (529)
T 1ygy_A           81 DVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIPAADASLREHTWKRSSFSGTEIFGKTVGVVGLGRIGQLVAQR  160 (529)
T ss_dssp             CHHHHHHTTCEEECCTTSSHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCGGGCCBCCCTTCEEEEECCSHHHHHHHHH
T ss_pred             CHhHHHhCCeEEEECCCcchHHHHHHHHHHHHHHHhhhHHHHHHHHhCCCcccCcCccccCCCEEEEEeeCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999987778999999999999999999999999


Q ss_pred             HHcCCCEEEEECCCCChhHHHHcCCcccCHHHHhccCCEEEEcCCCCccccccccHHHHhcCCCCcEEEEcCCCchhcHH
Q 006864          248 AKGLGMNVIAHDPYAPADKARAVGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEE  327 (628)
Q Consensus       248 l~~~G~~V~~~d~~~~~~~a~~~g~~~~sl~ell~~aDvV~l~~Plt~~t~~li~~~~l~~mk~gailIN~aRg~~vde~  327 (628)
                      |+++||+|++|||+...+.+.+.|+..+++++++++||+|++|+|++++|+++++++.+++||+|++|||++||+++|++
T Consensus       161 l~~~G~~V~~~d~~~~~~~a~~~g~~~~~l~e~~~~aDvV~l~~P~~~~t~~~i~~~~~~~~k~g~ilin~arg~iv~~~  240 (529)
T 1ygy_A          161 IAAFGAYVVAYDPYVSPARAAQLGIELLSLDDLLARADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEA  240 (529)
T ss_dssp             HHTTTCEEEEECTTSCHHHHHHHTCEECCHHHHHHHCSEEEECCCCSTTTTTCBCHHHHTTSCTTEEEEECSCTTSBCHH
T ss_pred             HHhCCCEEEEECCCCChhHHHhcCcEEcCHHHHHhcCCEEEECCCCchHHHHHhCHHHHhCCCCCCEEEECCCCchhhHH
Confidence            99999999999998866667778888789999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhCCCeeEEEeeccCCCCCCCCCccccCCcEEEcCCCCCCcHHHHHHHHHHHHHHHHHHHcCCCCCCcccCCCCC
Q 006864          328 ALVRALDSGVVAQAALDVFTEEPPAKDSKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAVVGALRGELSATAINAPMVP  407 (628)
Q Consensus       328 aL~~aL~~g~i~ga~lDV~~~EP~~~~~~L~~~~nvilTPHig~~T~ea~~~~~~~~~~~i~~~l~g~~~~~~vn~p~~~  407 (628)
                      +|+++|++|+++||++|||+.||+ +++|||+++|||+|||++++|.|++++++..+++++.+++.|+.+.+.||.|.  
T Consensus       241 aL~~al~~g~i~ga~lDv~~~eP~-~~~~L~~~~~vilTPh~~~~t~ea~~~~~~~~~~~l~~~l~~~~~~~~v~~~~--  317 (529)
T 1ygy_A          241 ALADAITGGHVRAAGLDVFATEPC-TDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGG--  317 (529)
T ss_dssp             HHHHHHHTSSEEEEEESSCSSSSC-SCCGGGGCTTEEECSSCSSCBHHHHHHHHHHHHHHHHHHHTTCCCTTBCSCCS--
T ss_pred             HHHHHHHcCCccEEEEeeccCCCC-CCchHHhCCCEEEccccCCCCHHHHHHHHHHHHHHHHHHHcCCCCCcccCCcc--
Confidence            999999999999999999999997 68999999999999999999999999999999999999999999999999875  


Q ss_pred             cccccccccHHHHHHHHhHHHHHHhcCCCCceEEEEEEeecCCCCCCCcccchHHHHHhhccccccCcccccchHhHHhh
Q 006864          408 SEVLSELAPYVVLAKKLGRLAVQLVSGGSGIKSVKLIYRSARDPDDLDTRILRAMITKGIIEPISASFINLVNADFTAKQ  487 (628)
Q Consensus       408 ~~~~~~~~p~~~lAerlG~la~qL~~g~~~~~~v~i~~~Gs~a~~~~~~~~~~~a~l~GlL~~~~~~~vnlvNA~~iAke  487 (628)
                      ++.++++.||+.||+++|+++.||++|  +|++++++|+|+++ + .+++++++++++|+|+.+.++.+|++||+.+|++
T Consensus       318 ~~~hd~i~P~l~La~~lg~~~~qla~g--~~~ditria~G~~~-~-~~i~~~n~a~l~g~L~~~~~~~~~~vnA~~iA~e  393 (529)
T 1ygy_A          318 GVVNEEVAPWLDLVRKLGVLAGVLSDE--LPVSLSVQVRGELA-A-EEVEVLRLSALRGLFSAVIEDAVTFVNAPALAAE  393 (529)
T ss_dssp             TTSCTTTTTHHHHHHHHHHHHHHTSSS--CCSEEEEEEEEGGG-G-SCCHHHHHHHHHHHTGGGSCTTCCCCCHHHHHHH
T ss_pred             cccchhhhhHHHHHHHHHHHHHHHhCC--CceEEEEEEEeecc-c-cCCcHHHHHHHHHhcCCCCCCCccccCHHHHHHH
Confidence            889999999999999999999999998  89999999999998 6 6799999999999999999888999999999999


Q ss_pred             cCceEEEEEeecCCCCCCCCceEEEEEEecccccceeeCCCcEEEEEEEEEC--CeeEEEEECceeEEeecCCcEEEEec
Q 006864          488 KGLRISEERVVADSSPEFPIDSIQVQLSNVDSKFAAAVSENGEISIEGKVKF--GIPHLTRVGSFGVDASLEGNLILCRQ  565 (628)
Q Consensus       488 ~GI~i~~~~~~~~~~~~~~~ntv~v~l~~~~~~~~~~~~~~~~~~v~Gt~~g--G~~~I~~Idgf~Vd~~~~~~~Llv~~  565 (628)
                      +||++.|.+.+...   .|+|+++++++         +.++++++|.|+|+|  |.++|++||||++++.|++|+|++.|
T Consensus       394 ~Gi~i~~~~~~~~~---~~~n~v~v~~~---------~~~~~~~~v~Gt~~gg~g~~~i~~i~g~~v~~~~~~~~l~v~~  461 (529)
T 1ygy_A          394 RGVTAEICKASESP---NHRSVVDVRAV---------GADGSVVTVSGTLYGPQLSQKIVQINGRHFDLRAQGINLIIHY  461 (529)
T ss_dssp             HSCEEEEEEESCCS---SSSEEEEEEEE---------CTTSCEEEEEEEEETTTTEEEEEEETTEEEEEESCSEEEEEEE
T ss_pred             cCCEEEEEEccCCC---CCCCEEEEEEE---------ECCCCEEEEEEEEeCCCCcEEEEEECCEEEEecCCccEEEEEc
Confidence            99999998866443   79999999997         347889999999997  49999999999999999999999999


Q ss_pred             cCCCCchhhHHhhhhcCCccccceEEeeeecCccEEEEEEeCCCCCHHHHHHHhcccCcccc
Q 006864          566 VDQPGMIGKVGNILGEHNVNVNFMSVGRTFRRNHGIMAIGVDEEPNQDSLKEIGKVHFVARI  627 (628)
Q Consensus       566 ~D~PGvIa~V~~iL~~~~INIa~m~v~R~~~gg~Al~~i~vD~~~~~~~l~~L~~l~~v~~v  627 (628)
                      .|+||+|++|+++|++++|||++|+++|..+++.|+|+|++|++++++++++|+++++|.++
T Consensus       462 ~D~PG~I~~v~~~Lg~~~INIa~m~v~r~~~~~~a~~~i~vd~~~~~~~l~~l~~~~~i~~v  523 (529)
T 1ygy_A          462 VDRPGALGKIGTLLGTAGVNIQAAQLSEDAEGPGATILLRLDQDVPDDVRTAIAAAVDAYKL  523 (529)
T ss_dssp             SCCTTHHHHHHHHHHHTTCCEEEEEEEECSSSSCEEEEEEESSCCCHHHHHHHHHHHTEEEE
T ss_pred             CCCCchHHHHHHHHHhcCCCeeeEEEecCCCCCEEEEEEEECCCCCHHHHHHHhcCCCccEE
Confidence            99999999999999999999999999999999999999999999999999999999999875



>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2iaf_A Hypothetical protein SDHL; MCSG, PSI2, MAD, structural genomics, L-serine dehydratase, structure initiative; 2.05A {Legionella pneumophila} SCOP: d.81.2.1 PDB: 2iqq_A Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1js1_X Transcarbamylase; alpha/beta topology, two domains, transferase; 2.00A {Bacteroides fragilis} SCOP: c.78.1.1 c.78.1.1 PDB: 2fg6_X* 2fg7_X* 2g7m_X* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>4h31_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PE5; 1.70A {Vibrio vulnificus} PDB: 3upd_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3kzn_A Aotcase, N-acetylornithine carbamoyltransferase; transcarbamylase, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: KCX AOR; 1.80A {Xanthomonas campestris PV} PDB: 3kzc_A* 3kzm_A* 3kzk_A* 3kzo_A* 3m4j_A* 3m5d_A* 3m5c_A* 3l05_A* 3l02_A* 3m4n_A* 3l06_A* 3l04_A* Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans} Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 628
d1ygya1184 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase 1e-43
d1gdha1191 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyp 6e-42
d2naca1188 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudom 6e-40
d1sc6a1188 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase 1e-37
d1mx3a1193 c.2.1.4 (A:126-318) Transcription corepressor CtbP 7e-34
d1j4aa1197 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lacto 3e-28
d1ygya2130 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehy 1e-24
d1qp8a1181 c.2.1.4 (A:83-263) Putative formate dehydrogenase 1e-24
d1gdha2129 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrog 5e-23
d1dxya1199 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydro 3e-21
d1mx3a2133 c.23.12.1 (A:27-125,A:319-352) Transcription corep 4e-21
d1sc6a2132 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate deh 5e-20
d1dxya2131 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproa 3e-18
d1j4aa2134 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogen 6e-18
d1ygya4135 d.81.2.2 (A:317-451) D-3-phosphoglycerate dehydrog 3e-17
d2naca2186 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenas 4e-16
d1li4a1163 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas 1e-13
d1qp8a2121 c.23.12.1 (A:1-82,A:264-302) Putative formate dehy 2e-12
d1ygya378 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogena 2e-12
d1sc6a384 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogena 9e-11
d1v8ba1163 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolas 2e-08
d1pjqa1113 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 3e-05
d1hwxa1293 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow ( 7e-05
d1v9la1242 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrob 1e-04
d1leha1230 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillu 3e-04
d1c1da1201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 0.002
d1bgva1255 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clost 0.004
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 184 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Formate/glycerate dehydrogenases, NAD-domain
domain: Phosphoglycerate dehydrogenase
species: Mycobacterium tuberculosis [TaxId: 1773]
 Score =  152 bits (385), Expect = 1e-43
 Identities = 87/185 (47%), Positives = 116/185 (62%), Gaps = 1/185 (0%)

Query: 186 NTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVA 245
           N  +AAEH +ALL + +R +  ADAS++   W RS + G  + GKT+ V+G G++G  VA
Sbjct: 1   NIHSAAEHALALLLAASRQIPAADASLREHTWKRSSFSGTEIFGKTVGVVGLGRIGQLVA 60

Query: 246 RRAKGLGMNVIAHDPYAPADKARAVGVELVSFDQALATADFISLHMPLNPTTSKIFNDET 305
           +R    G  V+A+DPY    +A  +G+EL+S D  LA ADFIS+H+P  P T+ + + E 
Sbjct: 61  QRIAAFGAYVVAYDPYVSPARAAQLGIELLSLDDLLARADFISVHLPKTPETAGLIDKEA 120

Query: 306 FAKMKKGVRIVNVARGGVIDEEALVRALDSGVVAQAALDVFTEEPPAKDSKLVQHENVTV 365
            AK K GV IVN ARGG++DE AL  A+  G V  A LDVF  EP   DS L +   V V
Sbjct: 121 LAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFATEPC-TDSPLFELAQVVV 179

Query: 366 TPHLG 370
           TPHLG
Sbjct: 180 TPHLG 184


>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 191 Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 188 Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 193 Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 197 Back     information, alignment and structure
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 130 Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 181 Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 129 Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 199 Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 131 Back     information, alignment and structure
>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 134 Back     information, alignment and structure
>d1ygya4 d.81.2.2 (A:317-451) D-3-phosphoglycerate dehydrogenase SerA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 186 Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 121 Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 78 Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Length = 84 Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 163 Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Length = 113 Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 293 Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 242 Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 230 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 255 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query628
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 100.0
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 100.0
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 100.0
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 100.0
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 100.0
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 100.0
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 100.0
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 100.0
d1ygya2130 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.95
d1ygya4135 D-3-phosphoglycerate dehydrogenase SerA {Mycobacte 99.94
d1sc6a2132 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.9
d1gdha2129 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.89
d1qp8a2121 Putative formate dehydrogenase {Archaeon Pyrobacul 99.85
d1dxya2131 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.84
d1mx3a2133 Transcription corepressor CtbP {Human (Homo sapien 99.83
d2naca2186 Formate dehydrogenase {Pseudomonas sp., strain 101 99.8
d1j4aa2134 D-lactate dehydrogenase {Lactobacillus helveticus 99.75
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 99.62
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 99.61
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.43
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 99.38
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.34
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 99.31
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.29
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.17
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 98.96
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 98.86
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 98.82
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 98.73
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 98.71
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 98.58
d2iafa1145 L-serine dehydratase SdhL, N-terminal domain {Legi 98.53
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.43
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 98.4
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 98.29
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.29
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 98.28
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 98.24
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 98.21
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 98.15
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.14
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 98.02
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.97
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 97.83
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.8
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.75
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 97.75
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 97.73
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.72
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.69
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.67
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 97.6
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.57
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.55
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 97.54
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 97.53
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.53
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.31
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.3
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 97.29
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 97.18
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 97.11
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.05
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 96.97
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 96.96
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.93
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 96.91
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 96.91
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 96.86
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.86
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.86
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.83
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 96.82
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.81
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.81
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.76
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.73
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 96.72
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.67
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.66
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.63
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 96.62
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 96.6
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.59
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.58
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 96.58
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.58
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.51
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 96.5
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 96.45
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.42
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.3
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 96.28
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.18
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.17
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 96.13
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.1
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.02
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 96.0
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 95.99
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 95.92
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.91
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 95.89
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.84
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.78
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.75
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.72
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 95.71
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.68
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 95.67
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.65
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.42
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 95.41
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 95.41
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.35
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.32
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.31
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 95.3
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 95.19
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 95.19
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.19
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 95.08
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 94.99
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.97
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.87
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 94.86
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 94.82
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 94.75
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.73
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 94.69
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 94.64
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 94.26
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.24
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 94.21
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 94.2
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 94.06
d1id1a_153 Rck domain from putative potassium channel Kch {Es 94.04
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 93.68
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 93.67
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 93.47
d1l7da2194 Nicotinamide nucleotide transhydrogenase dI compon 93.44
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 93.39
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 93.26
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 93.17
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 93.07
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 93.04
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 92.96
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 92.86
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 92.7
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 92.16
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 92.14
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 92.07
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 91.87
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 91.83
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 91.75
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 91.4
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 91.38
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 91.37
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.26
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 91.26
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 91.23
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 91.21
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 90.98
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 90.96
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 90.86
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 90.72
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 90.59
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 90.46
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 90.41
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 90.3
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 90.22
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 90.11
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 90.08
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 89.98
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 89.8
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 89.68
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 89.48
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 89.44
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 89.32
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 89.32
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 89.2
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 89.18
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 89.04
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 89.02
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 88.87
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 88.85
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 88.79
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 88.64
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 88.61
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 88.55
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 88.5
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 88.21
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 88.18
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 87.98
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 87.93
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 87.78
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 87.75
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 87.7
d1pjca2193 L-alanine dehydrogenase {Phormidium lapideum [TaxI 87.54
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 87.53
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 87.48
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 87.33
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 87.22
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 86.72
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 86.72
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 86.64
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 86.6
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 86.52
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 86.47
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 86.44
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 86.27
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 86.25
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 86.13
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 86.1
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 85.96
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 85.94
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 85.88
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 85.83
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 85.72
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 85.63
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 85.46
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 85.4
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 85.28
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 85.25
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 85.11
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 84.94
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 84.87
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 84.69
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 84.56
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 84.53
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 84.12
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.09
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 84.0
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 83.96
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 83.78
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 83.72
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 83.64
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 83.42
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 83.37
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 83.31
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 83.21
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 83.09
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 82.76
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 82.47
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 81.94
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 81.92
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 81.81
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 81.62
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 81.6
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 81.31
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 81.22
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 81.16
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 81.06
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 81.06
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 80.81
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 80.78
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 80.39
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 80.11
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 80.09
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Formate/glycerate dehydrogenases, NAD-domain
domain: Phosphoglycerate dehydrogenase
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=100.00  E-value=6.3e-51  Score=395.27  Aligned_cols=184  Identities=47%  Similarity=0.783  Sum_probs=178.1

Q ss_pred             ChhhHHHHHHHHHHHHHHchhHHHHHHHcCcccccccceeeecCCeEEEEecChhHHHHHHHHHcCCCEEEEECCCCChh
Q 006864          186 NTVAAAEHGIALLASMARNVSQADASIKAGKWLRSKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGMNVIAHDPYAPAD  265 (628)
Q Consensus       186 ~~~avAE~~l~l~L~~~R~i~~~~~~~~~g~W~~~~~~g~~l~GktiGIIGlG~IG~~vA~~l~~~G~~V~~~d~~~~~~  265 (628)
                      |+.+||||+++|||++.|+++++++.+++|.|.+..+.+.++.||++||+|+|+||+.+|+++++|||+|++|||+....
T Consensus         1 N~~sVAE~~~~liL~~~R~i~~~~~~~~~~~W~~~~~~~~~l~~k~vgiiG~G~IG~~va~~~~~fg~~v~~~d~~~~~~   80 (184)
T d1ygya1           1 NIHSAAEHALALLLAASRQIPAADASLREHTWKRSSFSGTEIFGKTVGVVGLGRIGQLVAQRIAAFGAYVVAYDPYVSPA   80 (184)
T ss_dssp             SHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCGGGCCBCCCTTCEEEEECCSHHHHHHHHHHHTTTCEEEEECTTSCHH
T ss_pred             CchHHHHHHHHHHHHHHcCHHHHHHHHHhCCCCccccccccccceeeeeccccchhHHHHHHhhhccceEEeecCCCChh
Confidence            67899999999999999999999999999999987788999999999999999999999999999999999999998877


Q ss_pred             HHHHcCCcccCHHHHhccCCEEEEcCCCCccccccccHHHHhcCCCCcEEEEcCCCchhcHHHHHHHHhCCCeeEEEeec
Q 006864          266 KARAVGVELVSFDQALATADFISLHMPLNPTTSKIFNDETFAKMKKGVRIVNVARGGVIDEEALVRALDSGVVAQAALDV  345 (628)
Q Consensus       266 ~a~~~g~~~~sl~ell~~aDvV~l~~Plt~~t~~li~~~~l~~mk~gailIN~aRg~~vde~aL~~aL~~g~i~ga~lDV  345 (628)
                      .....+++..+++|++++||+|++|||+|++|++|||++.|++||+|++|||+|||++|||+||+++|++|+|+||+|||
T Consensus        81 ~~~~~~~~~~~l~ell~~sDiv~~~~Plt~~T~~lin~~~l~~mk~~a~lIN~sRG~iVde~aL~~aL~~~~i~~a~lDV  160 (184)
T d1ygya1          81 RAAQLGIELLSLDDLLARADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDV  160 (184)
T ss_dssp             HHHHHTCEECCHHHHHHHCSEEEECCCCSTTTTTCBCHHHHTTSCTTEEEEECSCTTSBCHHHHHHHHHTSSEEEEEESS
T ss_pred             HHhhcCceeccHHHHHhhCCEEEEcCCCCchhhhhhhHHHHhhhCCCceEEEecchhhhhhHHHHHHHhcCcEeEEEEeC
Confidence            77778888889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCccccCCcEEEcCCCC
Q 006864          346 FTEEPPAKDSKLVQHENVTVTPHLG  370 (628)
Q Consensus       346 ~~~EP~~~~~~L~~~~nvilTPHig  370 (628)
                      |++||++ ++|||++|||++|||+|
T Consensus       161 ~~~EP~~-~~~l~~~~nviiTPHIG  184 (184)
T d1ygya1         161 FATEPCT-DSPLFELAQVVVTPHLG  184 (184)
T ss_dssp             CSSSSCS-CCGGGGCTTEEECSSCS
T ss_pred             CCCCCCC-CchHhcCCCEEECCCCC
Confidence            9999985 89999999999999997



>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ygya4 d.81.2.2 (A:317-451) D-3-phosphoglycerate dehydrogenase SerA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2iafa1 d.81.2.1 (A:4-148) L-serine dehydratase SdhL, N-terminal domain {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7da2 c.23.12.2 (A:1-143,A:327-377) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pjca2 c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure