Citrus Sinensis ID: 007140

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610------
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVGLPILYLNTTALVVTLGF
cccccccEEEEEcccccccccEEEEccccccccccEEEcccccEEEEEEEEcccccccccccEEEEEEcccccEEEcccccccccccccccEEEEEcccEEEEEEcccccccccccccccccEEEEccccccccccccccccccHHHHHHHHHccccEEEEEcccccEEEEccccccccccccccccEEEEEEcccccccccccccccEEEEEEEccccEEEEEccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccEEEEcccccccccccEEEccccccccccccccccEEEEEEEEEccccEEEEEEcccccccccEEEEEccccccccccccccEEEcccccEEEEEEcccccccEEEEEEccccccccccccEEEEccccccEEEEEEEcccccEEEEEEEEcccccccccccccEEEEEEEcccccccEEEEEcccccccccccccccccccccccEEEEEEEcccccEEEEEEEEcccccccccccccEEEEEccccccccccccccccccccccccccccHHHHHHccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEcc
cccccccEEEEccccccccccEEEccccccccccccEEcccccEEEEEEEEccccccccccEEEEEEEcccccEEEccccccEEEEcccccEEEccccEEEEEEEcccccccccccccccccEEEEcccccccccccHHHHHccHHHHHHHHHHHHccEEEEEccccEEEcccccEEEcccccccccEEEEEEEccccEEEEEccccccEEEEEEccccEEEEEcccccHHcccccccccccccccccEccccccEEEEEEEccccccccccccccEEEEccccccccccccEEEEEcHHcccEEEccccEEEEEEEccccccEEEEEEcccccccccEEEEEcccccccccccccEEEEcccccEEEEEEEccccccEEEEEEccccccccccccEcEEEccccccEEEEEccccccccEEEEEccccccccccccccEEEEEEccccccccEEEEEccccccEEEcccccccHHHccccEEEEEEEcccccEEEEEEEccccccccccccccEEEEEccHHcccHHHHcccccccccccccccccHHHHHHccEEEEccccccEEcccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEccEEEEEEccc
mpfftgigihrllpddslgpekevhgypdgakinfvswspdgkriafsvrvdeednvssckLRVWIADaetgeakplfespdiclnaVFGSFvwvnnstlliftipssrrdppkktmvplgpkiqsneqKNIIISRMTdnllkdeydesLFDYYTTAQLVLGsldgtakdfgtpavytavepspdqkYVLITSmhrpysykvpcarfsqKVQVWTTDGKLVRelcdlppaedipvcynSVREGMRsiswradkpstlYWVEAQdrgdanvevsprdiiytqpaepaegekpeilhkldlrfrsvswcddSLALVNETWYKtsqtrtwlvcpgskdvaprvLFDRVFenvysdpgspmmtrtstgTNVIAKIKKENDEQIYILLNgrgftpegnipfldlfdintgskerIWESNREKYFETAVALVFGqgeedinlNQLKILTSKESKTEITQYHILswplkkssqitnfphpyptlASLQKEMIKYQrkdgvpltatlylppgydqskdgplpclfwaypedykskdaagqvrgspnefsgmtptsSLIFLARRFAvlagpsipiigegdklpndrFVEQLVSSAEAAVEEVVRRGVGLPILYLNTTALVVTLGF
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFsvrvdeednvsscKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIftipssrrdppkktmvplgpkiqsneqkniIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAvytavepspdQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRelcdlppaedipVCYNSVREGMRsiswradkpstLYWVEAQDrgdanvevspRDIIytqpaepaegekpeILHKLDLRFRSVSWCDDSLALVNETWyktsqtrtwlvcpgskdVAPRVLFDRVFENvysdpgspmmtrtsTGTNVIAKIKKENDEQIYILLNGrgftpegniPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEevvrrgvglpilylnttaLVVTLGF
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLvssaeaaveevvrrgvgLPILYLNTTALVVTLGF
***FTGIGIHRLLP*********VHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTI*************************NIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIY*************ILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYS*************TNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDY***********************SLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVGLPILYLNTTALVVTL**
*PFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSS**************************SRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYK*************EFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVGLPILYLNTTALVVTLGF
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVGLPILYLNTTALVVTLGF
*PFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVGLPILYLNTTALVVTLGF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVGLPILYLNTTALVVTLGF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query616 2.2.26 [Sep-21-2011]
Q8VZF3 960 Probable glutamyl endopep yes no 0.967 0.620 0.702 0.0
Q10MJ1 938 Probable glutamyl endopep yes no 0.972 0.638 0.693 0.0
>sp|Q8VZF3|CGEP_ARATH Probable glutamyl endopeptidase, chloroplastic OS=Arabidopsis thaliana GN=GEP PE=2 SV=2 Back     alignment and function desciption
 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/599 (70%), Positives = 500/599 (83%), Gaps = 3/599 (0%)

Query: 1   MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC 60
           M F+TG+GIH+LLPD +L PEKE+ G PDG KINFV+WS DGK +AFS+RVDE  N  S 
Sbjct: 174 MSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAFSIRVDENGN--SS 231

Query: 61  KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL 120
           K  VW+AD ETG A+PLF S DI LNA+F SFVW++NSTLL+ TIPSSR +PPKK +VP 
Sbjct: 232 KPVVWVADVETGVARPLFNSQDIFLNAIFESFVWIDNSTLLVSTIPSSRGEPPKKPLVPS 291

Query: 121 GPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAV 180
           GPK  SNE K ++  R   +LLKDEYD  LFDYY ++QLVL SLDGT K+ G PAVYT++
Sbjct: 292 GPKTLSNETKTVVQVRTFQDLLKDEYDADLFDYYASSQLVLASLDGTVKEVGVPAVYTSL 351

Query: 181 EPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSV 240
           +PS D KY+L++S+HRPYS+ VPC RF +KV+VWTTDG+ VR+LCDLP AEDIP+  NSV
Sbjct: 352 DPSTDHKYLLVSSLHRPYSFIVPCGRFPKKVEVWTTDGRFVRQLCDLPLAEDIPIASNSV 411

Query: 241 REGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLR 300
           R+GMRSI+WRADKPSTL W E QD GDA +EVSPRDI+Y Q AEP  GE+PE+LHKLDLR
Sbjct: 412 RKGMRSINWRADKPSTL-WAETQDGGDAKMEVSPRDIVYMQSAEPLAGEEPEVLHKLDLR 470

Query: 301 FRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTR 360
           +  +SWCDD+LALV E+WYKT +TRTW++ PGS DV+PR+LFDR  E+VYSDPGS M+ R
Sbjct: 471 YGGISWCDDTLALVYESWYKTRRTRTWVISPGSNDVSPRILFDRSSEDVYSDPGSTMLRR 530

Query: 361 TSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFE 420
           T  GT VIAKIKKENDE  Y+LLNG G TP+GN+PFLDLFDINTG+KERIWES++EKYFE
Sbjct: 531 TDAGTYVIAKIKKENDEGTYVLLNGSGATPQGNVPFLDLFDINTGNKERIWESDKEKYFE 590

Query: 421 TAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASL 480
           T VAL+  Q E D+ + +LKILTSKESKTE TQY +  WP +K  QITNFPHPYP LASL
Sbjct: 591 TVVALMSDQKEGDLKMEELKILTSKESKTENTQYSLQLWPDRKVQQITNFPHPYPQLASL 650

Query: 481 QKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEF 540
           QKEMI+YQRKDGV LTATLYLPPGYD SKDGPLPCLFW+YP ++KSKDAAGQVRGSPNEF
Sbjct: 651 QKEMIRYQRKDGVQLTATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEF 710

Query: 541 SGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVG 599
           +G+  TS+L++LARRFA+L+GP+IPIIGEGD+  NDR+VEQLV+SAEAAVEEVVRRGV 
Sbjct: 711 AGIGSTSALLWLARRFAILSGPTIPIIGEGDEEANDRYVEQLVASAEAAVEEVVRRGVA 769
Serine-type protease active in vitro against the LHCII N-terminal. Cleaves its substrate on the carboxy-side of Glu residues.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|Q10MJ1|CGEP_ORYSJ Probable glutamyl endopeptidase, chloroplastic OS=Oryza sativa subsp. japonica GN=GEP PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query616
297743980 913 unnamed protein product [Vitis vinifera] 0.974 0.657 0.737 0.0
359479944 961 PREDICTED: probable glutamyl endopeptida 0.972 0.623 0.735 0.0
224130988 967 predicted protein [Populus trichocarpa] 0.974 0.620 0.728 0.0
224064539 905 predicted protein [Populus trichocarpa] 0.967 0.658 0.723 0.0
449436423 970 PREDICTED: probable glutamyl endopeptida 0.974 0.618 0.718 0.0
449436421 971 PREDICTED: probable glutamyl endopeptida 0.974 0.617 0.718 0.0
357511363 962 Acylamino-acid-releasing enzyme [Medicag 0.974 0.623 0.707 0.0
297828471 962 serine-type peptidase [Arabidopsis lyrat 0.972 0.622 0.703 0.0
30690669 961 prolyl oligopeptidase-like protein [Arab 0.969 0.621 0.704 0.0
356572793 948 PREDICTED: probable glutamyl endopeptida 0.974 0.632 0.710 0.0
>gi|297743980|emb|CBI36950.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  941 bits (2432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/601 (73%), Positives = 523/601 (87%), Gaps = 1/601 (0%)

Query: 1   MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC 60
           M F+T IGIH+L+PD +LGPEKEVHG+PDGAKINFVSWS +G+ ++FS+RVDEE+N SS 
Sbjct: 109 MSFYTSIGIHQLMPDGTLGPEKEVHGFPDGAKINFVSWSLNGQHLSFSIRVDEEEN-SSS 167

Query: 61  KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL 120
           KLR+W+AD ETG+A+PLF+SPDI LNAVF +FVWV++STLL+ TIP SR DPPKK +VP 
Sbjct: 168 KLRIWVADVETGKARPLFQSPDIHLNAVFDNFVWVDDSTLLVCTIPLSRGDPPKKPLVPS 227

Query: 121 GPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAV 180
           GPK+QSNEQKN++  R   +LLKDEYD  LFDYY T QLVL SLDGT K+ G PAVYT++
Sbjct: 228 GPKVQSNEQKNVVQVRTFQDLLKDEYDADLFDYYATTQLVLASLDGTMKEIGPPAVYTSM 287

Query: 181 EPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSV 240
           +PSPDQKY+LI+S+HRPYS+ VPC RF +KV +WT++GK VRELCDLP AEDIP+ +NSV
Sbjct: 288 DPSPDQKYLLISSIHRPYSFIVPCGRFPKKVDLWTSEGKFVRELCDLPLAEDIPIAFNSV 347

Query: 241 REGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLR 300
           R+GMRSI+WRADKPSTLYWVE QD GDA VEVSPRDI+Y QPAEP +GE+  ILHKLDLR
Sbjct: 348 RKGMRSINWRADKPSTLYWVETQDEGDAKVEVSPRDIVYMQPAEPLDGEQQAILHKLDLR 407

Query: 301 FRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTR 360
           +  +SWCDDSLALV E+WYKT +TRTW++ PGS+DV+PR+LFDR  E+VYSDPGSPM+ R
Sbjct: 408 YGGISWCDDSLALVYESWYKTRRTRTWVISPGSEDVSPRILFDRSSEDVYSDPGSPMLRR 467

Query: 361 TSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFE 420
           T+ GT VIAKIKKENDE  YILLNG G TPEGNIPFLDLFDINTGSKERIWES++EKY+E
Sbjct: 468 TTAGTYVIAKIKKENDEGTYILLNGSGATPEGNIPFLDLFDINTGSKERIWESDKEKYYE 527

Query: 421 TAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASL 480
           T VAL+  Q E D+ LNQLKILTSKESKTE TQY I SW  KK+ QITNFPHPYP LASL
Sbjct: 528 TVVALMSDQSEGDLYLNQLKILTSKESKTENTQYFIQSWLDKKACQITNFPHPYPQLASL 587

Query: 481 QKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEF 540
           QKEMI+Y+RKDGV LTATLYLPPGYD SKDGPLPCL W+YP ++KSKDAAGQVRGSPNEF
Sbjct: 588 QKEMIRYERKDGVQLTATLYLPPGYDPSKDGPLPCLVWSYPGEFKSKDAAGQVRGSPNEF 647

Query: 541 SGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVGL 600
           +G+ PTS+L++LARRFA+L+GP+IPIIGEG++  NDR+VEQLV+SAEAAVEEV+RRGV  
Sbjct: 648 AGIGPTSALLWLARRFAILSGPTIPIIGEGNEEANDRYVEQLVASAEAAVEEVIRRGVAH 707

Query: 601 P 601
           P
Sbjct: 708 P 708

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359479944|ref|XP_002270510.2| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130988|ref|XP_002320974.1| predicted protein [Populus trichocarpa] gi|222861747|gb|EEE99289.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224064539|ref|XP_002301512.1| predicted protein [Populus trichocarpa] gi|222843238|gb|EEE80785.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449436423|ref|XP_004135992.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 2 [Cucumis sativus] gi|449507837|ref|XP_004163143.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449436421|ref|XP_004135991.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 1 [Cucumis sativus] gi|449507834|ref|XP_004163142.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357511363|ref|XP_003625970.1| Acylamino-acid-releasing enzyme [Medicago truncatula] gi|355500985|gb|AES82188.1| Acylamino-acid-releasing enzyme [Medicago truncatula] Back     alignment and taxonomy information
>gi|297828471|ref|XP_002882118.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata] gi|297327957|gb|EFH58377.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30690669|ref|NP_850473.1| prolyl oligopeptidase-like protein [Arabidopsis thaliana] gi|330255741|gb|AEC10835.1| prolyl oligopeptidase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356572793|ref|XP_003554550.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query616
UNIPROTKB|Q8EHB8 801 SO_1310 "Serine peptidase S9 f 0.777 0.598 0.288 2.7e-50
TIGR_CMR|SO_1310 801 SO_1310 "conserved hypothetica 0.777 0.598 0.288 2.7e-50
UNIPROTKB|Q8EHB8 SO_1310 "Serine peptidase S9 family" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
 Score = 527 (190.6 bits), Expect = 2.7e-50, P = 2.7e-50
 Identities = 144/500 (28%), Positives = 235/500 (47%)

Query:    85 LNAVFG-SFVWVNNSTLLI-FTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLL 142
             LN      + W NN TLL  F I  ++     +  V + PK +    KN    R   +LL
Sbjct:   160 LNGTISLDYQWANNKTLLARFVI--AQDISASQPHVSISPKTKETSGKNSP-QRTYQDLL 216

Query:   143 KDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKV 202
             K   D+ LF   TT+QL L  L+G     G P +      SPD +Y+L   +  P+S +V
Sbjct:   217 KTSADKQLFSRLTTSQLALVDLEGKLTKIGAPGIIEDFSVSPDGQYILSRQITTPFSTQV 276

Query:   203 PCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEA 262
                 F    +++  +G+L+  L      E  P   +SV  G R   W   + +TL + +A
Sbjct:   277 KYDDFPTLTEIYNLNGQLITLLHQSQGGESRPQGKDSVLPGPRMFHWVQGQAATLAFTKA 336

Query:   263 QDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTS 322
              D+GD+  +   RD ++    +P   ++   + +   R   + W ++ LAL+ E   K  
Sbjct:   337 LDQGDSQRDAPQRDSLWL--LDPPFTQQATRVAQTQWRITDIDWAENHLALITERNSKAQ 394

Query:   323 QTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYIL 382
             Q R   +     + +   L +R   + Y D G         G   +  ++ +  +   ++
Sbjct:   395 QIRLSSLNTRLGESSLHTLNERNLRDKYQDLGL-FAKHYYPGKGQVVSLQ-QGAKTTGLI 452

Query:   383 LNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKIL 442
               G+G TP+G+ PFL    + T     +W+S   +    +V  V       +NL+ L+++
Sbjct:   453 HYGQGATPQGDKPFLKRTSLITSESSLLWQSASNRL--ESVRYV-------LNLDPLQLI 503

Query:   443 TSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLP 502
              ++ES TE     +L+    K S +   P        +QK++I ++R DGVPL+ TLYLP
Sbjct:   504 INRESPTESPSLVLLN--AAKESVLYEQPDGLSAYLGMQKQLITFKRADGVPLSGTLYLP 561

Query:   503 PGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGP 562
               Y + + G LP L WAYP ++   + AGQ+  S N++  ++P   +  +A  FAV    
Sbjct:   562 ANYTKEQ-GTLPVLMWAYPREFNDPEVAGQISFSANQYPTISPRGPIPLVAEGFAVFDKV 620

Query:   563 SIPIIGEGDKLPNDRFVEQL 582
             S+PII +GDK  ND F EQL
Sbjct:   621 SMPIIAQGDKESNDTFREQL 640
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TIGR_CMR|SO_1310 SO_1310 "conserved hypothetical protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q10MJ1CGEP_ORYSJ3, ., 4, ., 2, 1, ., -0.69380.97240.6385yesno
Q8VZF3CGEP_ARATH3, ., 4, ., 2, 1, ., -0.70280.96750.6208yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 616
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 100.0
PRK10115 686 protease 2; Provisional 99.97
KOG2281 867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 99.92
PRK04043419 tolB translocation protein TolB; Provisional 99.88
PRK01029428 tolB translocation protein TolB; Provisional 99.88
PRK03629429 tolB translocation protein TolB; Provisional 99.88
PRK05137435 tolB translocation protein TolB; Provisional 99.87
PRK04792448 tolB translocation protein TolB; Provisional 99.85
PRK02889427 tolB translocation protein TolB; Provisional 99.84
PRK01029428 tolB translocation protein TolB; Provisional 99.84
PRK05137435 tolB translocation protein TolB; Provisional 99.84
PRK04922433 tolB translocation protein TolB; Provisional 99.83
PRK00178430 tolB translocation protein TolB; Provisional 99.83
PRK03629429 tolB translocation protein TolB; Provisional 99.82
PRK04043419 tolB translocation protein TolB; Provisional 99.81
PRK04792448 tolB translocation protein TolB; Provisional 99.79
PRK01742429 tolB translocation protein TolB; Provisional 99.79
PRK02889427 tolB translocation protein TolB; Provisional 99.79
PRK04922433 tolB translocation protein TolB; Provisional 99.79
PRK00178430 tolB translocation protein TolB; Provisional 99.79
KOG2100 755 consensus Dipeptidyl aminopeptidase [Posttranslati 99.78
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.74
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.7
PRK01742429 tolB translocation protein TolB; Provisional 99.68
COG4946668 Uncharacterized protein related to the periplasmic 99.66
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.65
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.62
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 99.6
COG1770 682 PtrB Protease II [Amino acid transport and metabol 99.58
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.57
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.53
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 99.31
COG1505 648 Serine proteases of the peptidase family S9A [Amin 99.15
PF00326 213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.13
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.11
COG4946668 Uncharacterized protein related to the periplasmic 99.07
KOG2237 712 consensus Predicted serine protease [Posttranslati 99.02
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.97
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.95
PRK11028330 6-phosphogluconolactonase; Provisional 98.86
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.85
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 98.78
COG3458 321 Acetyl esterase (deacetylase) [Secondary metabolit 98.78
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.78
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.72
PF05448 320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 98.7
PRK13616591 lipoprotein LpqB; Provisional 98.64
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.62
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.61
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 98.58
PRK11028330 6-phosphogluconolactonase; Provisional 98.45
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 98.44
KOG0318603 consensus WD40 repeat stress protein/actin interac 98.43
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 98.41
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 98.4
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.39
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 98.39
KOG0293519 consensus WD40 repeat-containing protein [Function 98.37
KOG0318 603 consensus WD40 repeat stress protein/actin interac 98.31
KOG0973 942 consensus Histone transcription regulator HIRA, WD 98.29
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 98.28
PF02129 272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 98.28
PF12715 390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 98.28
KOG2314698 consensus Translation initiation factor 3, subunit 98.27
KOG0279315 consensus G protein beta subunit-like protein [Sig 98.27
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.23
PRK13616591 lipoprotein LpqB; Provisional 98.2
KOG2055514 consensus WD40 repeat protein [General function pr 98.18
PRK05077 414 frsA fermentation/respiration switch protein; Revi 98.17
KOG0293519 consensus WD40 repeat-containing protein [Function 98.16
KOG0315311 consensus G-protein beta subunit-like protein (con 98.14
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.14
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 98.13
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.11
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.09
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 98.07
KOG2055514 consensus WD40 repeat protein [General function pr 98.06
KOG1407313 consensus WD40 repeat protein [Function unknown] 98.04
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.03
PRK13604 307 luxD acyl transferase; Provisional 98.02
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 98.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 97.94
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 97.94
KOG0266456 consensus WD40 repeat-containing protein [General 97.9
KOG2139445 consensus WD40 repeat protein [General function pr 97.83
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 97.81
PRK10566 249 esterase; Provisional 97.81
KOG2314698 consensus Translation initiation factor 3, subunit 97.8
KOG0291893 consensus WD40-repeat-containing subunit of the 18 97.73
COG0412 236 Dienelactone hydrolase and related enzymes [Second 97.72
PTZ00421493 coronin; Provisional 97.68
TIGR01840 212 esterase_phb esterase, PHB depolymerase family. Th 97.66
KOG1407313 consensus WD40 repeat protein [Function unknown] 97.66
COG2936 563 Predicted acyl esterases [General function predict 97.66
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 97.65
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.64
COG3509 312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 97.62
KOG0315311 consensus G-protein beta subunit-like protein (con 97.59
KOG0279315 consensus G protein beta subunit-like protein [Sig 97.57
KOG2096420 consensus WD40 repeat protein [General function pr 97.54
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.54
KOG2315566 consensus Predicted translation initiation factor 97.53
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.52
PRK10162 318 acetyl esterase; Provisional 97.49
KOG0266456 consensus WD40 repeat-containing protein [General 97.47
PTZ00421493 coronin; Provisional 97.43
TIGR02171912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 97.42
PTZ00420568 coronin; Provisional 97.41
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 97.41
KOG0286343 consensus G-protein beta subunit [General function 97.36
PLN02298 330 hydrolase, alpha/beta fold family protein 97.32
KOG2315566 consensus Predicted translation initiation factor 97.32
PTZ00420568 coronin; Provisional 97.29
KOG0263707 consensus Transcription initiation factor TFIID, s 97.26
KOG2139445 consensus WD40 repeat protein [General function pr 97.22
PLN00181793 protein SPA1-RELATED; Provisional 97.18
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 97.14
KOG0772641 consensus Uncharacterized conserved protein, conta 97.13
KOG1274 933 consensus WD40 repeat protein [General function pr 97.13
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 97.13
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.12
COG0657 312 Aes Esterase/lipase [Lipid metabolism] 97.12
KOG0772641 consensus Uncharacterized conserved protein, conta 97.12
KOG0284464 consensus Polyadenylation factor I complex, subuni 97.11
KOG0282503 consensus mRNA splicing factor [Function unknown] 97.09
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.06
KOG1274 933 consensus WD40 repeat protein [General function pr 97.01
PF06500 411 DUF1100: Alpha/beta hydrolase of unknown function 97.0
KOG2110391 consensus Uncharacterized conserved protein, conta 96.99
PF10503 220 Esterase_phd: Esterase PHB depolymerase 96.99
PLN029191057 haloacid dehalogenase-like hydrolase family protei 96.89
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 96.86
KOG0286343 consensus G-protein beta subunit [General function 96.86
PF01738 218 DLH: Dienelactone hydrolase family; InterPro: IPR0 96.82
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 96.79
PRK10115686 protease 2; Provisional 96.78
PF00135 535 COesterase: Carboxylesterase family The prints ent 96.76
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 96.76
KOG0275508 consensus Conserved WD40 repeat-containing protein 96.75
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 96.7
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.69
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 96.68
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.68
KOG1515 336 consensus Arylacetamide deacetylase [Defense mecha 96.67
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 96.6
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 96.59
PLN029191057 haloacid dehalogenase-like hydrolase family protei 96.53
PLN02442 283 S-formylglutathione hydrolase 96.52
TIGR02821 275 fghA_ester_D S-formylglutathione hydrolase. This m 96.43
KOG0265338 consensus U5 snRNP-specific protein-like factor an 96.4
PLN00021 313 chlorophyllase 96.37
KOG0296399 consensus Angio-associated migratory cell protein 96.36
PLN00181793 protein SPA1-RELATED; Provisional 96.31
KOG0973 942 consensus Histone transcription regulator HIRA, WD 96.26
COG4099 387 Predicted peptidase [General function prediction o 96.19
KOG0645312 consensus WD40 repeat protein [General function pr 96.13
KOG2048691 consensus WD40 repeat protein [General function pr 96.07
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 96.02
KOG1273405 consensus WD40 repeat protein [General function pr 96.01
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 95.96
KOG0282503 consensus mRNA splicing factor [Function unknown] 95.9
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 95.81
PLN02872 395 triacylglycerol lipase 95.75
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 95.66
KOG4391 300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 95.58
KOG0643327 consensus Translation initiation factor 3, subunit 95.52
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 95.48
KOG0283712 consensus WD40 repeat-containing protein [Function 95.46
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 95.43
KOG0265338 consensus U5 snRNP-specific protein-like factor an 95.34
KOG0771398 consensus Prolactin regulatory element-binding pro 95.27
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 95.25
PLN02385 349 hydrolase; alpha/beta fold family protein 95.21
PRK10985 324 putative hydrolase; Provisional 95.2
KOG14451012 consensus Tumor-specific antigen (contains WD repe 95.1
KOG0263707 consensus Transcription initiation factor TFIID, s 95.09
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.04
KOG0640430 consensus mRNA cleavage stimulating factor complex 94.92
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 94.84
KOG0296399 consensus Angio-associated migratory cell protein 94.83
COG2945210 Predicted hydrolase of the alpha/beta superfamily 94.78
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 94.75
PF07859 211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 94.73
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 94.47
KOG0278334 consensus Serine/threonine kinase receptor-associa 94.47
COG3490366 Uncharacterized protein conserved in bacteria [Fun 94.45
PHA02857 276 monoglyceride lipase; Provisional 94.39
KOG0645312 consensus WD40 repeat protein [General function pr 94.26
KOG2096420 consensus WD40 repeat protein [General function pr 94.21
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 94.12
TIGR02171 912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 94.02
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 94.01
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 93.97
PLN02652 395 hydrolase; alpha/beta fold family protein 93.96
KOG0288459 consensus WD40 repeat protein TipD [General functi 93.77
COG4188 365 Predicted dienelactone hydrolase [General function 93.67
KOG14451012 consensus Tumor-specific antigen (contains WD repe 93.64
KOG2624 403 consensus Triglyceride lipase-cholesterol esterase 93.55
KOG1539910 consensus WD repeat protein [General function pred 93.36
KOG0771398 consensus Prolactin regulatory element-binding pro 93.29
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 93.28
COG4757 281 Predicted alpha/beta hydrolase [General function p 93.27
PRK02888635 nitrous-oxide reductase; Validated 93.02
KOG2110391 consensus Uncharacterized conserved protein, conta 92.95
KOG0288459 consensus WD40 repeat protein TipD [General functi 92.72
KOG0639705 consensus Transducin-like enhancer of split protei 92.55
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 92.5
COG3386307 Gluconolactonase [Carbohydrate transport and metab 92.49
KOG1516 545 consensus Carboxylesterase and related proteins [G 92.37
PRK10749 330 lysophospholipase L2; Provisional 92.26
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 92.26
KOG0284464 consensus Polyadenylation factor I complex, subuni 91.93
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 91.78
PF12740 259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 91.74
COG3204316 Uncharacterized protein conserved in bacteria [Fun 91.71
PRK02888635 nitrous-oxide reductase; Validated 91.27
COG1647 243 Esterase/lipase [General function prediction only] 91.03
KOG0639705 consensus Transducin-like enhancer of split protei 90.73
KOG1063764 consensus RNA polymerase II elongator complex, sub 90.01
KOG0275508 consensus Conserved WD40 repeat-containing protein 89.79
KOG0299479 consensus U3 snoRNP-associated protein (contains W 89.7
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 89.54
KOG0268433 consensus Sof1-like rRNA processing protein (conta 89.4
KOG0310487 consensus Conserved WD40 repeat-containing protein 89.34
COG1770 682 PtrB Protease II [Amino acid transport and metabol 89.28
KOG0283712 consensus WD40 repeat-containing protein [Function 89.24
KOG1552 258 consensus Predicted alpha/beta hydrolase [General 89.21
KOG1539910 consensus WD repeat protein [General function pred 89.1
KOG0306888 consensus WD40-repeat-containing subunit of the 18 89.0
PLN02511 388 hydrolase 88.34
KOG2048691 consensus WD40 repeat protein [General function pr 87.98
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 87.96
KOG0278334 consensus Serine/threonine kinase receptor-associa 87.74
PRK10439 411 enterobactin/ferric enterobactin esterase; Provisi 87.67
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 86.57
KOG0306888 consensus WD40-repeat-containing subunit of the 18 86.17
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 86.03
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 85.99
KOG1455 313 consensus Lysophospholipase [Lipid transport and m 85.92
KOG2106626 consensus Uncharacterized conserved protein, conta 85.66
COG3490366 Uncharacterized protein conserved in bacteria [Fun 85.63
KOG3101 283 consensus Esterase D [General function prediction 85.51
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 85.24
KOG0295406 consensus WD40 repeat-containing protein [Function 85.13
COG3391381 Uncharacterized conserved protein [Function unknow 85.07
PF02273 294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 84.88
COG0429 345 Predicted hydrolase of the alpha/beta-hydrolase fo 84.56
KOG4389 601 consensus Acetylcholinesterase/Butyrylcholinestera 84.26
KOG0295406 consensus WD40 repeat-containing protein [Function 84.13
KOG2106626 consensus Uncharacterized conserved protein, conta 84.04
KOG0289506 consensus mRNA splicing factor [General function p 83.83
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 83.34
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 82.82
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 82.72
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 82.06
KOG1273405 consensus WD40 repeat protein [General function pr 81.6
PF03583 290 LIP: Secretory lipase ; InterPro: IPR005152 This e 81.44
KOG0643327 consensus Translation initiation factor 3, subunit 81.12
PRK00870 302 haloalkane dehalogenase; Provisional 80.9
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 80.37
KOG0268433 consensus Sof1-like rRNA processing protein (conta 80.06
PRK13614573 lipoprotein LpqB; Provisional 80.03
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 80.02
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=7.9e-30  Score=278.33  Aligned_cols=157  Identities=20%  Similarity=0.267  Sum_probs=133.5

Q ss_pred             ccccCCEEEEEeecCCCCceEEEEeCCCCceeeeeeCCCCCCcccCC-ceeEEEEECCCCcEEEEEEEcCCCCCCCCCCC
Q 007140          434 INLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASL-QKEMIKYQRKDGVPLTATLYLPPGYDQSKDGP  512 (616)
Q Consensus       434 ~s~d~~~~v~~~ss~~~p~~l~~~~~~~~~~~~Lt~~~~~~~~~~~~-~~e~i~~~~~DG~~l~g~l~~P~~~~~~kk~p  512 (616)
                      |+.+++.+++.++++..|+++|+++.  ++..+++..+........+ .+|.+++++.||.+|+|||++|.++++.||| 
T Consensus       318 f~~~~~~~~~~~s~~~~p~~i~~~~~--~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~dG~~i~~~l~~P~~~~~~k~y-  394 (620)
T COG1506         318 FDVDGRKLALAYSSPTEPPEIYLYDR--GEEAKLTSSNNSGLKKVKLAEPEPVTYKSNDGETIHGWLYKPPGFDPRKKY-  394 (620)
T ss_pred             EeeCCCEEEEEecCCCCccceEEEcC--CCceEEeecccccccccccCCceEEEEEcCCCCEEEEEEecCCCCCCCCCC-
Confidence            45578999999999999999999986  5566776655554444455 9999999999999999999999999999887 


Q ss_pred             CcEEEecccCcccccccCCcccCCCCccCCCC-CchHHHHhhCCeEEEE-CCCCCccccCCCccC---ChhHHHHHHHHH
Q 007140          513 LPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMT-PTSSLIFLARRFAVLA-GPSIPIIGEGDKLPN---DRFVEQLVSSAE  587 (616)
Q Consensus       513 ~P~vv~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~q~la~~Gy~Vl~-n~R~GS~GyG~~f~~---~~~g~~~~~D~~  587 (616)
                       |+||++|+|              |....++. .+++|+||++||+|++ ||| ||+|||++|..   ++||+.+++|++
T Consensus       395 -P~i~~~hGG--------------P~~~~~~~~~~~~q~~~~~G~~V~~~n~R-GS~GyG~~F~~~~~~~~g~~~~~D~~  458 (620)
T COG1506         395 -PLIVYIHGG--------------PSAQVGYSFNPEIQVLASAGYAVLAPNYR-GSTGYGREFADAIRGDWGGVDLEDLI  458 (620)
T ss_pred             -CEEEEeCCC--------------CccccccccchhhHHHhcCCeEEEEeCCC-CCCccHHHHHHhhhhccCCccHHHHH
Confidence             899999543              32111111 2789999999999999 999 99999999997   899999999999


Q ss_pred             HHHHHHHHcCCccCCceEEEee
Q 007140          588 AAVEEVVRRGVGLPILYLNTTA  609 (616)
Q Consensus       588 ~~v~~l~~~~~vD~~ri~~~~~  609 (616)
                      +++++|.++|+||++||||++.
T Consensus       459 ~~~~~l~~~~~~d~~ri~i~G~  480 (620)
T COG1506         459 AAVDALVKLPLVDPERIGITGG  480 (620)
T ss_pred             HHHHHHHhCCCcChHHeEEecc
Confidence            9999999999999999999985

>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG4389 consensus Acetylcholinesterase/Butyrylcholinesterase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query616
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 1e-08
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 4e-05
1k32_A 1045 Tricorn protease; protein degradation, substrate g 1e-05
1k32_A1045 Tricorn protease; protein degradation, substrate g 4e-04
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 60.6 bits (146), Expect = 1e-09
 Identities = 62/449 (13%), Positives = 123/449 (27%), Gaps = 132/449 (29%)

Query: 126 SNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPD 185
            +  K+I+     D+++  +   S          +  +L           V   VE    
Sbjct: 39  QDMPKSILSKEEIDHIIMSKDAVS------GTLRLFWTL----LSKQEEMVQKFVEEVLR 88

Query: 186 QKYVLITSMHRPYSYKVPCA---RFSQKVQVWTTDG---------------KLVRELCDL 227
             Y  + S  +    + P      + ++      D                KL + L +L
Sbjct: 89  INYKFLMSPIK-TEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLEL 147

Query: 228 PPAEDIPVCYNSVREGM-------------RSISWRADKPSTLYWVEAQDRGDANVEVSP 274
            PA+++ +       G+              S   +      ++W+   +  + N   SP
Sbjct: 148 RPAKNVLID------GVLGSGKTWVALDVCLSYKVQCKMDFKIFWL---NLKNCN---SP 195

Query: 275 RDIIYTQPAEPAEGEKPEILHKLDLRFRSVSWCDDSLALVNETWYKTSQTRTWLVCPGSK 334
             ++             E+L KL  +    +W   S    N    +    +  L      
Sbjct: 196 ETVL-------------EMLQKLLYQIDP-NWTSRSDHSSNIK-LRIHSIQAELRRLLKS 240

Query: 335 DVAPRVLFDRVFENVYS-------DPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRG 387
                 L   V  NV +       +    ++  T+    V   +       I +  +   
Sbjct: 241 KPYENCLL--VLLNVQNAKAWNAFNLSCKILL-TTRFKQVTDFLSAATTTHISLDHHSMT 297

Query: 388 FTPEGNIPFLDLFDINTGSKER----------------IWESNRE-----KYFETAVALV 426
            TP+       L       + +                I ES R+       ++     V
Sbjct: 298 LTPDEV---KSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKH----V 350

Query: 427 FGQGEEDINLNQLKILTSKESKTEITQYHILS-WPLKKSSQITNFPHPYPTLASLQKEMI 485
                  I  + L +L   E +     +  LS +P   S+ I     P   L+ +  ++I
Sbjct: 351 NCDKLTTIIESSLNVLEPAEYR---KMFDRLSVFP--PSAHI-----PTILLSLIWFDVI 400

Query: 486 KYQ--------------RKDGVPLTATLY 500
           K                 K     T ++ 
Sbjct: 401 KSDVMVVVNKLHKYSLVEKQPKESTISIP 429
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Length = 347 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Length = 347 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Length = 297 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query616
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 100.0
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 100.0
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 100.0
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 100.0
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 100.0
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 100.0
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 100.0
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 100.0
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 100.0
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 100.0
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 100.0
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 100.0
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 99.91
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.87
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.82
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.81
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.81
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.81
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.8
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.78
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.75
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.74
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.74
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.73
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.73
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.7
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.69
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.66
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.61
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.61
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.6
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.59
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.55
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.53
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.53
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.52
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.5
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.49
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.47
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.46
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.44
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.4
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.4
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.36
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.35
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.34
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.34
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.31
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.27
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.26
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.21
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.19
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.19
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.17
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.15
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.12
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.1
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.1
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.07
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.06
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.06
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 99.05
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.04
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.03
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.02
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.02
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.01
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.0
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.98
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.98
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 98.96
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.96
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.94
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.93
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.93
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 98.92
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 98.89
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.87
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.87
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 98.86
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.86
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 98.86
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 98.86
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 98.86
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 98.85
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 98.84
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.83
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 98.82
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.81
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 98.8
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 98.8
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 98.8
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 98.79
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 98.79
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 98.78
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 98.78
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 98.78
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 98.78
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 98.78
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 98.77
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 98.77
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 98.76
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.75
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 98.75
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 98.75
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 98.75
4e54_B435 DNA damage-binding protein 2; beta barrel, double 98.75
4g56_B357 MGC81050 protein; protein arginine methyltransfera 98.74
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 98.74
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.72
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 98.71
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 98.7
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 98.7
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 98.68
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 98.68
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.67
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 98.67
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.67
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 98.67
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 98.66
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 98.66
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 98.65
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 98.64
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 98.63
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.62
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 98.6
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.6
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 98.59
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.59
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 98.57
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 98.57
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 98.55
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.55
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 98.55
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 98.55
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 98.54
3doh_A 380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 98.54
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.54
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 98.53
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.52
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 98.51
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.51
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 98.49
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 98.49
3jrp_A379 Fusion protein of protein transport protein SEC13 98.49
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.47
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 98.47
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 98.46
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.46
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.46
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 98.44
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 98.43
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 98.43
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.42
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 98.41
2xyi_A430 Probable histone-binding protein CAF1; transcripti 98.4
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 98.4
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 98.39
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 98.39
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.39
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 98.38
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 98.37
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.36
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 98.36
4e54_B435 DNA damage-binding protein 2; beta barrel, double 98.36
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 98.35
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 98.35
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 98.34
3f67_A 241 Putative dienelactone hydrolase; alpha-beta-alpha 98.33
2pm7_B297 Protein transport protein SEC13, protein transport 98.33
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.32
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 98.28
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 98.27
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.27
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 98.26
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 98.26
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 98.24
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.23
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 98.23
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 98.22
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 98.21
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 98.17
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.17
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 98.15
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 98.13
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 98.12
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 98.11
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 98.11
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.1
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 98.09
3jrp_A379 Fusion protein of protein transport protein SEC13 98.06
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.03
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 98.03
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 98.03
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.02
3jro_A 753 Fusion protein of protein transport protein SEC13 98.01
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 98.01
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 98.01
2xyi_A430 Probable histone-binding protein CAF1; transcripti 98.01
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 98.0
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 97.99
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.99
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 97.98
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 97.98
4ezi_A 377 Uncharacterized protein; alpha-beta hydrolases fol 97.97
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 97.97
1gkl_A 297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 97.97
2i3d_A 249 AGR_C_3351P, hypothetical protein ATU1826; structu 97.96
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 97.96
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 97.93
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.93
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 97.92
2pm7_B297 Protein transport protein SEC13, protein transport 97.92
3d0k_A 304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 97.91
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 97.91
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 97.91
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 97.9
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 97.9
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 97.88
4g4g_A 433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 97.87
3pic_A 375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 97.87
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 97.86
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.86
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 97.84
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.84
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 97.83
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 97.83
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 97.82
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 97.82
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 97.82
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.82
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.81
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 97.81
3fcx_A 282 FGH, esterase D, S-formylglutathione hydrolase; re 97.78
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 97.76
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.74
1jjf_A 268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 97.74
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 97.72
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 97.71
1zi8_A 236 Carboxymethylenebutenolidase; alpha and beta prote 97.7
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 97.7
2ece_A462 462AA long hypothetical selenium-binding protein; 97.68
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 97.67
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 97.67
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 97.67
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.67
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 97.63
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 97.63
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 97.62
2uz0_A 263 Esterase, tributyrin esterase; alpha/beta hydrolas 97.62
3v65_B386 Low-density lipoprotein receptor-related protein; 97.61
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.6
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 97.6
3v65_B386 Low-density lipoprotein receptor-related protein; 97.59
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 97.59
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 97.58
3jro_A 753 Fusion protein of protein transport protein SEC13 97.57
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 97.56
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.56
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 97.56
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.53
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 97.49
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.49
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 97.47
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.47
3ls2_A 280 S-formylglutathione hydrolase; psychrophilic organ 97.46
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 97.45
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.45
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.42
2ece_A462 462AA long hypothetical selenium-binding protein; 97.4
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 97.38
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 97.38
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.38
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 97.38
3h04_A 275 Uncharacterized protein; protein with unknown func 97.37
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.36
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.36
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 97.35
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 97.32
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 97.32
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.3
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.3
2qm0_A 275 BES; alpha-beta structure, structural genomics, PS 97.29
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.29
4b6g_A 283 Putative esterase; hydrolase, formaldehyde detoxif 97.22
1jfr_A 262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 97.21
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 97.2
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 97.2
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.18
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 97.16
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.16
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 97.15
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 97.1
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 97.09
3d59_A 383 Platelet-activating factor acetylhydrolase; secret 97.09
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.08
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.08
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.06
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 97.06
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.06
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.06
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.03
3vis_A 306 Esterase; alpha/beta-hydrolase fold, polyethylene 97.02
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.01
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 97.0
3i6y_A 280 Esterase APC40077; lipase, structural genomics, PS 96.99
3c8d_A 403 Enterochelin esterase; alpha-beta-alpha sandwich, 96.98
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 96.97
3e4d_A 278 Esterase D; S-formylglutathione hydrolase, hydrola 96.95
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.95
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 96.95
2pbl_A 262 Putative esterase/lipase/thioesterase; alpha/beta- 96.93
2qe8_A343 Uncharacterized protein; structural genomics, join 96.92
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.92
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 96.92
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 96.89
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 96.87
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.87
1r88_A 280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 96.82
2qe8_A343 Uncharacterized protein; structural genomics, join 96.81
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 96.77
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.75
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.7
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 96.58
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 96.51
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.48
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.4
2gzs_A 278 IROE protein; enterobactin, salmochelin, DFP, hydr 96.39
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.36
2fx5_A 258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 96.19
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 96.1
3llc_A 270 Putative hydrolase; structural genomics, joint cen 95.93
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 95.92
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.84
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 95.78
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 95.62
3guu_A 462 Lipase A; protein structure, hydrolase; HET: 1PE; 95.61
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 95.36
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 95.29
1ufo_A 238 Hypothetical protein TT1662; alpha-beta fold, hydr 95.27
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 95.06
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 94.8
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 94.76
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 94.75
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 94.62
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 94.53
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 94.36
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 94.29
2fp8_A322 Strictosidine synthase; six bladed beta propeller 93.97
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 93.95
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 93.92
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 93.59
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 93.44
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 93.44
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 93.35
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 93.19
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 93.14
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 93.1
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 93.01
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 92.89
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 92.78
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 92.61
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 92.54
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 92.37
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 92.28
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 92.0
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 92.0
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 91.75
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 91.65
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 91.59
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 91.57
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 91.52
3kya_A496 Putative phosphatase; structural genomics, joint c 91.18
1fj2_A 232 Protein (acyl protein thioesterase 1); alpha/beta 91.03
2p4o_A306 Hypothetical protein; putative lactonase, structur 90.89
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 90.86
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 90.85
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 90.52
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 90.48
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 90.37
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 89.86
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 89.25
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 88.97
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 88.04
2fp8_A322 Strictosidine synthase; six bladed beta propeller 87.71
1dqz_A 280 85C, protein (antigen 85-C); fibronectin, structur 87.36
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 87.3
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 87.21
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 86.33
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 85.8
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 85.76
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 85.65
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 85.04
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 84.49
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 84.08
3kya_A496 Putative phosphatase; structural genomics, joint c 83.99
4fhz_A 285 Phospholipase/carboxylesterase; alpha/beta hydrola 83.24
4fol_A 299 FGH, S-formylglutathione hydrolase; D-type esteras 83.21
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 82.72
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 82.7
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 81.91
3u0v_A 239 Lysophospholipase-like protein 1; alpha, beta hydr 81.88
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 81.65
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 81.6
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 81.24
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 81.15
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 80.88
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 80.79
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 80.74
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 80.68
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 80.51
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 80.3
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
Probab=100.00  E-value=1.1e-36  Score=344.06  Aligned_cols=474  Identities=11%  Similarity=-0.003  Sum_probs=301.4

Q ss_pred             eeEEeecCCCCCCCCceeeecCCCCC--cc--cceEEccCCCeEEEEEeeccccccCCCceeEEEEECCCCceEecccCC
Q 007140            6 GIGIHRLLPDDSLGPEKEVHGYPDGA--KI--NFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESP   81 (616)
Q Consensus         6 ~~~~~~~~~~~~~g~~~~lt~~~~~~--~~--~~~~~SPDG~~iaf~~~~~~~~~~~~~~~~l~v~~~~~g~~~~lt~~~   81 (616)
                      .|++.++..    |+.+++.......  ..  ..+.|||||++|+|..+....- -.+...++|++|+++|+.++|+...
T Consensus        37 ~i~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~Spdg~~l~~~~~~~~~~-r~~~~~~~~~~d~~~~~~~~l~~~~  111 (740)
T 4a5s_A           37 NILVFNAEY----GNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQW-RHSYTASYDIYDLNKRQLITEERIP  111 (740)
T ss_dssp             EEEEEETTT----CCEEEEECTTTTTTCCSCCCEEEECTTSSEEEEEEEEEECS-SSCEEEEEEEEETTTTEECCSSCCC
T ss_pred             cEEEEECCC----CceEEEEechhhhhhcccccceEECCCCCEEEEEECCeeeE-EEccceEEEEEECCCCcEEEcccCC
Confidence            477778754    7766664222111  12  2389999999999988631100 0022378999999999988887544


Q ss_pred             CccccccccceEEecCCcEEEEEecCCCCCCCCCcccCCCCeeeecCccccchhccccccccCCCcccceeEeccceEEE
Q 007140           82 DICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVL  161 (616)
Q Consensus        82 ~~~~~~~~~~~~wspdg~~l~~~~~~~~~~~~~~~~~~~g~~~~~~~~g~~~~~~~~~~~~~~~~d~~~~~~~~~~~l~~  161 (616)
                      ..     ...+.|||||+.|+|+.                                                  ...||+
T Consensus       112 ~~-----~~~~~~SPdG~~la~~~--------------------------------------------------~~~i~~  136 (740)
T 4a5s_A          112 NN-----TQWVTWSPVGHKLAYVW--------------------------------------------------NNDIYV  136 (740)
T ss_dssp             TT-----EEEEEECSSTTCEEEEE--------------------------------------------------TTEEEE
T ss_pred             Cc-----ceeeEECCCCCEEEEEE--------------------------------------------------CCeEEE
Confidence            32     56899999999999962                                                  135777


Q ss_pred             EeC-CCCeeecCCCCc--------------------eeeeeECCCCcEEEEEeccCCCcc--cc----------------
Q 007140          162 GSL-DGTAKDFGTPAV--------------------YTAVEPSPDQKYVLITSMHRPYSY--KV----------------  202 (616)
Q Consensus       162 ~d~-~g~~~~l~~~~~--------------------~~~~~~SpDg~~i~~~~~~~~~~~--~~----------------  202 (616)
                      +++ +|+.++|+..+.                    ...+.|||||++|+|.+.+...-.  .+                
T Consensus       137 ~~~~~~~~~~lt~~g~~~~~~~g~~~~v~~ee~~~~~~~~~wSpDg~~la~~~~d~~~v~~~~~~~~~~~~~~~~~~~~~  216 (740)
T 4a5s_A          137 KIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRV  216 (740)
T ss_dssp             ESSTTSCCEECCSCCBTTTEEESBCCHHHHHHTSSSSBCEEECTTSSEEEEEEEECTTCCEEEEEECCSTTCSSCEEEEE
T ss_pred             EECCCCceEEEcCCCCccceecCcccccccchhcCCCcceEECCCCCEEEEEEEcccCCceEEEEeecCCCCCCCcceee
Confidence            887 557777764321                    124889999999999875432100  00                


Q ss_pred             cCc-----ccCccEEEEeCCC---c---eEEEecCCCCCCCCCccccCccCCCCcceeecCCCceEEEEEeecCCCcccc
Q 007140          203 PCA-----RFSQKVQVWTTDG---K---LVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVE  271 (616)
Q Consensus       203 ~~~-----~~~~~l~~~d~~~---~---~~~~l~~~~~~~~~~~~~~~~~~~~~~~~wspdg~~~l~~~~~~d~~~~~~~  271 (616)
                      .+.     ....+|+++|+++   +   +...+.. +      ..+.+...-...+.|||||+. +++....        
T Consensus       217 ~yp~~G~~~~~~~l~v~d~~~~~~~~~~~~~~l~~-~------~~~~~~~~~~~~~~wspdg~~-~~~~~~r--------  280 (740)
T 4a5s_A          217 PYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITA-P------ASMLIGDHYLCDVTWATQERI-SLQWLRR--------  280 (740)
T ss_dssp             ECCBTTSCCCEEEEEEEETTSCCSSSCCCEEEECC-C------HHHHTSCEEEEEEEEEETTEE-EEEEEES--------
T ss_pred             cCCCCcCcCCeeEEEEEECCCCCCCCcceEEEecC-C------ccCCCCCeEEEEEEEeCCCeE-EEEEeCC--------
Confidence            000     0112789999988   6   4444432 0      000000001235789999973 4333111        


Q ss_pred             cCCCceeEeccCCCCCCCC-------ceEec-c-cccc-----ccceeecCCCceEE-EeeeccCccEEEEEEeCCCCCC
Q 007140          272 VSPRDIIYTQPAEPAEGEK-------PEILH-K-LDLR-----FRSVSWCDDSLALV-NETWYKTSQTRTWLVCPGSKDV  336 (616)
Q Consensus       272 ~~~~~~~~~~~~~~~~~g~-------~~~l~-~-~~~~-----~~~~~wspDg~~l~-~~~~~~~~~~~l~~~d~~~~~~  336 (616)
                      ......++++++   .+|+       ...+. . ....     ...+.|||||+.|+ +.+ .+.+..+||++++++  +
T Consensus       281 ~~~~~~i~~~d~---~tg~~~~~~~~~~~l~~~~~~~~v~~~~~~~p~fspDG~~l~~~~s-~~~G~~~l~~~~~~~--~  354 (740)
T 4a5s_A          281 IQNYSVMDICDY---DESSGRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIIS-NEEGYRHICYFQIDK--K  354 (740)
T ss_dssp             STTEEEEEEEEE---ETTTTEEEECGGGCEEEECSSSCSSSSSCCCCEECTTSSEEEEEEE-CTTSCEEEEEEETTC--S
T ss_pred             CCCEEEEEEEEC---CCCccccceeEEEEeeeccCCceEccCcCCCceEcCCCCEEEEEEE-cCCCceEEEEEECCC--C
Confidence            112235777776   6565       23331 1 1111     24789999999766 444 334678999999998  4


Q ss_pred             CceEEeecccccccCCCCCCCeeeCCCCCEEEEEeee--cCCcccEEEEEecCCCCCCCcceeEeeecCCCcee-eeeec
Q 007140          337 APRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKK--ENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKE-RIWES  413 (616)
Q Consensus       337 ~~~~l~~~~~~~~~~~~g~~~~~~s~dgk~l~~~~~~--~~~~~~~l~~~~~g~~~~~~~~~l~~~d~~~g~~~-~l~~~  413 (616)
                      +.+.|+.....-.        ..+..||+.|+|.+..  .+....+||                ++++++++.. +|+..
T Consensus       355 ~~~~lT~g~~~v~--------~~~~~d~~~i~f~~~~~~~~~~~~~ly----------------~v~~~g~~~~~~lt~~  410 (740)
T 4a5s_A          355 DCTFITKGTWEVI--------GIEALTSDYLYYISNEYKGMPGGRNLY----------------KIQLIDYTKVTCLSCE  410 (740)
T ss_dssp             SCEESCCSSSCEE--------EEEEECSSEEEEEESCGGGCTTCBEEE----------------EEETTEEEEEEESSTT
T ss_pred             ceEecccCCEEEE--------EEEEEeCCEEEEEEecCCCCCceeEEE----------------EEECCCCCcceeeccc
Confidence            5677765433210        1123458888888764  222233444                5677655433 45422


Q ss_pred             CCcccceeeEEeecCCCcccccccCCEEEEEeecCCCCceEEEEeCCCCceeeeeeCCCCC---CcccCC-ceeEEEEEC
Q 007140          414 NREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPY---PTLASL-QKEMIKYQR  489 (616)
Q Consensus       414 ~~~~~~~~~~~~~~~~~~~~~s~d~~~~v~~~ss~~~p~~l~~~~~~~~~~~~Lt~~~~~~---~~~~~~-~~e~i~~~~  489 (616)
                      ... .-.+..       ..+||++++++++..+++. ||.+++++..+++..+++..+...   .....+ ..+.+++ +
T Consensus       411 ~~~-~~~~~~-------~~~~S~dg~~~~~~~s~~~-~p~~~l~~~~~~~~~~~l~~n~~~~~~~~~~~~~~~~~~~~-~  480 (740)
T 4a5s_A          411 LNP-ERCQYY-------SVSFSKEAKYYQLRCSGPG-LPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFI-I  480 (740)
T ss_dssp             TST-TTBCBE-------EEEECTTSSEEEEEECSBS-SCEEEEEETTTTEEEEEEECCHHHHHHHTTEECCEEEEEEE-E
T ss_pred             cCC-CCCceE-------EEEECCCCCEEEEEeCCCC-CCEEEEEECCCCcEEEEeccChhhhhhhhhccCCccEEEEE-c
Confidence            100 001111       2568999999999999887 899999998888776666543211   111223 6788888 7


Q ss_pred             CCCcEEEEEEEcCCCCCCCCCCCCcEEEecccCcccccccCCcccCCCCccCCCCCchHHHHh-hCCeEEEE-CCCCCcc
Q 007140          490 KDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFL-ARRFAVLA-GPSIPII  567 (616)
Q Consensus       490 ~DG~~l~g~l~~P~~~~~~kk~p~P~vv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~la-~~Gy~Vl~-n~R~GS~  567 (616)
                      .||.+|+++|++|+++++++++  |+||++|+++.      .+..  ...|   ...+.++++ ++||+|+. |+| |+.
T Consensus       481 ~dg~~l~~~~~~P~~~~~~~~~--P~vv~~HGg~~------~~~~--~~~~---~~~~~~~l~~~~G~~Vv~~D~r-G~g  546 (740)
T 4a5s_A          481 LNETKFWYQMILPPHFDKSKKY--PLLLDVYAGPC------SQKA--DTVF---RLNWATYLASTENIIVASFDGR-GSG  546 (740)
T ss_dssp             ETTEEEEEEEEECTTCCTTSCE--EEEEECCCCTT------CCCC--CCCC---CCSHHHHHHHTTCCEEEEECCT-TCS
T ss_pred             cCCeEEEEEEEeCCCCCCCCCc--cEEEEECCCCc------cccc--cccc---CcCHHHHHHhcCCeEEEEEcCC-CCC
Confidence            8999999999999999887766  89999854321      1110  1223   223445566 59999999 999 999


Q ss_pred             ccCCCccC---ChhHHHHHHHHHHHHHHHHHcCCccCCceEEEee
Q 007140          568 GEGDKLPN---DRFVEQLVSSAEAAVEEVVRRGVGLPILYLNTTA  609 (616)
Q Consensus       568 GyG~~f~~---~~~g~~~~~D~~~~v~~l~~~~~vD~~ri~~~~~  609 (616)
                      ++|.+|..   ++||..+++|+++++++|++++++|++||+|.+-
T Consensus       547 ~~g~~~~~~~~~~~~~~~~~D~~~~i~~l~~~~~~d~~ri~i~G~  591 (740)
T 4a5s_A          547 YQGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGW  591 (740)
T ss_dssp             SSCHHHHGGGTTCTTSHHHHHHHHHHHHHHTSTTEEEEEEEEEEE
T ss_pred             cCChhHHHHHHhhhCcccHHHHHHHHHHHHhcCCcCCccEEEEEE
Confidence            99999875   7888899999999999999999999999999873
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 616
d2hqsa1269 b.68.4.1 (A:163-431) TolB, C-terminal domain {Esch 4e-05
d1qfma2 280 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-term 2e-04
d1mpxa2 381 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrol 6e-04
d2bgra2 258 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26 0.001
d2b9va2 385 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrol 0.002
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 0.004
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 269 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: TolB, C-terminal domain
family: TolB, C-terminal domain
domain: TolB, C-terminal domain
species: Escherichia coli [TaxId: 562]

 Score = 43.7 bits (101), Expect = 4e-05
 Identities = 34/273 (12%), Positives = 70/273 (25%), Gaps = 22/273 (8%)

Query: 44  RIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIF 103
           RIA+ V+ +           + ++D +      +  SP   +     S  W  + + L +
Sbjct: 5   RIAYVVQTNGGQFPY----ELRVSDYDGYNQFVVHRSPQPLM-----SPAWSPDGSKLAY 55

Query: 104 TIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGS 163
               S R       +  G   Q         +                       ++  +
Sbjct: 56  VTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLA 115

Query: 164 LDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRE 223
                +     +  T     PD + +  TS                  Q  T +     +
Sbjct: 116 SGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWE---GSQ 172

Query: 224 LCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSP--RDIIYTQ 281
             D   + D          G +    + D  +    V +    D    ++P    +IY+ 
Sbjct: 173 NQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSS 232

Query: 282 PAE--------PAEGEKPEILHKLDLRFRSVSW 306
                        +G     L   D + +  +W
Sbjct: 233 SQGMGSVLNLVSTDGRFKARLPATDGQVKFPAW 265
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 280 Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Length = 381 Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 258 Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Length = 385 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query616
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.8
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.78
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.77
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.77
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.75
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.73
d1xfda2 258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.66
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.65
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.65
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.62
d2bgra2 258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.58
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.56
d2hu7a2 260 Acylamino-acid-releasing enzyme, C-terminal donain 99.38
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.2
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.13
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.12
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.09
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.07
d1qfma2 280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.05
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.04
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.02
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 98.99
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 98.98
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 98.98
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.96
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.95
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.93
d1l7aa_ 318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.88
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 98.86
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 98.86
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.84
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.81
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.81
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.79
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.78
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.73
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.71
d1jkma_ 358 Carboxylesterase {Bacillus subtilis, brefeldin A e 98.7
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 98.68
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.65
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 98.61
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.6
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 98.49
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.45
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 98.44
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 98.44
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.41
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 98.4
d1dina_ 233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 98.39
d1lzla_ 317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 98.38
d1tbga_340 beta1-subunit of the signal-transducing G protein 98.35
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.35
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 98.31
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 98.27
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 98.26
d1jfra_ 260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.21
d1lnsa3 405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 98.21
d1u4na_ 308 Carboxylesterase {Alicyclobacillus acidocaldarius 98.19
d1wb4a1 273 Feruloyl esterase domain of the cellulosomal xylan 98.17
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 98.11
d1jjia_ 311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 98.05
d2gzsa1 265 Enterobactin and salmochelin hydrolase IroE {Esche 98.04
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.96
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 97.95
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.89
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 97.88
d2pbla1 261 Uncharacterized protein TM1040_2492 {Silicibacter 97.87
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 97.82
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.8
d2i3da1 218 Hypothetical protein Atu1826 {Agrobacterium tumefa 97.76
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.63
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.55
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.44
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 97.41
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.27
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 97.27
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 97.18
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 97.13
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.02
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 96.87
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 96.87
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.86
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 96.85
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 96.83
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 96.82
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 96.82
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 96.68
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 96.67
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.64
d1vkha_ 263 Putative serine hydrolase Ydr428c {Baker's yeast ( 96.63
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.5
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.46
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 96.45
d3c8da2 246 Enterochelin esterase, catalytic domain {Shigella 96.39
d1ufoa_ 238 Hypothetical protein TT1662 {Thermus thermophilus 96.37
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 96.35
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 96.09
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 96.02
d1sfra_ 288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 95.79
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.68
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 95.66
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 95.45
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.23
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 95.05
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 94.55
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 94.53
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 94.44
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 94.35
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 94.12
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 94.03
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.98
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 93.96
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 93.86
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 93.8
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 93.78
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 93.74
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 93.53
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 93.53
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 93.18
d1r88a_ 267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 92.33
d1qlwa_ 318 A novel bacterial esterase {Alcaligenes sp. [TaxId 92.14
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 91.54
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 90.75
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 90.17
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 90.14
d1dqza_ 280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 89.28
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 88.94
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 87.63
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 85.99
d1pv1a_ 299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 85.5
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 84.69
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 84.12
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 83.42
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 83.39
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 82.6
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 82.04
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 81.34
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 81.29
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 8-bladed beta-propeller
superfamily: DPP6 N-terminal domain-like
family: DPP6 N-terminal domain-like
domain: Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.80  E-value=2.5e-17  Score=171.90  Aligned_cols=356  Identities=11%  Similarity=0.019  Sum_probs=198.7

Q ss_pred             eeEEeecCCCCCCCCceeeecCCCC--CcccceEEccCCCeEEEEEeeccccccCCCceeEEEEECCCCceEecccCCCc
Q 007140            6 GIGIHRLLPDDSLGPEKEVHGYPDG--AKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDI   83 (616)
Q Consensus         6 ~~~~~~~~~~~~~g~~~~lt~~~~~--~~~~~~~~SPDG~~iaf~~~~~~~~~~~~~~~~l~v~~~~~g~~~~lt~~~~~   83 (616)
                      +|++.+++.    ++.+.+......  .....+.|||||++|+|..+.... --.+...++|++|+++++.++|+.....
T Consensus        38 ~i~~~~~~~----~~~~~l~~~~~~~~~~~~~~~~SpD~~~vl~~~~~~~~-~r~s~~~~~~i~d~~~~~~~~l~~~~~~  112 (465)
T d1xfda1          38 TVRLWNVET----NTSTVLIEGKKIESLRAIRYEISPDREYALFSYNVEPI-YQHSYTGYYVLSKIPHGDPQSLDPPEVS  112 (465)
T ss_dssp             CEEEBCGGG----CCCEEEECTTTTTTTTCSEEEECTTSSEEEEEESCCCC-SSSCCCSEEEEEESSSCCCEECCCTTCC
T ss_pred             cEEEEECCC----CCEEEEEcCccccccccceeEECCCCCeEEEEEcccce-eEeeccccEEEEEccCCceeeccCccCC
Confidence            578888765    766665432221  135677899999999997653110 0002346899999999999988644321


Q ss_pred             cccccccceEEecCCcEEEEEecCCCCCCCCCcccCCCCeeeecCccccchhccccccccCCCcccceeEeccceEEEEe
Q 007140           84 CLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGS  163 (616)
Q Consensus        84 ~~~~~~~~~~wspdg~~l~~~~~~~~~~~~~~~~~~~g~~~~~~~~g~~~~~~~~~~~~~~~~d~~~~~~~~~~~l~~~d  163 (616)
                        ...+..+.|||||+.|+|+..                                                  ..||+.+
T Consensus       113 --~~~l~~~~wSPDG~~iafv~~--------------------------------------------------~nl~~~~  140 (465)
T d1xfda1         113 --NAKLQYAGWGPKGQQLIFIFE--------------------------------------------------NNIYYCA  140 (465)
T ss_dssp             --SCCCSBCCBCSSTTCEEEEET--------------------------------------------------TEEEEES
T ss_pred             --ccccceeeeccCCceEEEEec--------------------------------------------------ceEEEEe
Confidence              112446899999999999732                                                  2344444


Q ss_pred             C-CCCeeecCCCC--------------------ceeeeeECCCCcEEEEEeccCCCc--cccc--------------Ccc
Q 007140          164 L-DGTAKDFGTPA--------------------VYTAVEPSPDQKYVLITSMHRPYS--YKVP--------------CAR  206 (616)
Q Consensus       164 ~-~g~~~~l~~~~--------------------~~~~~~~SpDg~~i~~~~~~~~~~--~~~~--------------~~~  206 (616)
                      . +++..+|+..+                    ....+.|||||++|+|...+...-  ..++              +..
T Consensus       141 ~~~~~~~~lt~~g~~~~i~nG~~d~vyeee~~~~~~a~~WSPDgk~iaf~~~D~s~V~~~~~~~~~~~~~p~~~~~~Yp~  220 (465)
T d1xfda1         141 HVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYAAINDSRVPIMELPTYTGSIYPTVKPYHYPK  220 (465)
T ss_dssp             SSSSCCEEEECCCBTTTEEEEECCHHHHHTTSSSSEEEEECTTSSEEEEEEEECTTSCEEEECCCSSSSSCCCEEEECCB
T ss_pred             cCCCceEEEecccCcceeeccccchhhhhhhccccceEEECCCCCeEEEEEecccccceeecccccccccceeeeeeccc
Confidence            4 23333333210                    123678999999999987542110  0000              100


Q ss_pred             -----cCccEEEEeCCCceEEEecCCCCCCCCCccccCccCCCCcceeecCCCceEEEEEeecCCCcccccCCCceeEec
Q 007140          207 -----FSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQ  281 (616)
Q Consensus       207 -----~~~~l~~~d~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~wspdg~~~l~~~~~~d~~~~~~~~~~~~~~~~~  281 (616)
                           ...+++++|++++....+...+. ...     ....-...+.|+||++  +++. ..+..      .....++.+
T Consensus       221 ~G~~np~~~l~v~d~~~~~~~~~~~~~~-~~~-----~~~~y~~~~~W~~d~~--~~~~-~~nR~------q~~~~i~~~  285 (465)
T d1xfda1         221 AGSENPSISLHVIGLNGPTHDLEMMPPD-DPR-----MREYYITMVKWATSTK--VAVT-WLNRA------QNVSILTLC  285 (465)
T ss_dssp             TTSCCCEEEEEEEESSSSCCCEECCCCC-CGG-----GSSEEEEEEEESSSSE--EEEE-EEETT------SCEEEEEEE
T ss_pred             cCCCCCceeEEEEecCCCcEEEEEeccC-cCc-----cccceeeeeEEcCCCe--EEEE-EEccc------cccceEEEE
Confidence                 11378899998765443322110 000     0000012468999986  3332 22211      223346666


Q ss_pred             cCCCCCCCCceEeccc--cc----cccceeecCCCceEEEee-eccCccEEEEEEeCCCC-----CCCceEEeeccc--c
Q 007140          282 PAEPAEGEKPEILHKL--DL----RFRSVSWCDDSLALVNET-WYKTSQTRTWLVCPGSK-----DVAPRVLFDRVF--E  347 (616)
Q Consensus       282 ~~~~~~~g~~~~l~~~--~~----~~~~~~wspDg~~l~~~~-~~~~~~~~l~~~d~~~~-----~~~~~~l~~~~~--~  347 (616)
                      ++   .+|+.+.+...  ..    ....+.|++||..+++.. ....++.+||++.+.+.     ....+.|+...+  .
T Consensus       286 d~---~tg~~~~~~~e~~~~wv~~~~~~p~~~~dg~~~~fi~~se~~g~~~ly~~~~~~~~~~~~~~~~~~LT~G~w~V~  362 (465)
T d1xfda1         286 DA---TTGVCTKKHEDESEAWLHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGDWDVT  362 (465)
T ss_dssp             ET---TTCCEEEEEEEECSSCCCCCCCCCEECTTSCSEEEEEEECCSSSSCEEEEEEECSSCCSSSCCCCBSCCSSSCEE
T ss_pred             cC---CCCcEEEEEEEcCCceEeccCCceeEccCCCeeEEEEeeeecccCceEEEEeccccccCCCceeEEeccCCceEE
Confidence            76   66777765432  11    235689999998644321 12235557777754321     022355654433  2


Q ss_pred             cccCCCCCCCeeeCCCCCEEEEEeeecCCcccEEEEEecCCCCCCCcceeEeeecCCCce-eeeeecCCcccceeeEEee
Q 007140          348 NVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSK-ERIWESNREKYFETAVALV  426 (616)
Q Consensus       348 ~~~~~~g~~~~~~s~dgk~l~~~~~~~~~~~~~l~~~~~g~~~~~~~~~l~~~d~~~g~~-~~l~~~~~~~~~~~~~~~~  426 (616)
                      +        .+.|+++++.|||.+...+....+||                +++++.+.. +.|+....+    ..    
T Consensus       363 ~--------i~~~d~~~~~vyF~a~~~~p~~~hly----------------~v~l~g~~~~~~lt~~~~~----~~----  410 (465)
T d1xfda1         363 K--------ILAYDEKGNKIYFLSTEDLPRRRQLY----------------SANTVGNFNRQCLSCDLVE----NC----  410 (465)
T ss_dssp             E--------EEEEETTTTEEEEEESSSCTTCCEEE----------------EECSSTTCCCBCSSTTSSS----SC----
T ss_pred             E--------EEEEcCCCCEEEEEEeCCCCCceEEE----------------EEECCCCCcceeeccccCC----CC----
Confidence            2        15678888888887754432233444                677765543 333321111    00    


Q ss_pred             cCCCcccccccCCEEEEEeecCCCCceEEEEeCCCCce-eeeeeC
Q 007140          427 FGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKS-SQITNF  470 (616)
Q Consensus       427 ~~~~~~~~s~d~~~~v~~~ss~~~p~~l~~~~~~~~~~-~~Lt~~  470 (616)
                       +.+.+.||+++++++..++.+..|+ +.+++..+++. +.|+++
T Consensus       411 -~~~~~~~S~~~~y~v~~~s~~~~P~-~~~~~~~~~~~~~~Le~N  453 (465)
T d1xfda1         411 -TYFSASFSHSMDFFLLKCEGPGVPM-VTVHNTTDKKKMFDLETN  453 (465)
T ss_dssp             -CCCEEEECTTSSEEEEECCSSSSCC-EEEEETTTCCEEEEEECC
T ss_pred             -CEEEEEECCCCCEEEEEeecCCCCe-EEEEECCCCCEEEEEcCC
Confidence             1123578999999999999998777 66777666654 456544
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure