Citrus Sinensis ID: 007036
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 620 | 2.2.26 [Sep-21-2011] | |||||||
| Q28E61 | 798 | tRNA (cytosine(34)-C(5))- | yes | no | 0.845 | 0.656 | 0.317 | 3e-73 | |
| Q5ZLV4 | 796 | tRNA (cytosine(34)-C(5))- | yes | no | 0.759 | 0.591 | 0.315 | 3e-71 | |
| Q08J23 | 767 | tRNA (cytosine(34)-C(5))- | yes | no | 0.812 | 0.657 | 0.320 | 2e-70 | |
| Q1HFZ0 | 757 | tRNA (cytosine(34)-C(5))- | yes | no | 0.833 | 0.682 | 0.309 | 3e-70 | |
| Q4V7N2 | 698 | tRNA (cytosine(34)-C(5))- | N/A | no | 0.787 | 0.699 | 0.314 | 1e-69 | |
| O13935 | 685 | Multisite-specific tRNA:( | yes | no | 0.732 | 0.662 | 0.306 | 3e-60 | |
| Q9W4M9 | 746 | tRNA (cytosine(34)-C(5))- | yes | no | 0.590 | 0.490 | 0.316 | 5e-56 | |
| Q9HGQ2 | 688 | Multisite-specific tRNA:( | no | no | 0.751 | 0.677 | 0.290 | 3e-55 | |
| P38205 | 684 | Multisite-specific tRNA:( | yes | no | 0.346 | 0.314 | 0.401 | 2e-51 | |
| B8CPH7 | 474 | Ribosomal RNA small subun | yes | no | 0.219 | 0.286 | 0.294 | 2e-13 |
| >sp|Q28E61|NSUN2_XENTR tRNA (cytosine(34)-C(5))-methyltransferase OS=Xenopus tropicalis GN=nsun2 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 276 bits (707), Expect = 3e-73, Method: Compositional matrix adjust.
Identities = 201/633 (31%), Positives = 315/633 (49%), Gaps = 109/633 (17%)
Query: 1 MVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNM 60
VIAND+D +RC LL+HQ KR+ + ++V NH+A P N S
Sbjct: 212 FVIANDVDNKRCYLLVHQAKRLNSPCIMVVNHDASSIPRLLVENNGSREV---------- 261
Query: 61 GQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIV 120
L +DR+LCDVPCSGDGTLRK D+W+KW LH LQ++IA RG+ L GGR+V
Sbjct: 262 --LYYDRILCDVPCSGDGTLRKNIDVWKKWTTLNSLQLHGLQIRIATRGVEQLAEGGRMV 319
Query: 121 YSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDK-GIWLASH 179
YSTCS+NPVE+EAV+A +L K EGS+EL DV++E+P L PG+ +WKV K G W
Sbjct: 320 YSTCSLNPVEDEAVIASLLDKSEGSLELADVASEIPGLKWMPGITQWKVMTKEGHWYEKW 379
Query: 180 KHVRKFRRIGIVPSMFPSGSSHMDATDIEPKHGNVTDVNSDEGLQQVEDVLTSADDLEEE 239
+ + R I P+MFP PK EE+
Sbjct: 380 EDIPTSRHTQIRPTMFP------------PKD-------------------------EEK 402
Query: 240 VSDLPLERCMRLVPHDQNSGAFFIAVLQKVSPLPVVQEKHINPEEKMLPRNDDPPKKLQN 299
+ + L RCMR++PH QN+G FF+AVL K +P+P N + L R PP
Sbjct: 403 LKSMNLNRCMRILPHHQNTGGFFVAVLIKKAPMP------WNKRQPKLQRR--PP----- 449
Query: 300 QDTEEVNGMEVDLADGTDEKDPEGSLEANSIDNEDGAAVEPDPLTCEKVDSEETEV-PVN 358
V D + PE L +N G A EP VD+E E P
Sbjct: 450 ----------VSACDASIAVAPE--LVKAVTENSAGMADEP------AVDTENGETKPCT 491
Query: 359 TETKSERTG------GKRKLQIQGKWKGIDPVIFFN-DETIINSIKTFYGIDDSFQLSGQ 411
++ S +T +K+++ G + DP +F + D+ I + I+TFY +D SF
Sbjct: 492 NQSDSSKTDIVCCPPPSKKMKLFGFKE--DPFVFVSEDDPIFDPIQTFYALDPSFP-KKN 548
Query: 412 LVSRNGDTNRVKRIYYVSKSVKDALDLNFRVGQQLKITSVGLKMFERQTSREGNSAPCSF 471
L++R + + +++Y VSK +++ L N +++K+ + G+K+ R + +G C++
Sbjct: 549 LLTRTQEGKK-RQLYMVSKELRNVLLHN---SEKMKVINTGIKVLCR--NNDGEQYGCAY 602
Query: 472 RISSEGLPVILPYITKQILYASLVDFKHLLQYKTIKFADFVDAEFGEKASKLMMGCCVIV 531
R++ EG+ + P+I +I+ S+ D K LL + + F E ++A+ MG V+
Sbjct: 603 RLAQEGIYTLYPFINARIVTVSIEDIKVLLTQENPFLSKF-SKETQKQANNFDMGSIVLK 661
Query: 532 LSKGGEALSNPIQIDASTIAIGCWKGRASLSVMVTAIDCQELLERLLMRLEIEKGDLVQE 591
+ P + + G W+G+ S+ V + L + + + EK +++++
Sbjct: 662 YEPDPQ---EPETLQCPIVLCG-WRGKTSIRSFVPKNERLHYLRMMGVEVFKEKAEVLEK 717
Query: 592 -----NALGTDEVQEEMNDNGKEEPESLEVAVN 619
A + + E+M+ +G +E ES E++ N
Sbjct: 718 KPVEGKACDEEHIDEKMDIDGAKE-ESKELSGN 749
|
RNA methyltransferase that methylates tRNAs, and possibly RNA polymerase III transcripts. Methylates cytosine to 5-methylcytosine (m5C) at position 34 of intron-containing tRNA(Leu)(CAA) precursors. Xenopus tropicalis (taxid: 8364) EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 0EC: 3 |
| >sp|Q5ZLV4|NSUN2_CHICK tRNA (cytosine(34)-C(5))-methyltransferase OS=Gallus gallus GN=NSUN2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q08J23|NSUN2_HUMAN tRNA (cytosine(34)-C(5))-methyltransferase OS=Homo sapiens GN=NSUN2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q1HFZ0|NSUN2_MOUSE tRNA (cytosine(34)-C(5))-methyltransferase OS=Mus musculus GN=Nsun2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q4V7N2|NSUN2_XENLA tRNA (cytosine(34)-C(5))-methyltransferase OS=Xenopus laevis GN=nsun2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O13935|TRM4B_SCHPO Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm4b PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q9W4M9|NSUN2_DROME tRNA (cytosine(34)-C(5))-methyltransferase OS=Drosophila melanogaster GN=CG6133 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9HGQ2|TRM4A_SCHPO Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm4a PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|P38205|NCL1_YEAST Multisite-specific tRNA:(cytosine-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCL1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|B8CPH7|RSMF_SHEPW Ribosomal RNA small subunit methyltransferase F OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rsmF PE=3 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 620 | ||||||
| 255581738 | 843 | conserved hypothetical protein [Ricinus | 0.982 | 0.722 | 0.697 | 0.0 | |
| 147811154 | 906 | hypothetical protein VITISV_039256 [Viti | 0.979 | 0.669 | 0.671 | 0.0 | |
| 297741823 | 837 | unnamed protein product [Vitis vinifera] | 0.979 | 0.725 | 0.671 | 0.0 | |
| 359480502 | 834 | PREDICTED: tRNA (cytosine(34)-C(5))-meth | 0.974 | 0.724 | 0.670 | 0.0 | |
| 224093730 | 799 | predicted protein [Populus trichocarpa] | 0.930 | 0.722 | 0.666 | 0.0 | |
| 356525455 | 820 | PREDICTED: tRNA (cytosine(34)-C(5))-meth | 0.922 | 0.697 | 0.638 | 0.0 | |
| 449451413 | 812 | PREDICTED: tRNA (cytosine(34)-C(5))-meth | 0.903 | 0.689 | 0.620 | 0.0 | |
| 449496414 | 812 | PREDICTED: tRNA (cytosine(34)-C(5))-meth | 0.903 | 0.689 | 0.618 | 0.0 | |
| 356538146 | 810 | PREDICTED: tRNA (cytosine(34)-C(5))-meth | 0.937 | 0.717 | 0.622 | 0.0 | |
| 297825119 | 838 | hypothetical protein ARALYDRAFT_320078 [ | 0.911 | 0.674 | 0.583 | 0.0 |
| >gi|255581738|ref|XP_002531671.1| conserved hypothetical protein [Ricinus communis] gi|223528702|gb|EEF30715.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 858 bits (2218), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 434/622 (69%), Positives = 506/622 (81%), Gaps = 13/622 (2%)
Query: 1 MVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNM 60
MVIANDLDVQRCNLLIHQTKRMCTANLIVTN+EAQHFPGCRANK+ + AS+ IE E +
Sbjct: 229 MVIANDLDVQRCNLLIHQTKRMCTANLIVTNNEAQHFPGCRANKSCTKASE--IEFEPPI 286
Query: 61 GQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIV 120
GQLLFDRVLCDVPCSGDGTLRKAPD+WRKWN G+GNGLH LQ+QIAMRG+SLLKVGGR+V
Sbjct: 287 GQLLFDRVLCDVPCSGDGTLRKAPDLWRKWNSGMGNGLHVLQIQIAMRGMSLLKVGGRMV 346
Query: 121 YSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDKGIWLASHK 180
YSTCSMNPVENEAVVAEILRKC GSVEL++VS+E+PQL+ RPGLRKWKVRDKGIWL+SHK
Sbjct: 347 YSTCSMNPVENEAVVAEILRKCGGSVELLNVSSELPQLVRRPGLRKWKVRDKGIWLSSHK 406
Query: 181 HVRKFRRIGIVPSMFPSGSSHMDATDIEPKHGNVTDVNSDEGLQQVEDVLTSADDLEEEV 240
V KFRR GI+PSMFPSG S++ + + KH N + S++ + +ED + S +D EEV
Sbjct: 407 DVSKFRRYGILPSMFPSGRSYVAPAESDHKHENGGNKISED--EPMEDPMAS-EDSNEEV 463
Query: 241 SDLPLERCMRLVPHDQNSGAFFIAVLQKVSPLPVVQEKHINPEEK-MLPRNDDPPKKLQN 299
SDLPLERCMR+VPHDQNSGAFFIAV K+SPLPV+ EK P + L R +P +K +
Sbjct: 464 SDLPLERCMRIVPHDQNSGAFFIAVFHKLSPLPVIPEK---PSRRGNLNRKHEPQEKSLD 520
Query: 300 QDTEEVNGMEVDLADGTDEKDPEGSLEANSIDNE-DGAAVEPDPL-TCEKVDSEETEVPV 357
QDTE NG+E+ + E+ PE + EA+ I+NE D A+EPD TC + +S + + V
Sbjct: 521 QDTEGNNGVELKSEEAAAERFPEAASEADLIENELDSTALEPDSCNTCGENESGKAQALV 580
Query: 358 NTETKSERTGGKRKLQIQGKWKGIDPVIFFNDETIINSIKTFYGIDDSFQLSGQLVSRNG 417
N ET+S GKRKLQIQGKWKG+DPV+FF DE IINSIK FYGID+SF +G L+SRN
Sbjct: 581 NGETQSSNAVGKRKLQIQGKWKGVDPVLFFKDEAIINSIKAFYGIDESFPFNGHLISRNN 640
Query: 418 DTNRVKRIYYVSKSVKDALDLNFRVGQQLKITSVGLKMFERQTSREGNSAPCSFRISSEG 477
D N VKRIYYVSKSVKD L+LN VGQQLKI SVGLKMFERQTSREG SAPCSFRISSEG
Sbjct: 641 DNNHVKRIYYVSKSVKDVLELNLLVGQQLKIASVGLKMFERQTSREGTSAPCSFRISSEG 700
Query: 478 LPVILPYITKQILYASLVDFKHLLQYKTIKFADFVDAEFGEKASKLMMGCCVIVLSKGGE 537
LPVILP+ITKQILYASLVDFKHLLQYK++K+ DFVDAEFGEKASKL+MGCCVIVL + G+
Sbjct: 701 LPVILPHITKQILYASLVDFKHLLQYKSVKYTDFVDAEFGEKASKLLMGCCVIVL-RDGK 759
Query: 538 ALSNPIQIDASTIAIGCWKGRASLSVMVTAIDCQELLERLLMRLEIEKGDLVQENALGTD 597
S+PIQ+DASTIAIGCWKGR+SLSVMVTAIDCQELLERLL R++ +G VQE+
Sbjct: 760 IFSDPIQVDASTIAIGCWKGRSSLSVMVTAIDCQELLERLLARMDTGEGSSVQESIAEAC 819
Query: 598 EVQEEMNDNGK-EEPESLEVAV 618
E Q++MN K E+ E+ E A
Sbjct: 820 EAQDDMNGIEKVEDTETTEQAT 841
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147811154|emb|CAN70164.1| hypothetical protein VITISV_039256 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297741823|emb|CBI33136.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359480502|ref|XP_002271053.2| PREDICTED: tRNA (cytosine(34)-C(5))-methyltransferase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224093730|ref|XP_002309966.1| predicted protein [Populus trichocarpa] gi|222852869|gb|EEE90416.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356525455|ref|XP_003531340.1| PREDICTED: tRNA (cytosine(34)-C(5))-methyltransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449451413|ref|XP_004143456.1| PREDICTED: tRNA (cytosine(34)-C(5))-methyltransferase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449496414|ref|XP_004160128.1| PREDICTED: tRNA (cytosine(34)-C(5))-methyltransferase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356538146|ref|XP_003537565.1| PREDICTED: tRNA (cytosine(34)-C(5))-methyltransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297825119|ref|XP_002880442.1| hypothetical protein ARALYDRAFT_320078 [Arabidopsis lyrata subsp. lyrata] gi|297326281|gb|EFH56701.1| hypothetical protein ARALYDRAFT_320078 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 620 | ||||||
| TAIR|locus:2041213 | 808 | AT2G22400 [Arabidopsis thalian | 0.888 | 0.681 | 0.605 | 2e-175 | |
| TAIR|locus:2140094 | 783 | AT4G40000 [Arabidopsis thalian | 0.543 | 0.430 | 0.531 | 6.5e-90 | |
| ZFIN|ZDB-GENE-030131-4017 | 766 | nsun2 "NOL1/NOP2/Sun domain fa | 0.301 | 0.244 | 0.475 | 2.1e-77 | |
| MGI|MGI:107252 | 757 | Nsun2 "NOL1/NOP2/Sun domain fa | 0.295 | 0.241 | 0.469 | 9.9e-72 | |
| UNIPROTKB|Q08J23 | 767 | NSUN2 "tRNA (cytosine(34)-C(5) | 0.295 | 0.238 | 0.474 | 4.2e-71 | |
| UNIPROTKB|F1MK61 | 777 | NSUN2 "Uncharacterized protein | 0.295 | 0.235 | 0.489 | 1.1e-68 | |
| POMBASE|SPAC23C4.17 | 685 | trm402 "tRNA (cytosine-5-)-met | 0.330 | 0.299 | 0.442 | 3.6e-62 | |
| UNIPROTKB|G3V1R4 | 531 | NSUN2 "NOL1/NOP2/Sun domain fa | 0.248 | 0.290 | 0.496 | 8.8e-62 | |
| UNIPROTKB|Q5ZLV4 | 796 | NSUN2 "tRNA (cytosine(34)-C(5) | 0.295 | 0.229 | 0.474 | 1.2e-61 | |
| UNIPROTKB|D4A3S8 | 782 | Nsun2 "NOL1/NOP2/Sun domain fa | 0.295 | 0.234 | 0.469 | 1.4e-61 |
| TAIR|locus:2041213 AT2G22400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1704 (604.9 bits), Expect = 2.0e-175, P = 2.0e-175
Identities = 349/576 (60%), Positives = 431/576 (74%)
Query: 1 MVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNM 60
+V+AND+D +R NLLIHQTKRMCT+NLIVTNHE Q FPGCR NK S AS+KGI +
Sbjct: 220 LVVANDVDFKRSNLLIHQTKRMCTSNLIVTNHEGQQFPGCRLNK--SRASEKGISENMPI 277
Query: 61 GQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIV 120
QL FDRVLCDVPCSGDGTLRKAPDIWRKWN G+GNGLHSLQ+ +AMRG+SLLKVGG+++
Sbjct: 278 NQLAFDRVLCDVPCSGDGTLRKAPDIWRKWNSGMGNGLHSLQIILAMRGLSLLKVGGKMI 337
Query: 121 YSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDKGIWLASHK 180
YSTCSMNPVE+EAVVAEILR+C SVEL+DVS+++P+LI RPGL+ WKVRDKG W S+K
Sbjct: 338 YSTCSMNPVEDEAVVAEILRRCGDSVELLDVSDKLPELIRRPGLKAWKVRDKGGWFTSYK 397
Query: 181 HVRKFRRIGIVPSMFPSGSSHMDATDIEPKHGNVTDVNS-DEGLQQVEDVLTSA--DDLE 237
V + RR G++ SMFPSG D+T+ K+ N DVN ++GL++ + + A ++
Sbjct: 398 DVPQNRRGGVLVSMFPSGKYLKDSTETTEKNEN-GDVNGCEDGLKETDISVVDATPEEQA 456
Query: 238 EEVSDLPLERCMRLVPHDQNSGAFFIAVLQKVSPLPVVQEKHINPEEKMLPRNDDPPKKL 297
EEVSDLPLERCMR++PHDQN+GAFFIAVLQK SPLP QEK N + ++ D +K
Sbjct: 457 EEVSDLPLERCMRIIPHDQNTGAFFIAVLQKKSPLPEFQEKP-NTKRNSTAKSTDSTEKS 515
Query: 298 QNQDTEEVNGMEVDLADGTDEKDPEGSLEANS-IDNEDGAAVEPDPLTCEKVDSEETEVP 356
++ E V + VD A DE E +EA+S I+ D ++EP EK +E +
Sbjct: 516 PSK--ESV--VTVD-AGVPDESAVEKVIEADSNIEKND--SLEP-----EKKITEGESIT 563
Query: 357 VNTETKSERTGGKRKLQIQGKWKGIDPVIFFNDETIINSIKTFYGI-DDSFQLSGQLVSR 415
+ E S GGKRK+ +QGKWKG DPV+F DET+IN IK FYGI D+SF L G LV+R
Sbjct: 564 EDKEANSSNAGGKRKVPMQGKWKGFDPVVFVKDETVINGIKEFYGIKDESFPLHGHLVAR 623
Query: 416 NGDTNRVKRIYYVSKSVKDALDLNFRVGQQLKITSVGLKMFERQTSREGNSAPCSFRISS 475
N DT+ VKRIYYVSKSVK+ L LNF VGQQLKI SVGLKMFERQ+++EG+S C FRISS
Sbjct: 624 NTDTSSVKRIYYVSKSVKEVLQLNFAVGQQLKIASVGLKMFERQSAKEGSSTLCPFRISS 683
Query: 476 EGLPVILPYITKQILYASLVDFKHLLQYKTIKFADFVDAEFGEKASKLMMGCCVIVLSKG 535
EGLPVILPYITKQ+LY + DFK LLQ K+IKF DFV+ + +KA+ L+MG CV++LS G
Sbjct: 684 EGLPVILPYITKQVLYTPMADFKLLLQDKSIKFHDFVNPQLAQKATDLVMGSCVVILSDG 743
Query: 536 GEALSNPIQIDASTIAIGCWKGRASLSVMVTAIDCQ 571
E P++ DASTIAI CW+G+ASL+VM T DCQ
Sbjct: 744 -EV---PVKADASTIAISCWRGKASLAVMATVADCQ 775
|
|
| TAIR|locus:2140094 AT4G40000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-4017 nsun2 "NOL1/NOP2/Sun domain family, member 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107252 Nsun2 "NOL1/NOP2/Sun domain family member 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q08J23 NSUN2 "tRNA (cytosine(34)-C(5))-methyltransferase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MK61 NSUN2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC23C4.17 trm402 "tRNA (cytosine-5-)-methyltransferase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V1R4 NSUN2 "NOL1/NOP2/Sun domain family, member 2, isoform CRA_b" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZLV4 NSUN2 "tRNA (cytosine(34)-C(5))-methyltransferase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A3S8 Nsun2 "NOL1/NOP2/Sun domain family, member 2 (Predicted)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.1.1 | 0.691 |
| 4th Layer | 2.1.1.29 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | estExt_fgenesh4_pg.C_LG_VII0458 | hypothetical protein (799 aa) | |||||||||
(Populus trichocarpa) | |||||||||||
 | gw1.I.4832.1 | • | • | • | 0.681 | ||||||
 | gw1.XIX.1572.1 | • | • | • | 0.675 | ||||||
 | estExt_fgenesh4_pg.C_LG_XV0629 | • | • | 0.658 | |||||||
 | eugene3.00090493 | • | • | 0.651 | |||||||
 | eugene3.00640202 | • | 0.604 | ||||||||
 | gw1.86.17.1 | • | 0.590 | ||||||||
 | estExt_fgenesh4_pm.C_280108 | • | 0.590 | ||||||||
 | estExt_fgenesh4_pm.C_1070023 | • | 0.564 | ||||||||
 | estExt_Genewise1_v1.C_LG_IV0024 | • | 0.559 | ||||||||
 | estExt_fgenesh4_pm.C_LG_I0505 | • | • | • | 0.553 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 620 | |||
| COG0144 | 355 | COG0144, Sun, tRNA and rRNA cytosine-C5-methylases | 2e-34 | |
| TIGR00446 | 264 | TIGR00446, nop2p, NOL1/NOP2/sun family putative RN | 7e-25 | |
| PRK14902 | 444 | PRK14902, PRK14902, 16S rRNA methyltransferase B; | 7e-21 | |
| pfam01189 | 277 | pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family | 1e-20 | |
| PRK14901 | 434 | PRK14901, PRK14901, 16S rRNA methyltransferase B; | 3e-17 | |
| TIGR00563 | 426 | TIGR00563, rsmB, ribosomal RNA small subunit methy | 2e-13 | |
| PRK11933 | 470 | PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransf | 7e-12 | |
| PRK10901 | 427 | PRK10901, PRK10901, 16S rRNA methyltransferase B; | 7e-12 | |
| pfam01189 | 277 | pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family | 2e-11 | |
| PRK14904 | 445 | PRK14904, PRK14904, 16S rRNA methyltransferase B; | 9e-11 | |
| PRK14903 | 431 | PRK14903, PRK14903, 16S rRNA methyltransferase B; | 7e-10 | |
| COG0144 | 355 | COG0144, Sun, tRNA and rRNA cytosine-C5-methylases | 9e-04 |
| >gnl|CDD|223222 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Score = 134 bits (338), Expect = 2e-34
Identities = 55/169 (32%), Positives = 73/169 (43%), Gaps = 19/169 (11%)
Query: 2 VIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNMG 61
V+A D+ +R L KR+ N+IV N +A+ + E
Sbjct: 185 VVAVDVSPKRLKRLRENLKRLGVRNVIVVNKDARRLA------------ELLPGGEK--- 229
Query: 62 QLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVY 121
FDR+L D PCSG G +R+ PD+ + L LQ +I + LLK GG +VY
Sbjct: 230 ---FDRILLDAPCSGTGVIRRDPDVKWRRTPEDIAELAKLQKEILAAALKLLKPGGVLVY 286
Query: 122 STCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVR 170
STCS+ P ENE VV L + EL V L G K R
Sbjct: 287 STCSLTPEENEEVVERFLERHPD-FELEPVRLPWGPLFEGLGSELGKTR 334
|
Length = 355 |
| >gnl|CDD|188051 TIGR00446, nop2p, NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >gnl|CDD|237857 PRK14902, PRK14902, 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201649 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family | Back alignment and domain information |
|---|
| >gnl|CDD|237856 PRK14901, PRK14901, 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233025 TIGR00563, rsmB, ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >gnl|CDD|183387 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236790 PRK10901, PRK10901, 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201649 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family | Back alignment and domain information |
|---|
| >gnl|CDD|237858 PRK14904, PRK14904, 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184896 PRK14903, PRK14903, 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223222 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 620 | |||
| KOG2198 | 375 | consensus tRNA cytosine-5-methylases and related e | 100.0 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 100.0 | |
| COG0144 | 355 | Sun tRNA and rRNA cytosine-C5-methylases [Translat | 100.0 | |
| PF01189 | 283 | Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR | 100.0 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 100.0 | |
| KOG1122 | 460 | consensus tRNA and rRNA cytosine-C5-methylase (nuc | 100.0 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 99.98 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 99.97 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 99.97 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 99.96 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 99.96 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 99.94 | |
| KOG2360 | 413 | consensus Proliferation-associated nucleolar prote | 99.82 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 98.3 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 98.17 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 98.09 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 98.02 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 97.91 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 97.88 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 97.85 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 97.59 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 97.58 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 97.52 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 97.46 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 97.44 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 97.43 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 97.32 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 97.3 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 97.16 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 97.15 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 97.09 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 96.97 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 96.93 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 96.87 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 96.81 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 96.76 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 96.75 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 96.65 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 96.63 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 96.56 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 96.55 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 96.54 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 96.52 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 96.52 | |
| COG1041 | 347 | Predicted DNA modification methylase [DNA replicat | 96.5 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 96.35 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 96.23 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 95.95 | |
| PRK04266 | 226 | fibrillarin; Provisional | 95.89 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 95.79 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 95.73 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 95.72 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 95.59 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 95.54 | |
| PF01189 | 283 | Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR | 95.52 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 95.48 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 95.21 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 95.16 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 94.9 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 94.85 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 94.77 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 94.75 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 94.75 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 94.74 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 94.7 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 94.65 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 94.31 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 94.25 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 94.11 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 94.11 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 94.1 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 93.97 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 93.91 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 93.82 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 93.8 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 93.75 | |
| PF01861 | 243 | DUF43: Protein of unknown function DUF43; InterPro | 93.75 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 93.47 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 93.46 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 93.42 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 93.23 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 93.21 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 93.21 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 93.18 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 93.03 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 92.97 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 92.96 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 92.82 | |
| PLN02476 | 278 | O-methyltransferase | 92.39 | |
| COG4076 | 252 | Predicted RNA methylase [General function predicti | 92.09 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 91.96 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 91.71 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 91.66 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 91.63 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 91.4 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 91.19 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 91.15 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 91.0 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 90.86 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 90.79 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 90.78 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 90.63 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 90.53 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 89.81 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 89.81 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 89.77 | |
| KOG2671 | 421 | consensus Putative RNA methylase [Replication, rec | 89.6 | |
| PLN02823 | 336 | spermine synthase | 89.44 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 89.43 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 89.3 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 89.0 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 88.88 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 88.71 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 88.55 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 88.36 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 88.33 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 87.68 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 87.52 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 87.28 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 86.98 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 86.81 | |
| PLN02366 | 308 | spermidine synthase | 86.76 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 86.25 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 85.95 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 85.7 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 85.51 | |
| PF02005 | 377 | TRM: N2,N2-dimethylguanosine tRNA methyltransferas | 85.3 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 85.17 | |
| PF10354 | 166 | DUF2431: Domain of unknown function (DUF2431); Int | 84.93 | |
| PF02527 | 184 | GidB: rRNA small subunit methyltransferase G; Inte | 84.29 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 84.2 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 84.17 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 84.04 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 83.83 | |
| KOG1540 | 296 | consensus Ubiquinone biosynthesis methyltransferas | 83.72 | |
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 83.67 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 83.56 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 83.35 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 83.17 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 82.94 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 80.69 |
| >KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.4e-46 Score=389.33 Aligned_cols=176 Identities=55% Similarity=0.896 Sum_probs=163.7
Q ss_pred CEEEEcCChhHHHHHHHHHHHhCCCcEEEEccccCCCCCCccCCCCCcCCCcCcccccccccCCccEEEEcCCCcccccc
Q 007036 1 MVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDGTL 80 (620)
Q Consensus 1 ~VvAnD~d~kR~~~L~~~~kRlg~~nv~vtn~Da~~~p~~~~~~~~~~~~~~g~~~~~~~~~~~FDrILlDvPCSGdGtl 80 (620)
+|+|||+|.+|+++|+||++|++.+++.|++||++.||++.+... .+.....|||||||||||||||+
T Consensus 185 ~vvaND~d~~R~~~L~~q~~~l~~~~~~v~~~~~~~~p~~~~~~~------------~~~~~~~fDrVLvDVPCS~Dgt~ 252 (375)
T KOG2198|consen 185 YVVANDVDPKRLNMLVHQLKRLPSPNLLVTNHDASLFPNIYLKDG------------NDKEQLKFDRVLVDVPCSGDGTL 252 (375)
T ss_pred eeEecccCHHHHHHHHHHHhccCCcceeeecccceeccccccccC------------chhhhhhcceeEEecccCCCccc
Confidence 589999999999999999999999999999999999999865311 12345889999999999999999
Q ss_pred ccCcccccc-cCcchhhhhHHHHHHHHHHHHhhcccCCEEEEeecCCChhccHHHHHHHHHhCCCceEEeeCCCcCCCcc
Q 007036 81 RKAPDIWRK-WNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLI 159 (620)
Q Consensus 81 rK~pdiw~~-w~~~~~~~L~~lQ~~IL~rAl~lLk~GG~LVYSTCSlnP~ENEaVV~~~L~~~~~~~eLvd~~~~lp~l~ 159 (620)
|++++||+. |+...+.+||.||.+||+||++|||+||+||||||||||+|||+||+++|++++++++|+|++..||.++
T Consensus 253 rk~~~i~~~~w~~~~~~~L~~LQ~~iL~rgl~lLk~GG~lVYSTCSLnpieNEaVV~~~L~~~~~~~~lv~~~~~lp~l~ 332 (375)
T KOG2198|consen 253 RKNPNIWKEGWKTQRALGLHALQLRILRRGLRLLKVGGRLVYSTCSLNPIENEAVVQEALQKVGGAVELVDVSGDLPGLK 332 (375)
T ss_pred ccCchHhhhhhhhhhccCChHHHHHHHHHHHHHhcCCCEEEEeccCCCchhhHHHHHHHHHHhcCcccceeeccccccce
Confidence 999999999 9999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCccccccccCC-ccccchhhHHhhhcc
Q 007036 160 HRPGLRKWKVRDKG-IWLASHKHVRKFRRI 188 (620)
Q Consensus 160 ~~pGl~~W~v~~~~-~~~~~~~~v~~~~~~ 188 (620)
|.+|.+.|++.+++ .|+.++.++|.....
T Consensus 333 r~~g~t~~~~~~~~~~~~~~~~~vp~~~~~ 362 (375)
T KOG2198|consen 333 RMFGSTGWKVHDKVLKWFTSPLEVPKLVAN 362 (375)
T ss_pred ecCCCCcceEEecCcccccCccccccchhh
Confidence 99999999999966 499999999977654
|
|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >KOG2360 consensus Proliferation-associated nucleolar protein (NOL1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >COG4076 Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known | Back alignment and domain information |
|---|
| >PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 620 | ||||
| 3m4x_A | 456 | Structure Of A Ribosomal Methyltransferase Length = | 1e-13 | ||
| 2frx_A | 479 | Crystal Structure Of Yebu, A M5c Rna Methyltransfer | 2e-12 | ||
| 1ixk_A | 315 | Crystal Structure Analysis Of Methyltransferase Hom | 7e-12 | ||
| 3m6w_A | 464 | Multi-Site-Specific 16s Rrna Methyltransferase Rsmf | 5e-11 | ||
| 3m6u_A | 464 | Multi-Site-Specific 16s Rrna Methyltransferase Rsmf | 5e-11 | ||
| 3m6x_A | 464 | Multi-Site-Specific 16s Rrna Methyltransferase Rsmf | 1e-10 | ||
| 1sqf_A | 429 | The Crystal Structure Of E. Coli Fmu Binary Complex | 3e-08 | ||
| 3a4t_A | 274 | Crystal Structure Of Atrm4 From M.Jannaschii With S | 3e-07 | ||
| 2yxl_A | 450 | Crystal Structure Of Ph0851 Length = 450 | 5e-07 | ||
| 4fp9_A | 360 | Human Mterf4-Nsun4 Protein Complex Length = 360 | 1e-06 | ||
| 4fzv_A | 359 | Crystal Structure Of The Human Mterf4:nsun4:sam Ter | 1e-06 |
| >pdb|3M4X|A Chain A, Structure Of A Ribosomal Methyltransferase Length = 456 | Back alignment and structure |
|
| >pdb|2FRX|A Chain A, Crystal Structure Of Yebu, A M5c Rna Methyltransferase From E.Coli Length = 479 | Back alignment and structure |
| >pdb|1IXK|A Chain A, Crystal Structure Analysis Of Methyltransferase Homolog Protein From Pyrococcus Horikoshii Length = 315 | Back alignment and structure |
| >pdb|3M6W|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group P21212 In Complex With S-Adenosyl-L- Methionine Length = 464 | Back alignment and structure |
| >pdb|3M6U|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group 43 Length = 464 | Back alignment and structure |
| >pdb|3M6X|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group P21212 Length = 464 | Back alignment and structure |
| >pdb|1SQF|A Chain A, The Crystal Structure Of E. Coli Fmu Binary Complex With S- Adenosylmethionine At 2.1 A Resolution Length = 429 | Back alignment and structure |
| >pdb|3A4T|A Chain A, Crystal Structure Of Atrm4 From M.Jannaschii With Sinefungin Length = 274 | Back alignment and structure |
| >pdb|2YXL|A Chain A, Crystal Structure Of Ph0851 Length = 450 | Back alignment and structure |
| >pdb|4FP9|A Chain A, Human Mterf4-Nsun4 Protein Complex Length = 360 | Back alignment and structure |
| >pdb|4FZV|A Chain A, Crystal Structure Of The Human Mterf4:nsun4:sam Ternary Complex Length = 359 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Length = 479 | Back alignment and structure |
|---|
Score = 142 bits (360), Expect = 8e-37
Identities = 43/199 (21%), Positives = 80/199 (40%), Gaps = 32/199 (16%)
Query: 1 MVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNM 60
++AN+ R +L R +N+ +T+ + + F
Sbjct: 144 AILANEFSASRVKVLHANISRCGISNVALTHFDGRVFGAAVPEM---------------- 187
Query: 61 GQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIV 120
FD +L D PCSG+G +RK PD + W+ + + Q ++ L+ GG +V
Sbjct: 188 ----FDAILLDAPCSGEGVVRKDPDALKNWSPESNQEIAATQRELIDSAFHALRPGGTLV 243
Query: 121 YSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDKGIWLASHK 180
YSTC++N ENEAV + +VE + + + P + + ++
Sbjct: 244 YSTCTLNQEENEAVCLWLKETYPDAVEFLPLGDLFPGANKALTEEGF-LH---VF--PQI 297
Query: 181 H------VRKFRRIGIVPS 193
+ V + R+ +P+
Sbjct: 298 YDCEGFFVARLRKTQAIPA 316
|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Length = 479 | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Length = 315 | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Length = 456 | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Length = 464 | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Length = 309 | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Length = 274 | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Length = 450 | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Length = 429 | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Length = 429 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 620 | |||
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 100.0 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 100.0 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 100.0 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 100.0 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 100.0 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 99.98 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 99.96 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 99.96 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 99.95 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 98.82 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 98.75 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 98.69 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 98.52 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 98.47 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 98.35 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 98.32 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 98.25 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 98.25 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 98.19 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 98.17 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 98.16 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 98.13 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 98.08 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 98.07 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 98.07 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 97.95 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 97.93 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 97.9 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 97.88 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 97.85 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 97.8 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 97.79 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 97.77 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 97.71 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 97.71 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 97.65 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 97.57 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 97.54 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 97.53 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 97.52 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 97.48 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 97.47 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 97.45 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 97.41 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 97.4 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 97.37 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 97.35 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 97.34 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 97.34 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 97.33 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 97.31 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 97.29 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 97.26 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 97.25 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 97.25 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 97.23 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 97.23 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 97.2 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 97.18 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 97.1 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 97.09 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 97.07 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 97.07 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 97.06 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 97.06 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 96.98 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 96.89 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 96.85 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 96.84 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 96.81 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 96.79 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 96.78 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 96.72 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 96.71 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 96.67 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 96.65 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 96.64 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 96.62 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 96.62 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 96.61 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 96.55 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 96.54 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 96.52 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 96.51 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 96.5 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 96.47 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 96.46 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 96.44 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 96.43 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 96.39 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 96.35 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 96.34 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 96.33 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 96.33 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 96.32 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 96.31 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 96.31 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 96.27 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 96.25 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 96.22 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 96.21 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 96.2 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 96.16 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 96.15 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 96.12 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 96.08 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 96.04 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 96.04 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 96.02 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 95.96 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 95.92 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 95.92 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 95.89 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 95.85 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 95.85 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 95.83 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 95.8 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 95.8 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 95.76 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 95.76 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 95.74 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 95.72 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 95.71 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 95.69 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 95.69 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 95.68 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 95.61 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 95.6 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 95.57 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 95.57 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 95.53 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 95.52 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 95.51 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 95.5 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 95.45 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 95.42 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 95.41 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 95.4 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 95.4 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 95.4 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 95.36 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 95.33 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 95.28 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 95.23 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 95.21 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 95.19 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 95.18 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 95.15 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 95.14 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 95.1 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 95.07 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 95.07 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 95.04 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 95.01 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 94.96 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 94.92 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 94.86 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 94.85 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 94.82 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 94.82 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 94.79 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 94.72 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 94.63 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 94.45 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 94.36 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 94.31 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 94.23 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 94.23 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 94.22 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 93.97 | |
| 3cvo_A | 202 | Methyltransferase-like protein of unknown functio; | 93.95 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 93.9 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 93.89 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 93.8 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 93.72 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 93.71 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 93.71 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 93.69 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 93.69 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 93.67 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 93.6 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 93.55 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 93.5 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 93.47 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 93.44 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 93.4 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 93.28 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 93.12 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 93.09 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 93.03 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 92.98 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 92.92 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 92.9 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 92.85 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 92.79 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 92.76 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 92.64 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 92.63 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 92.57 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 92.42 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 92.34 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 92.22 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 91.85 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 91.8 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 91.38 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 91.32 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 91.14 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 90.92 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 90.84 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 90.84 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 90.83 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 90.44 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 90.41 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 90.15 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 89.75 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 89.62 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 89.27 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 89.18 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 89.15 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 89.08 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 88.92 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 88.19 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 87.82 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 87.72 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 87.68 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 87.39 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 87.24 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 87.06 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 86.81 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 86.54 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 86.5 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 86.41 | |
| 3s1s_A | 878 | Restriction endonuclease bpusi; PD--(D/E)XK cataly | 86.14 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 85.89 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 85.68 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 85.41 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 85.29 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 84.69 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 84.56 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 84.42 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 83.98 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 83.88 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 83.51 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 82.72 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 81.62 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 81.08 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 80.36 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 80.1 |
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-39 Score=346.65 Aligned_cols=123 Identities=30% Similarity=0.427 Sum_probs=113.3
Q ss_pred EEEEcCChhHHHHHHHHHHHhCC------CcEEEEccccCCCCCCccCCCCCcCCCcCcccccccccCCccEEEEcCCCc
Q 007036 2 VIANDLDVQRCNLLIHQTKRMCT------ANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCS 75 (620)
Q Consensus 2 VvAnD~d~kR~~~L~~~~kRlg~------~nv~vtn~Da~~~p~~~~~~~~~~~~~~g~~~~~~~~~~~FDrILlDvPCS 75 (620)
|+|||++.+|+..|.++++|++. .++.++++|+..++.. ....||+||||||||
T Consensus 175 l~A~D~~~~R~~~l~~~l~r~~~~~~~~~~~v~v~~~D~~~~~~~--------------------~~~~fD~VLlDaPCS 234 (359)
T 4fzv_A 175 LAANDLSPSRIARLQKILHSYVPEEIRDGNQVRVTSWDGRKWGEL--------------------EGDTYDRVLVDVPCT 234 (359)
T ss_dssp EEEECSCHHHHHHHHHHHHHHSCTTTTTSSSEEEECCCGGGHHHH--------------------STTCEEEEEEECCCC
T ss_pred EEEEcCCHHHHHHHHHHHHHhhhhhhccCCceEEEeCchhhcchh--------------------ccccCCEEEECCccC
Confidence 79999999999999999999986 4799999999876531 126799999999999
Q ss_pred cc--cccccCcccccccCcchhhhhHHHHHHHHHHHHhhcccCCEEEEeecCCChhccHHHHHHHHHhCCC
Q 007036 76 GD--GTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEG 144 (620)
Q Consensus 76 Gd--GtlrK~pdiw~~w~~~~~~~L~~lQ~~IL~rAl~lLk~GG~LVYSTCSlnP~ENEaVV~~~L~~~~~ 144 (620)
|+ |++|++|++|++|++.++..|+.+|++||.+|+++|||||+||||||||+|+|||+||++||+++++
T Consensus 235 g~g~g~~r~~~~~~~~~~~~~~~~l~~lQ~~iL~~a~~~lkpGG~LVYsTCSl~~~ENE~vV~~~L~~~~~ 305 (359)
T 4fzv_A 235 TDRHSLHEEENNIFKRSRKKERQILPVLQVQLLAAGLLATKPGGHVVYSTCSLSHLQNEYVVQGAIELLAN 305 (359)
T ss_dssp CHHHHTTCCTTCTTSGGGHHHHHTHHHHHHHHHHHHHHTEEEEEEEEEEESCCCTTTTHHHHHHHHHHHHH
T ss_pred CCCCcccccChhhhhhCCHHHHHHHHHHHHHHHHHHHhcCCCCcEEEEEeCCCchhhCHHHHHHHHHhCCC
Confidence 98 8889999999999999999999999999999999999999999999999999999999999998753
|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 620 | ||||
| d1ixka_ | 313 | c.66.1.38 (A:) Hypothetical methyltransferase PH13 | 3e-19 | |
| d1ixka_ | 313 | c.66.1.38 (A:) Hypothetical methyltransferase PH13 | 5e-05 | |
| d1sqga2 | 284 | c.66.1.38 (A:145-428) Ribosomal RNA small subunit | 4e-16 | |
| d1sqga2 | 284 | c.66.1.38 (A:145-428) Ribosomal RNA small subunit | 3e-06 | |
| d2b9ea1 | 293 | c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) | 6e-12 | |
| d2b9ea1 | 293 | c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) | 1e-06 | |
| d1wxxa2 | 318 | c.66.1.51 (A:65-382) Hypothetical protein TTHA1280 | 2e-05 | |
| d2as0a2 | 324 | c.66.1.51 (A:73-396) Hypothetical protein PH1915, | 2e-04 |
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 313 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: NOL1/NOP2/sun domain: Hypothetical methyltransferase PH1374 species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
Score = 86.6 bits (213), Expect = 3e-19
Identities = 48/194 (24%), Positives = 80/194 (41%), Gaps = 29/194 (14%)
Query: 1 MVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNM 60
++ A D+D R R+ N+I+ + + H
Sbjct: 143 VIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGELNVE----------------- 185
Query: 61 GQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIV 120
FD++L D PC+G GT+ K P+ + LQ+++ +G+ +LK GG +V
Sbjct: 186 ----FDKILLDAPCTGSGTIHKNPERKWNRTMDDIKFCQGLQMRLLEKGLEVLKPGGILV 241
Query: 121 YSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDKGIWLASHK 180
YSTCS+ P ENE V+ L + VEL+ + P L + G+ + L
Sbjct: 242 YSTCSLEPEENEFVIQWALDNFD--VELLPLKYGEPALTNPFGIELSEEIKNARRLYPDV 299
Query: 181 H------VRKFRRI 188
H + K R++
Sbjct: 300 HETSGFFIAKIRKL 313
|
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 313 | Back information, alignment and structure |
|---|
| >d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 284 | Back information, alignment and structure |
|---|
| >d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 284 | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Length = 318 | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 324 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 620 | |||
| d1ixka_ | 313 | Hypothetical methyltransferase PH1374 {Archaeon Py | 100.0 | |
| d1sqga2 | 284 | Ribosomal RNA small subunit methyltransferase B, R | 100.0 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 99.37 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 99.04 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 98.86 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 98.08 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 97.99 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 97.78 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 97.55 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 97.38 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 97.24 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 97.22 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 97.19 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 97.16 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 97.15 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 96.82 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 96.81 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 96.71 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 96.63 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 96.36 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 96.22 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 96.22 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 96.21 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 96.19 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 96.04 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 96.0 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 95.91 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 95.89 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 95.88 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 95.87 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 95.86 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 95.65 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 95.46 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 95.37 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 95.24 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 95.18 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 94.89 | |
| d1wg8a2 | 182 | TM0872, methyltransferase domain {Thermus thermoph | 94.48 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 94.43 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 93.17 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 92.84 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 92.45 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 92.28 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 92.26 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 92.18 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 92.0 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 91.95 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 91.55 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 91.0 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 90.26 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 90.25 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 89.99 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 89.65 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 89.45 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 89.4 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 89.2 | |
| d1jsxa_ | 207 | Glucose-inhibited division protein B (GidB) {Esche | 88.85 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 88.72 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 88.56 | |
| d2okca1 | 425 | Type I restriction enzyme StySJI M protein {Bacter | 88.14 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 87.74 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 87.57 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 87.35 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 87.25 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 86.64 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 85.85 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 85.54 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 85.12 | |
| d1xdza_ | 239 | Glucose-inhibited division protein B (GidB) {Bacil | 83.8 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 83.76 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 83.41 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 82.82 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 82.27 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 82.22 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 81.22 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 80.95 |
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: NOL1/NOP2/sun domain: Hypothetical methyltransferase PH1374 species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
Probab=100.00 E-value=9.1e-42 Score=354.30 Aligned_cols=130 Identities=32% Similarity=0.494 Sum_probs=112.5
Q ss_pred EEEEcCChhHHHHHHHHHHHhCCCcEEEEccccCCCCCCccCCCCCcCCCcCcccccccccCCccEEEEcCCCccccccc
Q 007036 2 VIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDGTLR 81 (620)
Q Consensus 2 VvAnD~d~kR~~~L~~~~kRlg~~nv~vtn~Da~~~p~~~~~~~~~~~~~~g~~~~~~~~~~~FDrILlDvPCSGdGtlr 81 (620)
|+|+|++.+|++.|.++++|+|+.|+.+++.|+..++.. ...||+|||||||||+|++|
T Consensus 144 i~a~d~~~~r~~~l~~~~~r~~~~~i~~~~~d~~~~~~~---------------------~~~fD~ILvDaPCSg~G~~~ 202 (313)
T d1ixka_ 144 IYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGEL---------------------NVEFDKILLDAPCTGSGTIH 202 (313)
T ss_dssp EEEECSCHHHHHHHHHHHHHHTCCSEEEESSCGGGGGGG---------------------CCCEEEEEEECCTTSTTTCC
T ss_pred eeeeccCHHHHHHHHHHHHHHHhhccccccccccccccc---------------------cccccEEEEccccccCCcee
Confidence 799999999999999999999999999999998776421 25799999999999999999
Q ss_pred cCcccccccCcchhhhhHHHHHHHHHHHHhhcccCCEEEEeecCCChhccHHHHHHHHHhCCCceEEeeCCCc
Q 007036 82 KAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVSNE 154 (620)
Q Consensus 82 K~pdiw~~w~~~~~~~L~~lQ~~IL~rAl~lLk~GG~LVYSTCSlnP~ENEaVV~~~L~~~~~~~eLvd~~~~ 154 (620)
|+|++++.|++.++..|+.+|++||.+|+++||+||+|||||||++|+|||+||++||++++ ++++++...
T Consensus 203 r~p~~~~~~~~~~~~~l~~~Q~~iL~~a~~~lk~gG~lVYsTCSl~~eENE~VV~~~L~~~~--~~~~~~~~~ 273 (313)
T d1ixka_ 203 KNPERKWNRTMDDIKFCQGLQMRLLEKGLEVLKPGGILVYSTCSLEPEENEFVIQWALDNFD--VELLPLKYG 273 (313)
T ss_dssp --------CCHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEESCCCGGGTHHHHHHHHHHSS--EEEECCCSS
T ss_pred eccchhhhhhhhHHHHHHHHHHHHHHhhhheeCCCcEEEEeeccCChHhHHHHHHHHHhcCC--CEEeecccC
Confidence 99999888999999999999999999999999999999999999999999999999999874 788877543
|
| >d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|