Citrus Sinensis ID: 006945

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620----

MSKTLGKVLEHDDMDQDRTKGKKLDTGFSGTTKQWEETFGSRYPKAGAMYRGTAPSPLTTIPFSSDIVSKEVVSSKECQKIINIPDLKIVEVFVEIVAVKNLPEDHKDKGDLFVFFSKSQPDIFFNAKQKLTILSKSGMKQVASFQCEATGELLFELVSHSTSKIPMTGASKTMGTASLSLQNFISPISKLAVEQWFDLVPRSGNVSSKPISLRIAVSFTIPTLAPHLLRMVRSRPLSKSSCFFPLPGRIQPAKSWTRVIDETQSEVISLQMRDPKKEKGGDNCTLRKQVIGVTESGETITLAEMVETGWSVMDCCWSLKKKSSKEGHLFELLGNRMINLFPGRKLDYEHKHCQKQRSEEDFVTAIEFSPADPYGKAIALLDLKSGVIKVKEEWFLLLGIISAFILSDALKEGYDGFTANNEVMKEMKSASDSVEGLQEEGICTKMIPPVGDEPELNKNMTNEVNSGGCGGCGSGCGGGRVASVKSSGCGGCGGGGGGCGNMVNGGGCGGCGGGCGGGCGGGCGGGCAALVKSSGCGGGECGGGCGSGGCGAGCGNMVKTGGCGSGGCGAGCGNTVKTGGCGGCGGGCGGNLVAKSASEYKVGNACNEEQSKETSVSMNETVVA

cccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEccccccccccccEEEEEEccccccccccccEEEEccccccEEEEEEEEEEcccEEEEEEEcccccccccccccccEEEEEEcccccccccccEEEEEEEEcccccccccccEEEEEEEEEEccccccEEEEEcccccccccccccccccccccccccEEEEcccccEEEEEEEEccccccccccccccEEEEEEEccccEEHHHHHHcccEEEEccEEEEEEccccccccEEEcccEEEEEEccccccccccccccccccccEEEEEEEccccccccEEEEEEccccEEEEcccHHHHHHHHHHHHHHHHHHccccccEEcHHHHHHHccccccccccEEEccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccEEcccccccccccccEEEcccEEcc

cHHHHHHHHcccccccccccccccccccccHHHHHHHHHcHHHHHcccccccccccccccccccccccccccccccHHHHHEEccccEEEEEEEEEEccccccccccccccEEEEEEccccccEEccccEEEEEEccccEEEEEEEEccccEEEEEEEEccccccccccccccccEEEEEHHHHccccccccEEEEEEEcccccccccccEEEEEEEEcccccccccEEEEEEccccccccccccccccccccccEEEEEEccccEEEEEEEEcccHccccccccEEEEEEEEEccccEEEEEEEEccEEEEEccccEEcccccccccEEEEccccEEEEEccccccEEHHHHHcccccccEEEEEEEccccccccEEEEEEccccEEEEcHHHHHHHHHHHHHHHHHHHcccccccEEcccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccEEEcccccccccccccccccccccccHHHHcccccccccccccccccccccccccEEccccccccccccccccEEEcccccccccccccEEEEcccccEEEccccccccccccEEEcccEEcc

msktlgkvlehddmdqdrtkgkkldtgfsgtTKQWEEtfgsrypkagamyrgtapsplttipfssdivsKEVVsskecqkiinipdlkIVEVFVEIVAvknlpedhkdkgdlfvffsksqpdiffNAKQKLTILSKSGMKQVASFQCEATGELLFELVShstskipmtgasktmgtaSLSLQNFISPISKLAVEQwfdlvprsgnvsskpislRIAVsftiptlaphllrmvrsrplsksscffplpgriqpakswTRVIDETQSEVISLqmrdpkkekggdnctlrKQVIGVTESGETITLAEMVETGWSVMDCCwslkkksskegHLFELLGNRMinlfpgrkldyehkhcqkqrseedfvtaiefspadpygKAIALLDLKSGVIKVKEEWFLLLGIISAFILSDALkegydgftaNNEVMKEMKSASDSVEGlqeegictkmippvgdepelnknmtnevnsggcggcgsgcgggrvasvkssgcggcggggggcgnmvngggcggcgggcgggcgggcgggcaalvkssgcgggecgggcgsggcgagcgnmvktggcgsggcgagcgntvktggcggcgggcggnlvaksaseykvgnacneeqskeTSVSMNETVVA

msktlgkvlehddmdqdrtkgkkldtgfsgttkqweeTFGSRYPKAGAMYRGTAPSPLTTIPFSSDIVSKEVVSSKecqkiinipdlkivEVFVEIVAVKnlpedhkdKGDLFVFFSKSQPDIFFNAKQKLTILSKSGMKQVASFQCEATGELLFELVSHSTSKIPMTGASKTMGTASLSLQNFISPISKLAVEQWFDLVPRSGNVSSKPISLRIAVSFTIPTLAPHLLRMVRSRPlsksscffplpgriqpakswtrVIDETQSEvislqmrdpkkekggdnctlrkqvigvtesgetiTLAEMVETGWSVMDCCWSLKKKSSKEGHLFELLGNRMINLFPGRKLDYEHKHCQKQRSEEDFVTAIEFSPADPYGKAIALLDLKSGVIKVKEEWFLLLGIISAFILSDALKEGYDGFTANNEVMKEMKSASDSVEGLQEEGICTkmippvgdepeLNKNMTNEVNSGGCGGCGSGCGGGRVASVKSSGCGGCGGGGGGCGNMVNGGGCGGCGGGCGGGCGGGCGGGCAALVKSSGCGGGECGGGCGSGGCGAGCGNMVKTGGCGSGGCGAGCGNTVKTGGCGGCGGGCGGNLVAKSASEYKVGNacneeqsketsvsmnetvva

MSKTLGKVLEHDDMDQDRTKGKKLDTGFSGTTKQWEETFGSRYPKAGAMYRGTAPSPLTTIPFSSDIVSKEVVSSKECQKIINIPDLKIVEVFVEIVAVKNLPEDHKDKGDLFVFFSKSQPDIFFNAKQKLTILSKSGMKQVASFQCEATGELLFELVSHSTSKIPMTGASKTMGTASLSLQNFISPISKLAVEQWFDLVPRSGNVSSKPISLRIAVSFTIPTLAPHLLRMVRSRPLSKSSCFFPLPGRIQPAKSWTRVIDETQSEVISLQMRDPKKEKGGDNCTLRKQVIGVTESGETITLAEMVETGWSVMDCCWSLKKKSSKEGHLFELLGNRMINLFPGRKLDYEHKHCQKQRSEEDFVTAIEFSPADPYGKAIALLDLKSGVIKVKEEWFLLLGIISAFILSDALKEGYDGFTANNEVMKEMKSASDSVEGLQEEGICTKMIPPVGDEPELNKNMTNEVNsggcggcgsgcgggRVASVKSSgcggcggggggcgnmvngggcggcgggcgggcgggcgggcAALVKssgcgggecgggcgsggcgagcgNMVKTggcgsggcgagcgNTVKTggcggcgggcggNLVAKSASEYKVGNACNEEQSKETSVSMNETVVA

*************************************************Y*******LTTIPFSSDIVSKEVVSSKECQKIINIPDLKIVEVFVEIVAVKNLPEDHKDKGDLFVFFSKSQPDIFFNAKQKLTILSKSGMKQVASFQCEATGELLFELVSH********************LQNFISPISKLA*******************SLRIAVSFTIPTLAPHLLRMVRSRPLSKSSCFFPLPGRIQPAKSWTRVID**********************CTLRKQVIGVTESGETITLAEMVETGWSVMDCCWSLKKKSSKEGHLFELLGNRMINLFPGRKLDY*****************IEFSPADPYGKAIALLDLKSGVIKVKEEWFLLLGIISAFILSDALKEGYDGFTA****************************************************C******************************VNGGGCGGCGGGCGGGCGGGCGGGCAALVKS**************************************CGNTVKTGGCGGCGGGCGGNLVAKS****************************

***TLGKVLEHD***************FSGTTKQWEETFGSRYPKAGAMYRGTAPS*******************KECQKIINIPDLKIVEVFVEIVAVKNLPEDHKDKGDLFVFFSKSQPDIFFNAKQKLTILSKSGMKQVASFQCEATGELLFELV******************ASLSLQNFISPISKLAVEQWFDLVPR*****SKPISLRIAVSFTIPTLAPHLLRMVRSRPLSKSSCFFPLPGRIQPAKSWTRVIDETQSEVISLQM***************KQVIGVTESGETITLAEMVETGWSVMDCCWSLKKKSSKEGHLFELLGNRMINLFPGRKLDYEHK*****RSEEDFVTAIEFSPADPYGKAIALLDLKSGVIKVKEEWFLLLGIISAFILSDALKEGYDGFT*********************EGI**KMIPPVGDEPELNKNMTNEV**G**GGCGSGCGGGRVAS********************************GGGCGGGCGGGCAALVK************CGSGGCGAGCGNMV****************TV*****************************************MNETVV*

MSKTLGKVLEHDDMDQDRTKGKKLDTGFSGTTKQWEETFGSRYPKAGAMYRGTAPSPLTTIPFSSDI*********ECQKIINIPDLKIVEVFVEIVAVKNLPEDHKDKGDLFVFFSKSQPDIFFNAKQKLTILSKSGMKQVASFQCEATGELLFELVSHSTSKIPMTGASKTMGTASLSLQNFISPISKLAVEQWFDLVPRSGNVSSKPISLRIAVSFTIPTLAPHLLRMVRSRPLSKSSCFFPLPGRIQPAKSWTRVIDETQSEVISLQMRDPKKEKGGDNCTLRKQVIGVTESGETITLAEMVETGWSVMDCCWSLKKKSSKEGHLFELLGNRMINLFPGRKLDYEH*********EDFVTAIEFSPADPYGKAIALLDLKSGVIKVKEEWFLLLGIISAFILSDALKEGYDGFTANNEVMKE***********QEEGICTKMIPPVGDEPELNKNMTNEVNSGGCGGCGSGCGGGRVASVKSSGCGGCGGGGGGCGNMVNGGGCGGCGGGCGGGCGGGCGGGCAALVKSSGCGGGECGGGCGSGGCGAGCGNMVKTGGCGSGGCGAGCGNTVKTGGCGGCGGGCGGNLVAKSASEYKVGNA*******************

MSKTLGKVLEHD*********KKLDTGFSGTTKQWEETFGSRYPKAGAMYRGTAPSPLTTIPFSSDIVSKEVVSSKECQKIINIPDLKIVEVFVEIVAVKNLPEDHKDKGDLFVFFSKSQPDIFFNAKQKLTILSKSGMKQVASFQCEATGELLFELVSHSTSKIPMTGASKTMGTASLSLQNFISPISKLAVEQWFDLVPRSGNVSSKPISLRIAVSFTIPTLAPHLLRMVRSRPLSKSSCFFPLPGRIQPAKSWTRVIDETQSEVISLQMRDPKKEKGGDNCTLRKQVIGVTESGETITLAEMVETGWSVMDCCWSLKKKSSKEGHLFELLGNRMINLFPGRKLDYEHKHCQKQRSEEDFVTAIEFSPADPYGKAIALLDLKSGVIKVKEEWFLLLGIISAFILSDALKEGYDGFTANNE*********************************************GCGGCGSGCGGGRVASVKSSGCGGCGGGGGGCGNMVNGGGCGGCGGGCGGGCGGGCGGGCAALVKSSGCGGGECGGGCGSGGCGAGCGNMVKTGGCGSGGCGAGCGNTVKTGGCGGCGGGCGGNLVAKSASEYKVGNACNE****************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSKTLGKVLEHDDMDQDRTKGKKLDTGFSGTTKQWEETFGSRYPKAGAMYRGTAPSPLTTIPFSSDIVSKEVVSSKECQKIINIPDLKIVEVFVEIVAVKNLPEDHKDKGDLFVFFSKSQPDIFFNAKQKLTILSKSGMKQVASFQCEATGELLFELVSHSTSKIPMTGASKTMGTASLSLQNFISPISKLAVEQWFDLVPRSGNVSSKPISLRIAVSFTIPTLAPHLLRMVRSRPLSKSSCFFPLPGRIQPAKSWTRVIDETQSEVISLQMRDPKKEKGGDNCTLRKQVIGVTESGETITLAEMVETGWSVMDCCWSLKKKSSKEGHLFELLGNRMINLFPGRKLDYEHKHCQKQRSEEDFVTAIEFSPADPYGKAIALLDLKSGVIKVKEEWFLLLGIISAFILSDALKEGYDGFTAxxxxxxxxxxxxxxxxxxxxxGICTKMIPPVGDEPELNKNMTNEVNSGGCGGCGSGCGGGRVASVKSSGCGGCGGGGGGCGNMVNGGGCGGCGGGCGGGCGGGCGGGCAALVKSSGCGGGECGGGCGSGGCGAGCGNMVKTGGCGSGGCGAGCGNTVKTGGCGGCGGGCGGNLVAKSASEYKVGNACNEEQSKETSVSMNETVVA

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		624
359496777		825	PREDICTED: uncharacterized protein LOC10	0.684	0.517	0.650	1e-161
296084627		648	unnamed protein product [Vitis vinifera]	0.679	0.654	0.652	1e-160
224133168		789	predicted protein [Populus trichocarpa]	0.700	0.553	0.612	1e-153
255572563		871	DNA binding protein, putative [Ricinus c	0.703	0.504	0.575	1e-141
356496614		852	PREDICTED: uncharacterized protein LOC10	0.674	0.494	0.573	1e-132
357485319		897	Glycine-rich protein [Medicago truncatul	0.665	0.462	0.575	1e-132
297821489		920	hypothetical protein ARALYDRAFT_343817 [	0.834	0.566	0.480	1e-130
356531387		827	PREDICTED: uncharacterized protein LOC10	0.674	0.509	0.565	1e-129
79322736		819	uncharacterized protein [Arabidopsis tha	0.836	0.637	0.469	1e-127
449465866		853	PREDICTED: uncharacterized protein LOC10	0.777	0.568	0.479	1e-126

>gi\|359496777\|ref\|XP_002265108.2\| PREDICTED: uncharacterized protein LOC100252003 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 283/435 (65%), Positives = 346/435 (79%), Gaps = 8/435 (1%)

Query: 3   KTLGKVLEHDDMDQDRTKGKKLDTGFSGTTKQWEETFGSRYPKAGAMYRGTAPSPLTTIP 62
           K +GKVLEHDDMD DRTKGKKLD GFS TTKQWEETFGSRY +AGAM+RG+APSPLTT P
Sbjct: 241 KLVGKVLEHDDMDSDRTKGKKLDVGFSETTKQWEETFGSRYWRAGAMHRGSAPSPLTTTP 300

Query: 63  FSSDIVSKEVVSSKECQKIINIPDLKIVEVFVEIVAVKNLPEDHKDKGDLFVFFSKSQPD 122
           +S ++++K+VV+  +CQKII +P++K+VEV +EIV VKNLP  HK  G L+V FSK+QPD
Sbjct: 301 YSPNMMTKKVVAPYDCQKIIQLPEVKVVEVLLEIVGVKNLPVGHK--GSLYVSFSKTQPD 358

Query: 123 IFFNAKQKLTILSKSGMKQVASFQCEATGELLFELVSHSTSKIP---MTGASKTMGTASL 179
             FNAK++LTI S+SG KQVASFQCE TGELLF+L+SHS S +P   ++  SK MG+ SL
Sbjct: 359 TIFNAKRRLTIFSESGEKQVASFQCEPTGELLFQLISHSPSNLPNLPISRPSKKMGSTSL 418

Query: 180 SLQNFISPISKLAVEQWFDLVPRSGNVSSKPISLRIAVSFTIPTLAPHLLRMVRSRPLSK 239
           SL+ F+SPIS+L+VE+W +LVP SGNVS+KPI LRIA+SFT+P LAP +   V SRP  +
Sbjct: 419 SLREFLSPISRLSVEKWLELVPSSGNVSAKPICLRIAISFTVPALAPRIFHTVCSRPFLR 478

Query: 240 SSCFFPLPGRIQPAKSWTRVIDETQSEVISLQMRDPKKEKGGDNCTLRKQVIGVTESGET 299
           SSCFFPLPGRIQ AK WTRVIDE  SEVISLQMRD KK    D    R++VIGVT S ET
Sbjct: 479 SSCFFPLPGRIQHAKRWTRVIDEAGSEVISLQMRDSKKGTARDTSVSRREVIGVTTSLET 538

Query: 300 ITLAEMVETGWSVMDCCWSLK--KKSSKEGHLFELLGNRMINLFPGRKLDYEHKHCQKQR 357
           ITLAE V TGWS+MD  W LK  KKS K+GHLFEL+GNRM+ ++PGRKL++EHKHC++Q+
Sbjct: 539 ITLAEFVGTGWSLMDYNWCLKFEKKSGKDGHLFELVGNRMVKIYPGRKLEFEHKHCERQK 598

Query: 358 SEEDFVTAIEFSPADPYGKAIALLDLKSGVIKVKEEWFLLLGIISAFILSDAL-KEGYDG 416
           S+  F+TA+EFS   PYG+A+ALLDLKSG +KV EEW +L GII  FILSD L KEG D 
Sbjct: 599 SDHGFLTAVEFSAEVPYGRAVALLDLKSGFLKVNEEWLVLPGIILVFILSDILRKEGCDS 658

Query: 417 FTANNEVMKEMKSAS 431
           FT +   +KE ++ S
Sbjct: 659 FTVSEGNLKETENLS 673

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|296084627\|emb\|CBI25715.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224133168\|ref\|XP_002321500.1\| predicted protein [Populus trichocarpa] gi\|222868496\|gb\|EEF05627.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255572563\|ref\|XP_002527215.1\| DNA binding protein, putative [Ricinus communis] gi\|223533391\|gb\|EEF35141.1\| DNA binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356496614\|ref\|XP_003517161.1\| PREDICTED: uncharacterized protein LOC100810300 [Glycine max]	Back alignment and taxonomy information

>gi\|357485319\|ref\|XP_003612947.1\| Glycine-rich protein [Medicago truncatula] gi\|163889366\|gb\|ABY48136.1\| glycine-rich protein [Medicago truncatula] gi\|355514282\|gb\|AES95905.1\| Glycine-rich protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|297821489\|ref\|XP_002878627.1\| hypothetical protein ARALYDRAFT_343817 [Arabidopsis lyrata subsp. lyrata] gi\|297324466\|gb\|EFH54886.1\| hypothetical protein ARALYDRAFT_343817 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356531387\|ref\|XP_003534259.1\| PREDICTED: uncharacterized protein LOC100782361 [Glycine max]	Back alignment and taxonomy information

>gi\|79322736\|ref\|NP_001031396.1\| uncharacterized protein [Arabidopsis thaliana] gi\|4314363\|gb\|AAD15574.1\| unknown protein [Arabidopsis thaliana] gi\|330252241\|gb\|AEC07335.1\| uncharacterized protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|449465866\|ref\|XP_004150648.1\| PREDICTED: uncharacterized protein LOC101219844 [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		624
TAIR\|locus:2065983		819	AT2G22660 "AT2G22660" [Arabido	0.676	0.515	0.531	2.7e-116
TAIR\|locus:2121013		787	AT4G37900 [Arabidopsis thalian	0.679	0.538	0.523	7.3e-114

TAIR\|locus:2065983 AT2G22660 "AT2G22660" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1146 (408.5 bits), Expect = 2.7e-116, P = 2.7e-116
 Identities = 229/431 (53%), Positives = 311/431 (72%)

Query:     1 MSKTLGKVLEHDDMDQDRTKGKKLDTGFSGTTKQWEETFGSRYPKAGAMYRGTAPSPLTT 60
             M K +GKVLEHDD D DR KGKKLDTGFS TT QWEETFG+RY KAGAM+RG  P P+T 
Sbjct:   242 MVKLIGKVLEHDDTDSDRGKGKKLDTGFSKTTAQWEETFGTRYWKAGAMHRGKTPVPVTN 301

Query:    61 IPFSSDIVSKEVVSSKECQKIINIPDLKIVEVFVEIVAVKNLPEDHKDKGDLFVFFSKSQ 120
              P++SD++ K+  +  + Q +I  P++++VEV +EI+ V+NLP+ HK  G + V FSK+Q
Sbjct:   302 SPYASDVLVKDPTAKDDFQNLIQFPEVEVVEVLLEIIGVRNLPDGHK--GKVSVMFSKTQ 359

Query:   121 PDIFFNAKQKLTILSKSGMKQVASFQCEATGELLFELVSHSTSKIPMTGASKTMGTASLS 180
             PD  FNA+++LTILS+ G KQVA+FQCE TGEL+F+L+S S SKIP++   K +G ASLS
Sbjct:   360 PDSLFNAERRLTILSEVGEKQVATFQCEPTGELVFKLISCSPSKIPVSREPKNLGFASLS 419

Query:   181 LQNFISP-ISKLAVEQWFDLVPRSGN-VSSKPISLRIAVSFTIPTLAPHLLRMVRSRPLS 238
             L+ F+ P I++L+VE+W +L P  G+   +KPISLR+AVSFT P  +P +L MV+SRP  
Sbjct:   420 LKEFLFPVITQLSVEKWLELTPSKGSQTDTKPISLRVAVSFTPPVRSPSVLHMVQSRPSC 479

Query:   239 KSSCFFPLPGRIQPAKSWTRVIDETQSEVISLQMRDPKKEKGGDNCTLRKQVIGVTESGE 298
             K SCFFP+ G+ + AKS T ++DETQ+EVI+LQ+R+     GG     ++QV+GVT+SGE
Sbjct:   480 KGSCFFPIIGKSRLAKSSTHIVDETQTEVITLQIRN--SADGGILKDDQRQVMGVTDSGE 537

Query:   299 TITLAEMVETGWSVMDCCWSLKK--KSSKEGHLFELLGNRMINLFPGRKLDYEHKHCQKQ 356
             T  LA    + WS++D  WSLK+   S+ +  LFE+LG R++ +F GRKLDYE KHC   
Sbjct:   538 TRVLAVYTGSFWSLLDSKWSLKQINASTADNPLFEILGPRVVKIFSGRKLDYEPKHCANL 597

Query:   357 RSEEDFVTAIEFSPADPYGKAIALLDLKSGVIKVKEEWFLLLGIISAFILSDALKEG-YD 415
             RS+ DF+T +EFS   PYGK + L+D++ G I+ KE W LL GI+SAFIL   LK+G  +
Sbjct:   598 RSDLDFMTLVEFSKQHPYGKTVGLVDMRFGSIEAKENWLLLPGIVSAFILHTVLKKGGSE 657

Query:   416 GFTANNEVMKE 426
             GF    + +KE
Sbjct:   658 GFNVTTKDIKE 668

GO:0003674 "molecular_function" evidence=ND

GO:0005634 "nucleus" evidence=ISM

GO:0005737 "cytoplasm" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0005886 "plasma membrane" evidence=IDA

TAIR\|locus:2121013 AT4G37900 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		624
COG4278		269	COG4278, COG4278, Uncharacterized conserved protei	8e-07
pfam01723		176	pfam01723, Chorion_1, Chorion protein	2e-06
pfam12810		248	pfam12810, Gly_rich, Glycine rich protein	4e-06
pfam01723		176	pfam01723, Chorion_1, Chorion protein	1e-05
PTZ00146		293	PTZ00146, PTZ00146, fibrillarin; Provisional	2e-05
COG4278		269	COG4278, COG4278, Uncharacterized conserved protei	4e-05
pfam12810		248	pfam12810, Gly_rich, Glycine rich protein	4e-05
pfam01723		176	pfam01723, Chorion_1, Chorion protein	7e-05
COG4278		269	COG4278, COG4278, Uncharacterized conserved protei	1e-04
pfam11759		61	pfam11759, KRTAP, Keratin-associated matrix	1e-04
PRK06958		182	PRK06958, PRK06958, single-stranded DNA-binding pr	1e-04
COG4278		269	COG4278, COG4278, Uncharacterized conserved protei	2e-04
PTZ00146		293	PTZ00146, PTZ00146, fibrillarin; Provisional	2e-04
PRK06958		182	PRK06958, PRK06958, single-stranded DNA-binding pr	2e-04
pfam12785		428	pfam12785, VESA1_N, Variant erythrocyte surface an	2e-04
pfam01723		176	pfam01723, Chorion_1, Chorion protein	4e-04
PHA00370		297	PHA00370, III, attachment protein	4e-04
pfam11759		61	pfam11759, KRTAP, Keratin-associated matrix	5e-04
COG4278		269	COG4278, COG4278, Uncharacterized conserved protei	6e-04
pfam05268		261	pfam05268, GP38, Phage tail fibre adhesin Gp38	7e-04
PHA00370		297	PHA00370, III, attachment protein	8e-04
PRK06958		182	PRK06958, PRK06958, single-stranded DNA-binding pr	0.002
pfam07172		91	pfam07172, GRP, Glycine rich protein family	0.002
TIGR03601		79	TIGR03601, B_an_ocin, probable heterocycle-contain	0.004
TIGR03601		79	TIGR03601, B_an_ocin, probable heterocycle-contain	0.004

>gnl\|CDD\|226728 COG4278, COG4278, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

 Score = 50.7 bits (121), Expect = 8e-07
 Identities = 24/64 (37%), Positives = 25/64 (39%), Gaps = 12/64 (18%)

Query: 470 GGCGSGCGGGRVASVKSSGCGGCGGGGGGCGNMVN---GGGCGGCGGGCGGGCGGGCGGG 526
               SGCG        S G    G   G  G+M     GG  GG G  CGGGCGG  G  
Sbjct: 215 KKWMSGCG--------SYGGKNFGSPSG-VGDMYFHGCGGHTGGDGSFCGGGCGGFGGDP 265

Query: 527 CAAL 530
              L
Sbjct: 266 LGEL 269

Length = 269

>gnl\|CDD\|216663 pfam01723, Chorion_1, Chorion protein	Back alignment and domain information

>gnl\|CDD\|221784 pfam12810, Gly_rich, Glycine rich protein	Back alignment and domain information

>gnl\|CDD\|216663 pfam01723, Chorion_1, Chorion protein	Back alignment and domain information

>gnl\|CDD\|240291 PTZ00146, PTZ00146, fibrillarin; Provisional	Back alignment and domain information

>gnl\|CDD\|226728 COG4278, COG4278, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|221784 pfam12810, Gly_rich, Glycine rich protein	Back alignment and domain information

>gnl\|CDD\|216663 pfam01723, Chorion_1, Chorion protein	Back alignment and domain information

>gnl\|CDD\|226728 COG4278, COG4278, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|221210 pfam11759, KRTAP, Keratin-associated matrix	Back alignment and domain information

>gnl\|CDD\|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|226728 COG4278, COG4278, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|240291 PTZ00146, PTZ00146, fibrillarin; Provisional	Back alignment and domain information

>gnl\|CDD\|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|221770 pfam12785, VESA1_N, Variant erythrocyte surface antigen-1	Back alignment and domain information

>gnl\|CDD\|216663 pfam01723, Chorion_1, Chorion protein	Back alignment and domain information

>gnl\|CDD\|164795 PHA00370, III, attachment protein	Back alignment and domain information

>gnl\|CDD\|221210 pfam11759, KRTAP, Keratin-associated matrix	Back alignment and domain information

>gnl\|CDD\|226728 COG4278, COG4278, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|147458 pfam05268, GP38, Phage tail fibre adhesin Gp38	Back alignment and domain information

>gnl\|CDD\|164795 PHA00370, III, attachment protein	Back alignment and domain information

>gnl\|CDD\|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|219320 pfam07172, GRP, Glycine rich protein family	Back alignment and domain information

>gnl\|CDD\|234276 TIGR03601, B_an_ocin, probable heterocycle-containing bacteriocin, BA_2677 family	Back alignment and domain information

>gnl\|CDD\|234276 TIGR03601, B_an_ocin, probable heterocycle-containing bacteriocin, BA_2677 family	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		624
cd08678		126	C2_C21orf25-like C2 domain found in the Human chro	98.25
cd04042		121	C2A_MCTP_PRT C2 domain first repeat found in Multi	98.24
cd04013		146	C2_SynGAP_like C2 domain present in Ras GTPase act	98.02
cd08400		126	C2_Ras_p21A1 C2 domain present in RAS p21 protein	98.0
cd04015		158	C2_plant_PLD C2 domain present in plant phospholip	97.84
cd08682		126	C2_Rab11-FIP_classI C2 domain found in Rab11-famil	97.72
cd04019		150	C2C_MCTP_PRT_plant C2 domain third repeat found in	97.72
PRK10737		196	FKBP-type peptidyl-prolyl cis-trans isomerase; Pro	97.7
cd04016		121	C2_Tollip C2 domain present in Toll-interacting pr	97.69
cd04043		126	C2_Munc13_fungal C2 domain in Munc13 (mammalian un	97.67
cd04050		105	C2B_Synaptotagmin-like C2 domain second repeat pre	97.63
cd08681		118	C2_fungal_Inn1p-like C2 domain found in fungal Ing	97.59
cd08373		127	C2A_Ferlin C2 domain first repeat in Ferlin. Ferli	97.56
cd04033		133	C2_NEDD4_NEDD4L C2 domain present in the Human neu	97.49
cd08376		116	C2B_MCTP_PRT C2 domain second repeat found in Mult	97.47
cd08382		123	C2_Smurf-like C2 domain present in Smad ubiquitina	97.42
TIGR03601		79	B_an_ocin probable heterocycle-containing bacterio	97.4
cd08688		110	C2_KIAA0528-like C2 domain found in the Human KIAA	97.39
cd04022		127	C2A_MCTP_PRT_plant C2 domain first repeat found in	97.34
TIGR03601		79	B_an_ocin probable heterocycle-containing bacterio	97.33
COG1047		174	SlpA FKBP-type peptidyl-prolyl cis-trans isomerase	97.33
cd08378		121	C2B_MCTP_PRT_plant C2 domain second repeat found i	97.32
cd08379		126	C2D_MCTP_PRT_plant C2 domain fourth repeat found i	97.28
cd08385		124	C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe	97.26
cd04014		132	C2_PKC_epsilon C2 domain in Protein Kinase C (PKC)	97.26
cd04036		119	C2_cPLA2 C2 domain present in cytosolic PhosphoLip	97.25
cd04024		128	C2A_Synaptotagmin-like C2 domain first repeat pres	97.25
cd04044		124	C2A_Tricalbin-like C2 domain first repeat present	97.24
cd08387		124	C2A_Synaptotagmin-8 C2A domain first repeat presen	97.17
cd08388		128	C2A_Synaptotagmin-4-11 C2A domain first repeat pre	97.16
cd04045		120	C2C_Tricalbin-like C2 domain third repeat present	97.14
cd08394		127	C2A_Munc13 C2 domain first repeat in Munc13 (mamma	97.12
cd04011		111	C2B_Ferlin C2 domain second repeat in Ferlin. Ferl	97.09
cd08390		123	C2A_Synaptotagmin-15-17 C2A domain first repeat pr	97.07
cd08391		121	C2A_C2C_Synaptotagmin_like C2 domain first and thi	97.06
cd04051		125	C2_SRC2_like C2 domain present in Soybean genes Re	97.06
cd04030		127	C2C_KIAA1228 C2 domain third repeat present in unc	97.03
cd08386		125	C2A_Synaptotagmin-7 C2A domain first repeat presen	97.0
cd04021		125	C2_E3_ubiquitin_ligase C2 domain present in E3 ubi	96.97
cd04029		125	C2A_SLP-4_5 C2 domain first repeat present in Syna	96.97
cd04031		125	C2A_RIM1alpha C2 domain first repeat contained in	96.96
cd08383		117	C2A_RasGAP C2 domain (first repeat) of Ras GTPase	96.91
cd04040		115	C2D_Tricalbin-like C2 domain fourth repeat present	96.9
cd08675		137	C2B_RasGAP C2 domain second repeat of Ras GTPase a	96.87
cd04049		124	C2_putative_Elicitor-responsive_gene C2 domain pre	96.86
cd04041		111	C2A_fungal C2 domain first repeat; fungal group. C	96.84
cd08389		124	C2A_Synaptotagmin-14_16 C2A domain first repeat pr	96.81
cd08409		137	C2B_Synaptotagmin-15 C2 domain second repeat prese	96.71
cd04025		123	C2B_RasA1_RasA4 C2 domain second repeat present in	96.69
cd08685		119	C2_RGS-like C2 domain of the Regulator Of G-Protei	96.68
cd08393		125	C2A_SLP-1_2 C2 domain first repeat present in Syna	96.68
cd08377		119	C2C_MCTP_PRT C2 domain third repeat found in Multi	96.67
cd04054		121	C2A_Rasal1_RasA4 C2 domain first repeat present in	96.66
cd04026		131	C2_PKC_alpha_gamma C2 domain in Protein Kinase C (	96.62
cd04046		126	C2_Calpain C2 domain present in Calpain proteins.	96.6
cd00030		102	C2 C2 domain. The C2 domain was first identified i	96.57
cd04010		148	C2B_RasA3 C2 domain second repeat present in RAS p	96.54
cd04017		135	C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl	96.5
cd00276		134	C2B_Synaptotagmin C2 domain second repeat present	96.47
cd08381		122	C2B_PI3K_class_II C2 domain second repeat present	96.44
cd08392		128	C2A_SLP-3 C2 domain first repeat present in Synapt	96.42
cd08521		123	C2A_SLP C2 domain first repeat present in Synaptot	96.41
PRK15095		156	FKBP-type peptidyl-prolyl cis-trans isomerase; Pro	96.41
cd08375		136	C2_Intersectin C2 domain present in Intersectin. A	96.37
cd04047		110	C2B_Copine C2 domain second repeat in Copine. Ther	96.31
cd00275		128	C2_PLC_like C2 domain present in Phosphoinositide-	96.28
cd04052		111	C2B_Tricalbin-like C2 domain second repeat present	96.23
PLN03008		868	Phospholipase D delta	96.21
cd08408		138	C2B_Synaptotagmin-14_16 C2 domain second repeat pr	96.18
cd04027		127	C2B_Munc13 C2 domain second repeat in Munc13 (mamm	96.16
cd04035		123	C2A_Rabphilin_Doc2 C2 domain first repeat present	96.13
cd08402		136	C2B_Synaptotagmin-1 C2 domain second repeat presen	96.12
PLN02270		808	phospholipase D alpha	96.05
smart00239		101	C2 Protein kinase C conserved region 2 (CalB). Ca2	95.85
cd08395		120	C2C_Munc13 C2 domain third repeat in Munc13 (mamma	95.78
cd08401		121	C2A_RasA2_RasA3 C2 domain first repeat present in	95.75
cd08403		134	C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe	95.71
PF00168		85	C2: C2 domain; InterPro: IPR000008 The C2 domain i	95.69
cd08676		153	C2A_Munc13-like C2 domain first repeat in Munc13 (	95.56
cd08691		137	C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li	95.48
cd08405		136	C2B_Synaptotagmin-7 C2 domain second repeat presen	95.46
cd04028		146	C2B_RIM1alpha C2 domain second repeat contained in	95.44
cd08406		136	C2B_Synaptotagmin-12 C2 domain second repeat prese	95.43
cd04020		162	C2B_SLP_1-2-3-4 C2 domain second repeat present in	95.36
cd04032		127	C2_Perforin C2 domain of Perforin. Perforin contai	95.24
cd08404		136	C2B_Synaptotagmin-4 C2 domain second repeat presen	95.15
cd04038		145	C2_ArfGAP C2 domain present in Arf GTPase Activati	95.1
cd08384		133	C2B_Rabphilin_Doc2 C2 domain second repeat present	95.08
cd08680		124	C2_Kibra C2 domain found in Human protein Kibra. K	95.02
cd04009		133	C2B_Munc13-like C2 domain second repeat in Munc13	94.94
cd04018		151	C2C_Ferlin C2 domain third repeat in Ferlin. Ferli	94.27
cd08690		155	C2_Freud-1 C2 domain found in 5' repressor element	93.92
cd04048		120	C2A_Copine C2 domain first repeat in Copine. There	93.86
cd04039		108	C2_PSD C2 domain present in Phosphatidylserine dec	93.39
cd04037		124	C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli	93.07
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	92.84
cd08407		138	C2B_Synaptotagmin-13 C2 domain second repeat prese	92.34
cd08410		135	C2B_Synaptotagmin-17 C2 domain second repeat prese	92.09
cd08677		118	C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a	92.0
COG4278		269	Uncharacterized conserved protein [Function unknow	91.96
PF10358		143	NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins;	91.62
PLN02352		758	phospholipase D epsilon	90.25
COG4278		269	Uncharacterized conserved protein [Function unknow	89.15
cd08692		135	C2B_Tac2-N C2 domain second repeat found in Tac2-N	83.17
KOG2059		800	consensus Ras GTPase-activating protein [Signal tr	82.96

>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein	Back alignment and domain information

Probab=98.25  E-value=2e-05  Score=70.93  Aligned_cols=125  Identities=19%  Similarity=0.254  Sum_probs=90.3

Q ss_pred             EEEEEEeecCcCCCcCCCCceEEEEEccCCceeeccCcceEeeecCCceeEEEEEee-ccCcEEEEEEeeCCCccccCCC
Q 006945           92 VFVEIVAVKNLPEDHKDKGDLFVFFSKSQPDIFFNAKQKLTILSKSGMKQVASFQCE-ATGELLFELVSHSTSKIPMTGA  170 (624)
Q Consensus        92 V~leIv~~knlp~~~k~~~~lFVrl~k~q~d~~~k~~~~l~i~Se~~wkq~~~fqCE-~TgeLvlELr~~~~~~L~~~r~  170 (624)
                      +.|.|++++|||. .....+-||.+...++....+. +-..-..++.|.+...|... ....|.|++.-+..     +.+
T Consensus         1 l~v~v~~A~~L~~-~~g~~dpyv~v~~~~~~~~~kT-~v~~~t~nP~Wne~f~f~~~~~~~~l~~~v~d~~~-----~~~   73 (126)
T cd08678           1 LLVKNIKANGLSE-AAGSSNPYCVLEMDEPPQKYQS-STQKNTSNPFWDEHFLFELSPNSKELLFEVYDNGK-----KSD   73 (126)
T ss_pred             CEEEEEEecCCCC-CCCCcCCEEEEEECCCCcEEEe-EEEecCCCCccCceEEEEeCCCCCEEEEEEEECCC-----CCC
Confidence            3578999999998 4445788888876532221222 22223357899988888776 37789999887766     357


Q ss_pred             cccccceeeecccccCCCCcceEeEEEEeecCCCCCCCCCeeEEEEEeeecCCccc
Q 006945          171 SKTMGTASLSLQNFISPISKLAVEQWFDLVPRSGNVSSKPISLRIAVSFTIPTLAP  226 (624)
Q Consensus       171 sKllG~~sisw~dLL~~~s~LS~Ekw~eL~~~~g~~ss~pisLRVa~SiTPPvqAP  226 (624)
                      .++||.+.|++++|+.. +  ..+.||+|+++........=+|+|.+.+++|-.||
T Consensus        74 ~~~lG~~~i~l~~l~~~-~--~~~~~~~L~~~~~~~~~~~G~l~l~~~~~~~~~~~  126 (126)
T cd08678          74 SKFLGLAIVPFDELRKN-P--SGRQIFPLQGRPYEGDSVSGSITVEFLFMEPAELP  126 (126)
T ss_pred             CceEEEEEEeHHHhccC-C--ceeEEEEecCCCCCCCCcceEEEEEEEEeccccCC
Confidence            89999999999999965 2  24789999987543333455999999999998765

The members in this cd are named after the Human C21orf25 which contains a single C2 domain. Several other members contain a C1 domain downstream of the C2 domain. No other information on this protein is currently known. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a

>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP)	Back alignment and domain information

>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family	Back alignment and domain information

>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1)	Back alignment and domain information

>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD)	Back alignment and domain information

>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I	Back alignment and domain information

>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional	Back alignment and domain information

>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip)	Back alignment and domain information

>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group	Back alignment and domain information

>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins	Back alignment and domain information

>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins	Back alignment and domain information

>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin	Back alignment and domain information

>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42)	Back alignment and domain information

>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP)	Back alignment and domain information

>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins	Back alignment and domain information

>TIGR03601 B_an_ocin probable heterocycle-containing bacteriocin, BA_2677 family	Back alignment and domain information

>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone	Back alignment and domain information

>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>TIGR03601 B_an_ocin probable heterocycle-containing bacteriocin, BA_2677 family	Back alignment and domain information

>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10	Back alignment and domain information

>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon	Back alignment and domain information

>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2)	Back alignment and domain information

>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins	Back alignment and domain information

>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins	Back alignment and domain information

>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8	Back alignment and domain information

>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11	Back alignment and domain information

>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins	Back alignment and domain information

>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins	Back alignment and domain information

>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin	Back alignment and domain information

>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17	Back alignment and domain information

>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins	Back alignment and domain information

>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins	Back alignment and domain information

>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins	Back alignment and domain information

>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7	Back alignment and domain information

>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase	Back alignment and domain information

>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5	Back alignment and domain information

>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins	Back alignment and domain information

>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs)	Back alignment and domain information

>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins	Back alignment and domain information

>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs)	Back alignment and domain information

>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene	Back alignment and domain information

>cd04041 C2A_fungal C2 domain first repeat; fungal group	Back alignment and domain information

>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16	Back alignment and domain information

>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15	Back alignment and domain information

>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4	Back alignment and domain information

>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family	Back alignment and domain information

>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2	Back alignment and domain information

>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP)	Back alignment and domain information

>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4	Back alignment and domain information

>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma	Back alignment and domain information

>cd04046 C2_Calpain C2 domain present in Calpain proteins	Back alignment and domain information

>cd00030 C2 C2 domain	Back alignment and domain information

>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3)	Back alignment and domain information

>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin	Back alignment and domain information

>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin	Back alignment and domain information

>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3	Back alignment and domain information

>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins	Back alignment and domain information

>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional	Back alignment and domain information

>cd08375 C2_Intersectin C2 domain present in Intersectin	Back alignment and domain information

>cd04047 C2B_Copine C2 domain second repeat in Copine	Back alignment and domain information

>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC)	Back alignment and domain information

>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins	Back alignment and domain information

>PLN03008 Phospholipase D delta	Back alignment and domain information

>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16	Back alignment and domain information

>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins	Back alignment and domain information

>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain	Back alignment and domain information

>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1	Back alignment and domain information

>PLN02270 phospholipase D alpha	Back alignment and domain information

>smart00239 C2 Protein kinase C conserved region 2 (CalB)	Back alignment and domain information

>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins	Back alignment and domain information

>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3	Back alignment and domain information

>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10	Back alignment and domain information

>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking	Back alignment and domain information

>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins	Back alignment and domain information

>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1)	Back alignment and domain information

>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7	Back alignment and domain information

>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins	Back alignment and domain information

>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12	Back alignment and domain information

>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4	Back alignment and domain information

>cd04032 C2_Perforin C2 domain of Perforin	Back alignment and domain information

>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4	Back alignment and domain information

>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP)	Back alignment and domain information

>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain	Back alignment and domain information

>cd08680 C2_Kibra C2 domain found in Human protein Kibra	Back alignment and domain information

>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins	Back alignment and domain information

>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin	Back alignment and domain information

>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1)	Back alignment and domain information

>cd04048 C2A_Copine C2 domain first repeat in Copine	Back alignment and domain information

>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD)	Back alignment and domain information

>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin	Back alignment and domain information

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13	Back alignment and domain information

>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17	Back alignment and domain information

>cd08677 C2A_Synaptotagmin-13 C2 domain	Back alignment and domain information

>COG4278 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen []	Back alignment and domain information

>PLN02352 phospholipase D epsilon	Back alignment and domain information

>COG4278 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus)	Back alignment and domain information

>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		624
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-18
2kfw_A		196	FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD	4e-06
2kfw_A		196	FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD	1e-05
2kfw_A		196	FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD	2e-04
2kfw_A		196	FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD	7e-04
2kfw_A		196	FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD	8e-04
2uvo_A		171	Agglutinin isolectin 1; carbohydrate-binding prote	1e-05
2uvo_A		171	Agglutinin isolectin 1; carbohydrate-binding prote	2e-04
2uvo_A		171	Agglutinin isolectin 1; carbohydrate-binding prote	5e-04
2uvo_A		171	Agglutinin isolectin 1; carbohydrate-binding prote	9e-04
3i08_A		220	Neurogenic locus notch homolog protein 1; SEA doma	9e-05

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 88.0 bits (217), Expect = 4e-18
 Identities = 73/484 (15%), Positives = 147/484 (30%), Gaps = 137/484 (28%)

Query: 62  PFSSDI-------VSKEVVSSKECQKIINIPDL----------------KIVEVFVEIVA 98
            F  +        + K ++S +E   II   D                 ++V+ FVE V 
Sbjct: 28  AFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVL 87

Query: 99  VKNLP-------EDHKDKGDLFVFFSKSQPDIFFNAKQKLTILSKSGMKQVASFQCEATG 151
             N          + +    +   +   Q D  +N  Q     + S ++     +     
Sbjct: 88  RINYKFLMSPIKTEQRQPSMMTRMYI-EQRDRLYNDNQVFAKYNVSRLQPYLKLR----- 141

Query: 152 ELLFELVSHSTSKIP---MTGASKTMGTASLSLQNFISPISKLAVEQ-------WFDLVP 201
           + L EL       +    + G+ KT   A     ++        V+        W +L  
Sbjct: 142 QALLELRPA--KNVLIDGVLGSGKTW-VALDVCLSY-------KVQCKMDFKIFWLNL-- 189

Query: 202 RSGNVSSKPISLRIAVSFTIPTLAPHLLRMVRSRPLSKSSCFFPLPGRIQPAKSWTRVID 261
              N +S    L +            LL  +     S+S     +  RI   ++  R + 
Sbjct: 190 --KNCNSPETVLEMLQK---------LLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLL 238

Query: 262 ETQSEVISL----QMRDPKKEKGGD-NC-TLRKQVIGVTESGETIT--LAEMVETGWSVM 313
           +++     L     +++ K     + +C  L      +T   + +T  L+    T  S+ 
Sbjct: 239 KSKPYENCLLVLLNVQNAKAWNAFNLSCKIL------LTTRFKQVTDFLSAATTTHISLD 292

Query: 314 DCCWSLKKKSSKEGHLFEL-LGNRM--------------INLFPGRKLDYEHKHCQ--KQ 356
               +L     K   L    L  R               +++     +          K 
Sbjct: 293 HHSMTLTPDEVKS--LLLKYLDCRPQDLPREVLTTNPRRLSII-AESIRDGLATWDNWKH 349

Query: 357 RSEEDFVTAIEFSPADPYGKAIALLDLKSGVIKVKEEWFLLLGI------ISAFILS--- 407
            + +   T IE S          L  L+    +   + F  L +      I   +LS   
Sbjct: 350 VNCDKLTTIIESS----------LNVLEPAEYR---KMFDRLSVFPPSAHIPTILLSLIW 396

Query: 408 DALKEGYDGFTANNEVMKEMKSASDSVEGLQEEGICT------KMIPPVGDEPELNKNMT 461
             + +  D       V+ ++   S  VE   +E   +      ++   + +E  L++++ 
Sbjct: 397 FDVIK-SD----VMVVVNKLHKYS-LVEKQPKESTISIPSIYLELKVKLENEYALHRSIV 450

Query: 462 NEVN 465
           +  N
Sbjct: 451 DHYN 454

PyMOL of 1vt4

>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196	Back alignment and structure

>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196	Back alignment and structure

>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196	Back alignment and structure

>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196	Back alignment and structure

>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196	Back alignment and structure

>2uvo_A Agglutinin isolectin 1; carbohydrate-binding protein, hevein domain, chitin-binding, GERM agglutinin, chitin-binding protein; HET: NDG NAG GOL; 1.40A {Triticum aestivum} PDB: 1wgc_A* 2cwg_A* 2uwg_A* 2x3t_A* 4aml_A* 7wga_A 9wga_A 2wgc_A 1wgt_A 1k7t_A* 1k7v_A* 1k7u_A 2uwz_A* 2x52_A* 1t0w_A* Length = 171	Back alignment and structure

>2uvo_A Agglutinin isolectin 1; carbohydrate-binding protein, hevein domain, chitin-binding, GERM agglutinin, chitin-binding protein; HET: NDG NAG GOL; 1.40A {Triticum aestivum} PDB: 1wgc_A* 2cwg_A* 2uwg_A* 2x3t_A* 4aml_A* 7wga_A 9wga_A 2wgc_A 1wgt_A 1k7t_A* 1k7v_A* 1k7u_A 2uwz_A* 2x52_A* 1t0w_A* Length = 171	Back alignment and structure

>2uvo_A Agglutinin isolectin 1; carbohydrate-binding protein, hevein domain, chitin-binding, GERM agglutinin, chitin-binding protein; HET: NDG NAG GOL; 1.40A {Triticum aestivum} PDB: 1wgc_A* 2cwg_A* 2uwg_A* 2x3t_A* 4aml_A* 7wga_A 9wga_A 2wgc_A 1wgt_A 1k7t_A* 1k7v_A* 1k7u_A 2uwz_A* 2x52_A* 1t0w_A* Length = 171	Back alignment and structure

>2uvo_A Agglutinin isolectin 1; carbohydrate-binding protein, hevein domain, chitin-binding, GERM agglutinin, chitin-binding protein; HET: NDG NAG GOL; 1.40A {Triticum aestivum} PDB: 1wgc_A* 2cwg_A* 2uwg_A* 2x3t_A* 4aml_A* 7wga_A 9wga_A 2wgc_A 1wgt_A 1k7t_A* 1k7v_A* 1k7u_A 2uwz_A* 2x52_A* 1t0w_A* Length = 171	Back alignment and structure

>3i08_A Neurogenic locus notch homolog protein 1; SEA domain, LIN-12 notch repeat, LNR, heterodimerization domain, HD, activator, ANK repeat, calcium; 3.20A {Homo sapiens} Length = 220	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		624
3b7y_A		153	E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-	98.11
2dmh_A		140	Myoferlin; beta-sandwich, FER-1-like protein 3, mu	98.03
3kwu_A		148	MUNC13-1; calcium binding protein, phospholipid bi	97.83
3m7f_B		176	E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1	97.76
2ep6_A		133	MCTP2 protein; beta sandwich, Ca2+ binding, membra	97.71
3f04_A		143	Synaptotagmin-1; C2A, calcium, cell junction, cyto	97.7
1rlw_A		126	Phospholipase A2, CALB domain; hydrolase, C2 domai	97.7
1wfj_A		136	Putative elicitor-responsive gene; C2 domain, rike	97.67
2d8k_A		141	Synaptotagmin VII; exocytosis, calcium binding, ly	97.63
1gmi_A		136	Protein kinase C, epsilon type; PKC, C2 domain, X-	97.61
1v27_A		141	Regulating synaptic membrane exocytosis protein 2;	97.58
3pyc_A		132	E3 ubiquitin-protein ligase smurf1; phospholipid b	97.54
2b3r_A		134	Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA	97.5
1a25_A		149	CALB, protein kinase C (beta); calcium++/phospholi	97.44
2nq3_A		173	Itchy homolog E3 ubiquitin protein ligase; C2 doma	97.43
1rsy_A		152	Synaptotagmin I; calcium/phospholipid binding prot	97.42
3fdw_A		148	Synaptotagmin-like protein 4; structural genomics,	97.38
3fbk_A		153	RGS3, RGP3, regulator of G-protein signaling 3; al	97.36
2enp_A		147	B/K protein; C2 type 1,beta sandwich, structural g	97.36
2dmg_A		142	KIAA1228 protein; beta-sandwich, structural genomi	97.35
1w15_A		153	Synaptotagmin IV; metal binding protein, endocytos	97.35
2r83_A		284	Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel	97.33
3n5a_A		138	Synaptotagmin-7; calcium/phospholipid binding prot	97.32
3rdl_A		137	Protein kinase C alpha type; protein kinase PKC, t	97.29
2bwq_A		129	Regulating synaptic membrane exocytosis protein 2;	97.24
2q3x_A		171	Regulating synaptic membrane exocytosis protein 1;	97.23
1tjx_A		159	Similar to synaptotagmini/P65; C2B domain, calcium	97.21
1ugk_A		138	Synaptotagmin IV, KIAA1342; beta sandwich, structu	97.19
2fk9_A		157	Protein kinase C, ETA type; ATP-binding, metal-bin	97.16
2cm5_A		166	Rabphilin-3A; protein transport, zinc-finger, Ca2+	97.07
1rh8_A		142	Piccolo protein; beta-sandwich, metal binding prot	97.05
2z0u_A		155	WW domain-containing protein 1; C2 domain, alterna	97.01
2kfw_A		196	FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD	96.88
2kr7_A		151	FKBP-type peptidyl-prolyl CIS-trans isomerase SLY;	96.69
2chd_A		142	Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium	96.65
4dt4_A		169	FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer;	96.64
2k8i_A		171	SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase,	96.59
1wfm_A		138	Synaptotagmin XIII; C2 domain, exocytosis, neurotr	96.52
2r83_A		284	Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel	96.15
2cjt_A		131	UNC-13 homolog A, MUNC13-1; phorbol-ester binding,	95.83
1dqv_A		296	Synaptotagmin III; beta sandwich, calcium ION, C2	95.7
3l9b_A		144	Otoferlin; C2-domain, beta-sheets, cell membrane,	95.4
2cjs_A		167	UNC-13 homolog A, MUNC13-1; neurotransmitter trans	95.4
1ix5_A		151	FKBP; ppiase, isomerase; NMR {Methanothermococcust	95.38
3pr9_A		157	FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB	95.33
3cgm_A		158	SLYD, peptidyl-prolyl CIS-trans isomerase; chapero	94.83
3prb_A		231	FKBP-type peptidyl-prolyl CIS-trans isomerase; cha	94.65
3jzy_A		510	Intersectin 2; C2 domain, structural genomics cons	94.37
1dqv_A		296	Synaptotagmin III; beta sandwich, calcium ION, C2	94.3
1cjy_A		749	CPLA2, protein (cytosolic phospholipase A2); lipid	93.25
2pbc_A		102	FK506-binding protein 2; endoplasmic reticulum, is	92.55
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	92.53
3o5q_A		128	Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506	92.42
3nsj_A		540	Perforin-1; pore forming protein, immune system; H	91.99
3o5e_A		144	Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506	91.75
2vn1_A		129	70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR	90.91
1r9h_A		135	FKB-6, FK506 binding protein family; structural ge	90.5
4dip_A		125	Peptidyl-prolyl CIS-trans isomerase FKBP14; struct	90.37
3kz7_A		119	FK506-binding protein 3; FKPB ppiase rapamycin, is	88.91
3bxj_A		483	RAS GTPase-activating protein syngap; GTPase activ	88.78
2ppn_A		107	FK506-binding protein 1A; high resolution protein	88.58
3pfq_A		674	PKC-B, PKC-beta, protein kinase C beta type; phosp	88.35
1yat_A		113	FK506 binding protein; HET: FK5; 2.50A {Saccharomy	88.32
2jwx_A		157	FKBP38NTD, FK506-binding protein 8 variant; apopto	87.98
3b7x_A		134	FK506-binding protein 6; isomerase, repeat, rotama	86.21
2lgo_A		130	FKBP; infectious disease, isomerase, giardiasis, s	86.16
2y78_A		133	Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase,	86.02
2f4e_A		180	ATFKBP42; FKBP-like, alpha-beta, signaling protein	85.64
1hxv_A		113	Trigger factor; FKBP fold, ppiase, chaperone; NMR	81.43
3uf8_A		209	Ubiquitin-like protein SMT3, peptidyl-prolyl CIS-	80.99

>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A	Back alignment and structure

Probab=98.11  E-value=4.1e-05  Score=68.45  Aligned_cols=124  Identities=19%  Similarity=0.220  Sum_probs=83.5

Q ss_pred             EEEEEEEeecCcCCCcC-CCCceEEEEEccCC-c---eeeccCcceEeeecCCceeEEEEEee-ccCcEEEEEEeeCCCc
Q 006945           91 EVFVEIVAVKNLPEDHK-DKGDLFVFFSKSQP-D---IFFNAKQKLTILSKSGMKQVASFQCE-ATGELLFELVSHSTSK  164 (624)
Q Consensus        91 EV~leIv~~knlp~~~k-~~~~lFVrl~k~q~-d---~~~k~~~~l~i~Se~~wkq~~~fqCE-~TgeLvlELr~~~~~~  164 (624)
                      .+.|.|+..+||+.... ...+-||+++...+ +   ...++ +.+.-..++.|.+...|... ....|.|+|.-++.  
T Consensus        21 ~L~V~v~~a~~L~~~d~~g~~dpyv~v~~~~~~~~~~~~~kT-~v~~~t~nP~wne~f~f~v~~~~~~l~~~V~d~d~--   97 (153)
T 3b7y_A           21 IVRVRVIAGIGLAKKDILGASDPYVRVTLYDPMNGVLTSVQT-KTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENR--   97 (153)
T ss_dssp             EEEEEEEEEESCC-------CCEEEEEEEEETTTEEEEEEEC-CCCSSCSSCCCCEEEEEEECTTTCEEEEEEEECCS--
T ss_pred             EEEEEEEEeeCCCCCCCCCCCCcEEEEEEECCCCccceeeeC-ccccCCCCCCCCCEEEEEecCCCCEEEEEEEECCC--
Confidence            46788999999996532 34688998877632 2   12222 22333467899987777776 46678888887764  


Q ss_pred             cccCCCcccccceeeecccccCCCCcc--e-EeEEEEeecCCCCCCCCCeeEEEEEeeec
Q 006945          165 IPMTGASKTMGTASLSLQNFISPISKL--A-VEQWFDLVPRSGNVSSKPISLRIAVSFTI  221 (624)
Q Consensus       165 L~~~r~sKllG~~sisw~dLL~~~s~L--S-~Ekw~eL~~~~g~~ss~pisLRVa~SiTP  221 (624)
                         +.+..+||.+.|++++|.......  . ..+|++|.+.+. .....=+|+|.+++.|
T Consensus        98 ---~~~d~~iG~~~i~l~~l~~~~~~~~~~~~~~w~~L~~~~~-~~~~~G~i~l~l~~~P  153 (153)
T 3b7y_A           98 ---LTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLHPRSH-KSRVKGYLRLKMTYLP  153 (153)
T ss_dssp             ---SSCCEEEEEEEEECCSCCBCCTTSCCCCCCEEEECBCSST-TCCCCSEEEEEEEECC
T ss_pred             ---CcCCCeeEEEEEEHHHcccCCCcccccccccccccccccC-CCCcceEEEEEEEEeC
Confidence               557789999999999998764331  2 259999998652 2233358889888876

PyMOL of 3b7y

>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A*	Back alignment and structure

>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus}	Back alignment and structure

>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1	Back alignment and structure

>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A*	Back alignment and structure

>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1	Back alignment and structure

>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2	Back alignment and structure

>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1	Back alignment and structure

>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A	Back alignment and structure

>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus}	Back alignment and structure

>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2	Back alignment and structure

>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1	Back alignment and structure

>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2	Back alignment and structure

>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens}	Back alignment and structure

>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0	Back alignment and structure

>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A	Back alignment and structure

>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus}	Back alignment and structure

>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2	Back alignment and structure

>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus}	Back alignment and structure

>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A*	Back alignment and structure

>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens}	Back alignment and structure

>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A	Back alignment and structure

>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2	Back alignment and structure

>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens}	Back alignment and structure

>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli}	Back alignment and structure

>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori}	Back alignment and structure

>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A	Back alignment and structure

>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli}	Back alignment and structure

>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli}	Back alignment and structure

>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1	Back alignment and structure

>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A	Back alignment and structure

>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus}	Back alignment and structure

>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1	Back alignment and structure

>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1	Back alignment and structure

>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A	Back alignment and structure

>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A*	Back alignment and structure

>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A	Back alignment and structure

>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B	Back alignment and structure

>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A	Back alignment and structure

>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A	Back alignment and structure

>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens}	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A	Back alignment and structure

>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus}	Back alignment and structure

>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A	Back alignment and structure

>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A	Back alignment and structure

>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1	Back alignment and structure

>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens}	Back alignment and structure

>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A*	Back alignment and structure

>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus}	Back alignment and structure

>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ...	Back alignment and structure

>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A	Back alignment and structure

>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1	Back alignment and structure

>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens}	Back alignment and structure

>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia}	Back alignment and structure

>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A*	Back alignment and structure

>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana}	Back alignment and structure

>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1	Back alignment and structure

>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		624
d1gmia_		136	Domain from protein kinase C epsilon {Rat (Rattus	98.27
d1wfja_		136	C2 domain protein At1g63220 {Thale cress (Arabidop	97.93
d2cjta1		128	Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId:	97.86
d1rsya_		143	Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10	97.7
d1wfma_		138	Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9	97.65
d1rlwa_		126	Domain from cytosolic phospholipase A2 {Human (Hom	97.62
d1uowa_		157	Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10	97.54
d2ep6a1		126	Multiple C2 and transmembrane domain-containing pr	97.47
d1dqva1		130	Synaptotagmin III {Rat (Rattus norvegicus) [TaxId:	97.46
d2nq3a1		133	E3 ubiquitin-protein ligase Itchy {Human (Homo sap	97.32
d2cm5a1		137	C2b-domain of rabphilin {Rat (Rattus norvegicus) [	97.23
d1w15a_		138	Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId:	97.15
d1qasa2		131	PI-specific phospholipase C isozyme D1 (PLC-D1), C	97.12
d1a25a_		132	C2 domain from protein kinase c (beta) {Rat (Rattu	97.11
d2bwqa1		125	Regulating synaptic membrane exocytosis protein, r	97.02
d1ugka_		138	Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960	97.0
d1rh8a_		142	Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]}	96.82
d1ix5a_		151	Archaeal FKBP {Archaeon Methanococcus thermolithot	96.57
d1dqva2		145	Synaptotagmin III {Rat (Rattus norvegicus) [TaxId:	96.43
d1bdya_		123	Domain from protein kinase C delta {Rat (Rattus no	90.19
d1q1ca1		120	FKBP52, N-terminal domains {Human (Homo sapiens) [	80.05

>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Domain from protein kinase C epsilon
species: Rat (Rattus rattus) [TaxId: 10117]

Probab=98.27  E-value=4.8e-06  Score=72.66  Aligned_cols=114  Identities=8%  Similarity=0.150  Sum_probs=81.1

Q ss_pred             EEEEEEeecCcCCCc------------CCCCceEEEEEccCCceeeccCcceEeeecCCceeEEEEEeeccCcEEEEEEe
Q 006945           92 VFVEIVAVKNLPEDH------------KDKGDLFVFFSKSQPDIFFNAKQKLTILSKSGMKQVASFQCEATGELLFELVS  159 (624)
Q Consensus        92 V~leIv~~knlp~~~------------k~~~~lFVrl~k~q~d~~~k~~~~l~i~Se~~wkq~~~fqCE~TgeLvlELr~  159 (624)
                      |.|.|+..++|+...            ....+-||.++.-.. .+.+ .+...-..+|.|.+...|..+....|.|+|..
T Consensus         8 L~v~I~~A~~L~~~~~~~~~~~~~~~~~~~~DPYv~v~l~~~-~~~~-T~~~~~t~~P~Wne~f~f~v~~~~~l~i~V~d   85 (136)
T d1gmia_           8 LKIKICEAVSLKPTAWSLRDAVGPRPQTFLLDPYIALNVDDS-RIGQ-TATKQKTNSPAWHDEFVTDVCNGRKIELAVFH   85 (136)
T ss_dssp             EEEEEEEEESCCCCHHHHCC-CCSSCCCCCCCEEEEEEETTE-EEEE-CCCCSSCSSCEEEEEEEEEEEEECEEEEEEEE
T ss_pred             EEEEEEEeECCCcccccccccccccCCCCCcCcEEEEEeCCC-cCcE-eeEEcCCCCccCccEEEEEEecCCceEEEEEE
Confidence            668889999998531            123456888877421 1222 22233346789999888877777888888886


Q ss_pred             eCCCccccCCCcccccceeeecccccCCCCcceEeEEEEeecCCCCCCCCCeeEEEEEeeec
Q 006945          160 HSTSKIPMTGASKTMGTASLSLQNFISPISKLAVEQWFDLVPRSGNVSSKPISLRIAVSFTI  221 (624)
Q Consensus       160 ~~~~~L~~~r~sKllG~~sisw~dLL~~~s~LS~Ekw~eL~~~~g~~ss~pisLRVa~SiTP  221 (624)
                      ++.     +.+.++||.++|+|.+|+.. .....+.||+|.|..        .++|.+++||
T Consensus        86 ~~~-----~~~d~~iG~~~i~l~~l~~~-~~~~~~~w~~L~p~G--------~v~l~v~~~~  133 (136)
T d1gmia_          86 DAP-----IGYDDFVANCTIQFEELLQN-GSRHFEDWIDLEPEG--------KVYVIIDLSG  133 (136)
T ss_dssp             CCS-----SSSCEEEEEEEEEHHHHTST-TCSEEEEEEECBSSC--------EEEEEEEEEE
T ss_pred             ecC-----CCCceeEEEEEEEHHHhhhc-CCcceeEEEeCCCCc--------EEEEEEEEEe
Confidence            655     45778999999999999977 556689999998742        4677777775

PyMOL of d1gmia_

>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]}	Back information, alignment and structure

>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure