Citrus Sinensis ID: 007208

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610---
MEQKHILLSALGVGVGVGVGLGLASGQTMSKWAGNNPSPNAVTPEKMEKELLRQIVDGRESNITFDEFPYYLSGQTRALLTSAAYVHLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFSLKIQSKYGGTNKESHFQRSPSESALERLSGLFGSFSILSQKEETQGTLRRQGSGVDITSRGTEGSFNHPALRRNASASANISNLASQSFSNTGNLKRTSSWSFDEKLLIQSIYRVLCYVSKTSPIVVYLRDVDKLIFKSQRTYNLFQKMMKKLLASVLILGSRIVDLSNDQREVDGRVTALFPYNIEIRPPEDENHLVSWKSQLEEDMKMMQAKDNRNHIMEVLSANDLDCDDLDSINVADTMVLGNYIEEIVVSAVSYHLMNNEDTDYRNGKLIISSKSLSHGLSIFQEGKASGKDTLKLEAQAEKSNEGGRKEAKGPKPAAGTEIMKPESTSEAEKSAAAPNKDGDSSVPAAAKAPEVPPDNEFEKRIRPEVIPSNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGLGKQCWPRPLPKRLGQASLMSPCLPSLPNGLVRMRRMFELYSR
cccccEEEEEccccccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccHHccccccccccccEEEEccHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHcHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccHHccccccccccHHHHHHHHHcccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEccccccHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHHHcc
ccHHHEEHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccEcccccccEccHHHHHHHHHHHHHHHHHHcHHHHHHccccccccEEcccHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccEEEEEccccccccccEEEccccccccccccccccccccHccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHcccHHHHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHccccEEccccccHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHHHHHHccccccccccccccEEEEccEEcccEEEEcccccccccEEEEEcccccccccccHHHHHccHHHHHHccccccccccEEccccccEEcccccccHHHcccccccccccccccccccccccccccHccHHHHHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHcc
MEQKHILLSALGVGVGVGVGLGLasgqtmskwagnnpspnavtpeKMEKELLRQIVDgresnitfdefpyylsgqtRALLTSAAYVHLKHTEVskytrnlspaSQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFSLKIQSkyggtnkeshfqrspseSALERLSGLFGSfsilsqkeetqgtlrrqgsgvditsrgtegsfnhpalrrnasasanisnlasqsfsntgnlkrtsswsfdEKLLIQSIYRVLCYvsktspivvYLRDVDKLIFKSQRTYNLFQKMMKKLLASVLILGSRIvdlsndqrevdgrvtalfpynieirppedenhLVSWKSQLEEDMKMMQAKDNRNHIMEVlsandldcddldsinvadtMVLGNYIEEIVVSAVSYHLmnnedtdyrngklIISSKslshglsifqegkasgkdTLKLEAQAEKsneggrkeakgpkpaagteimkpestseaeksaaapnkdgdssvpaaakapevppdnefekrirpevipsneisvtfADIGALEEIKESLQELVMlplrrpdlfkggllkpcrgillfgppglgkqcwprplpkrlgqaslmspclpslpngLVRMRRMFELYSR
MEQKHILLSALGVGVGVGVGLGLASGQTMSKWAGNNPSPNAVTPEKMEKELLRQIVDGRESNITFDEFPYYLSGQTRALLTSAAYVHLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFSLKIQSKYggtnkeshfqrSPSESALERLSGLFGSFSILSQkeetqgtlrrqgsgvditsrgtegsfnhpaLRRNASASANISNlasqsfsntgnlkrtsswsfDEKLLIQSIYRVLCYVSKTSPIVVYLRDVDKLIFKSQRTYNLFQKMMKKLLASVLILGSRIVdlsndqrevdgrVTALFpynieirppedenhlVSWKSQLEEDMKMMQAKDNRNHIMEVLSANDLDCDDLDSINVADTMVLGNYIEEIVVSAVSYHLMNNEDTDYRNGKLIISSKSLSHGLSIFQegkasgkdtLKLEAQaeksneggrkeakgpkpaagteimkpesTSEAEKSAAAPNKDGDSSVPAAakapevppdnefekrirpevipsneisVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGLGKQCWPRPLPKRlgqaslmspclpslpnglVRMRRMFELYSR
MEQKHIllsalgvgvgvgvglglasgQTMSKWAGNNPSPNAVTPEKMEKELLRQIVDGRESNITFDEFPYYLSGQTRALLTSAAYVHLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFSLKIQSKYGGTNKESHFQRSPSESALERlsglfgsfsilsQKEETQGTLRRQGSGVDITSRGTEGSFNHPalrrnasasanisnlasqsFSNTGNLKRTSSWSFDEKLLIQSIYRVLCYVSKTSPIVVYLRDVDKLIFKSQRTYNLFQKMMKKLLASVLILGSRIVDLSNDQREVDGRVTALFPYNIEIRPPEDENHLVSWKSQLEEDMKMMQAKDNRNHIMEVLSANDLDCDDLDSINVADTMVLGNYIEEIVVSAVSYHLMNNEDTDYRNGKLIISSKSLSHGLSIFQEGKASGKDTLKLEAQAEKSNEGGRKEAKGPKPAAGTEIMKPestseaeksaaaPNKDGDSSvpaaakapevppDNEFEKRIRPEVIPSNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGLGKQCWPRPLPKRLGQASLMSPCLPSLPNGLVRMRRMFELYSR
*****ILLSALGVGVGVGVGLGLASG*************************LRQIVDGRESNITFDEFPYYLSGQTRALLTSAAYVHLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFSLKIQSK*********************************************************************************************SWSFDEKLLIQSIYRVLCYVSKTSPIVVYLRDVDKLIFKSQRTYNLFQKMMKKLLASVLILGSRIVDLSNDQREVDGRVTALFPYNIEIR*****************************HIMEVLSANDLDCDDLDSINVADTMVLGNYIEEIVVSAVSYHLMNNEDTDYRNGKLIIS***************************************************************************************************SNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGLGKQCWPRPLPKRLG***LM*PCLP*L*NGLVR**********
****HIL*SALGVGVGVGVGLG***************************ELLRQIVDGRESNITFDEFPYYLSGQTRALLTSAAYVHLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDF***************************************************************************ASASANISNLASQSFSNTGNLKRTSSWSFDEKLLIQSIYRVLCYVSKTSPIVVYLRDVDKLIFKSQRTYNLFQKMMKKLLASVLILG******************ALFPYNIEIRPPEDENHLVS***********MQAKDNRNHIMEVLS***L*CDDLDSINVADTMVLGNYIEEIVVS******************************************************************************************************************IRPEVIPSNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGLGKQCWPRPLPKRLGQASLMSPCLPSLPNGLVRMRRMFELYSR
MEQKHILLSALGVGVGVGVGLGLASGQTMSKWAGNNPSPNAVTPEKMEKELLRQIVDGRESNITFDEFPYYLSGQTRALLTSAAYVHLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFSLKIQSKYG***************ALERLSGLFGSFSILSQK*************VDITSRGTEGSFNHPALRRNASASANISNLASQSFSNTGNLKRTSSWSFDEKLLIQSIYRVLCYVSKTSPIVVYLRDVDKLIFKSQRTYNLFQKMMKKLLASVLILGSRIVDLSNDQREVDGRVTALFPYNIEIRPPEDENHLVSWKSQLEEDMKMMQAKDNRNHIMEVLSANDLDCDDLDSINVADTMVLGNYIEEIVVSAVSYHLMNNEDTDYRNGKLIISSKSLSHGLSIFQEGKASGKDTLKLEAQ*********************************************************PDNEFEKRIRPEVIPSNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGLGKQCWPRPLPKRLGQASLMSPCLPSLPNGLVRMRRMFELYSR
**QKHILLSALGVGVGVGVGLGLAS***************AVTPEKMEKELLRQIVDGRESNITFDEFPYYLSGQTRALLTSAAYVHLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFSLK***************************************************GVDITSRGTEGSFNHPALRRNASASANISNLASQSFSNTGNLKRTSSWSFDEKLLIQSIYRVLCYVSKTSPIVVYLRDVDKLIFKSQRTYNLFQKMMKKLLASVLILGSRIVDLSNDQREVDGRVTALFPYNIEIRPPEDENHLVSWKSQLEEDMKMMQAKDNRNHIMEVLSANDLDCDDLDSINVADTMVLGNYIEEIVVSAVSYHLMNNEDTDYRNGKLIISSKSLSHGLSIFQEGKASGKDTLKLEAQAEKSNEGGRKEAKGPKPAAGTEIMKPESTSEAEKSAAAPNKDGDSSVPAAAKAPEVPPDNEFEKRIRPEVIPSNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGLGKQCWPRPLPKRLGQASLMSPCLPSLPNGLVRMRRMFELYS*
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQKHILLSALGVGVGVGVGLGLASGQTMSKWAGNNPSPNAVTPEKMEKELLRQIVDGRESNITFDEFPYYLSGQTRALLTSAAYVHLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFSLKIQSKYGGTNKESHFQRSPSESALERLSGLFGSFSILSQKEETQGTLRRQGSGVDITSRGTEGSFNHPALRRNASASANISNLASQSFSNTGNLKRTSSWSFDEKLLIQSIYRVLCYVSKTSPIVVYLRDVDKLIFKSQRTYNLFQKMMKKLLASVLILGSRIVDLSNDQREVDGRVTALFPYNIEIRPPEDENHLVSWKSQLEEDMKMMQAKDNRNHIMEVLSANDLDCDDLDSINVADTMVLGNYIEEIVVSAVSYHLMNNEDTDYRNGKLIISSKSLSHGLSIFQEGKASGKDTLKLEAQAEKSNEGGRKEAKGPKPAAGTEIMKPESTSEAEKSAAAPNKDGDSSVPAAAKAPEVPPDNEFEKRIRPEVIPSNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGLGKQCWPRPLPKRLGQASLMSPCLPSLPNGLVRMRRMFELYSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query613 2.2.26 [Sep-21-2011]
O43078 660 ATPase-like fidgetin OS=S yes no 0.112 0.104 0.492 6e-11
Q9P3U2 741 Uncharacterized AAA domai no no 0.119 0.098 0.493 3e-10
Q9P7J5 355 Uncharacterized AAA domai no no 0.140 0.242 0.382 6e-10
Q9QYY8 614 Spastin OS=Mus musculus G yes no 0.166 0.166 0.388 7e-10
P39955 897 Protein SAP1 OS=Saccharom yes no 0.119 0.081 0.466 8e-10
A2VDN5 614 Spastin OS=Bos taurus GN= yes no 0.164 0.164 0.403 9e-10
Q6NH92 509 AAA ATPase forming ring-s yes no 0.119 0.143 0.414 9e-10
B2RYN7 581 Spastin OS=Rattus norvegi no no 0.172 0.182 0.380 1e-09
P40328 754 Probable 26S protease sub no no 0.088 0.071 0.566 2e-09
A4IHT0 656 Fidgetin-like protein 1 O yes no 0.269 0.251 0.284 3e-09
>sp|O43078|ALF1_SCHPO ATPase-like fidgetin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alf1 PE=1 SV=1 Back     alignment and function desciption
 Score = 69.7 bits (169), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 2/71 (2%)

Query: 503 PDNEFEKRIRPEVIPSNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCRG 562
           P ++FE  I  E+I SN   V ++DI  L++ K SL+E V+ P  RP+LF+ GL +P +G
Sbjct: 357 PSSDFEYAIMNEII-SNHEPVYWSDIAGLDDAKNSLKEAVIYPFLRPELFQ-GLREPVQG 414

Query: 563 ILLFGPPGLGK 573
           +LLFGPPG GK
Sbjct: 415 MLLFGPPGTGK 425

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q9P3U2|YKX4_SCHPO Uncharacterized AAA domain-containing protein C328.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.04 PE=3 SV=1 Back     alignment and function description
>sp|Q9P7J5|YJNA_SCHPO Uncharacterized AAA domain-containing protein C24B10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.10c PE=3 SV=1 Back     alignment and function description
>sp|Q9QYY8|SPAST_MOUSE Spastin OS=Mus musculus GN=Spast PE=2 SV=3 Back     alignment and function description
>sp|P39955|SAP1_YEAST Protein SAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP1 PE=1 SV=1 Back     alignment and function description
>sp|A2VDN5|SPAST_BOVIN Spastin OS=Bos taurus GN=SPAST PE=2 SV=1 Back     alignment and function description
>sp|Q6NH92|ARC_CORDI AAA ATPase forming ring-shaped complexes OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=arc PE=3 SV=1 Back     alignment and function description
>sp|B2RYN7|SPAST_RAT Spastin OS=Rattus norvegicus GN=Spast PE=2 SV=1 Back     alignment and function description
>sp|P40328|TBP6_YEAST Probable 26S protease subunit YTA6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA6 PE=1 SV=2 Back     alignment and function description
>sp|A4IHT0|FIGL1_XENTR Fidgetin-like protein 1 OS=Xenopus tropicalis GN=fignl1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query613
356528839 834 PREDICTED: uncharacterized protein LOC10 0.960 0.706 0.702 0.0
356528837 851 PREDICTED: uncharacterized protein LOC10 0.967 0.696 0.705 0.0
356511464 845 PREDICTED: uncharacterized protein LOC10 0.967 0.701 0.687 0.0
297742262 836 unnamed protein product [Vitis vinifera] 0.951 0.697 0.720 0.0
359474308 833 PREDICTED: uncharacterized protein LOC10 0.946 0.696 0.718 0.0
255537631 796 ATP binding protein, putative [Ricinus c 0.895 0.689 0.711 0.0
297836963 827 AAA-type ATPase family protein [Arabidop 0.978 0.725 0.686 0.0
222422955 769 AT1G64110 [Arabidopsis thaliana] 0.978 0.780 0.672 0.0
30696968 829 P-loop containing nucleoside triphosphat 0.978 0.723 0.672 0.0
17065032 752 similar to homeobox protein [Arabidopsis 0.978 0.797 0.672 0.0
>gi|356528839|ref|XP_003533005.1| PREDICTED: uncharacterized protein LOC100807464 isoform 2 [Glycine max] Back     alignment and taxonomy information
 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/598 (70%), Positives = 493/598 (82%), Gaps = 9/598 (1%)

Query: 1   MEQKHILLSALGVGVGVGVGLGLASGQTMSKWAGNNPSPNAVTPEKMEKELLRQIVDGRE 60
           MEQK IL+SALGVGVGVGVG+GLASGQ++ KW  N  S NA+T EKME+E+LRQ+VDGRE
Sbjct: 1   MEQKSILISALGVGVGVGVGIGLASGQSVGKWGANTFSSNAITAEKMEQEMLRQVVDGRE 60

Query: 61  SNITFDEFPYYLSGQTRALLTSAAYVHLKHTEVSKYTRNLSPASQAILLSGPAELYQQML 120
           SN TFD+FPYYLS QTR LLTSAAYVHLKH EVSKYTRNL+PAS+ ILLSGPAELYQQML
Sbjct: 61  SNATFDKFPYYLSEQTRVLLTSAAYVHLKHAEVSKYTRNLAPASRTILLSGPAELYQQML 120

Query: 121 AKALAHFFEAKLLLLDVTDFSLKIQSKYGGTNKESHFQRSPSESALERLSGLFGSFSILS 180
           AKALAH+FEAKLLLLD+TDFSLKIQSKYG +N ES F+RS SE+ LERLS LFGSFSI S
Sbjct: 121 AKALAHYFEAKLLLLDLTDFSLKIQSKYGFSNMESSFRRSTSETTLERLSDLFGSFSIFS 180

Query: 181 QKEETQGTLRRQGSGVDITSRGTEGSFNHPALRRNASASANISNLASQSF-SNTGNLKRT 239
           Q+EE +G + R  SGVD+ S G E S N P LRRNAS+S+NIS LASQ++ +N+  LKRT
Sbjct: 181 QREEPKGKMNRPSSGVDLQSMGAEASCNPPILRRNASSSSNISGLASQTYPTNSVPLKRT 240

Query: 240 SSWSFDEKLLIQSIYRVLCYVSKTSPIVVYLRDVDKLIFKSQRTYNLFQKMMKKLLASVL 299
           +SWSFDEKLLIQS+Y+VL +VSKT PIV+YLRDVD+L++KSQR YNLFQKM+KKL   VL
Sbjct: 241 TSWSFDEKLLIQSLYKVLAFVSKTYPIVLYLRDVDRLLYKSQRIYNLFQKMLKKLSGPVL 300

Query: 300 ILGSRIVDLSNDQREVDGRVTALFPYNIEIRPPEDENHLVSWKSQLEEDMKMMQAKDNRN 359
           ILGSR++D  ND  EVD ++ +LFPYNIEIRPPEDE+HLVSWKSQLEED+KM+Q +DN+N
Sbjct: 301 ILGSRVIDSGNDYEEVDEKINSLFPYNIEIRPPEDESHLVSWKSQLEEDLKMIQVQDNKN 360

Query: 360 HIMEVLSANDLDCDDLDSINVADTMVLGNYIEEIVVSAVSYHLMNNEDTDYRNGKLIISS 419
           HIMEVL+ANDLDCDDLDSI V+DTMVL NYIEEI+VSA+SYHLM N+DT+YRNGKL+ISS
Sbjct: 361 HIMEVLAANDLDCDDLDSICVSDTMVLSNYIEEIIVSAISYHLMKNKDTEYRNGKLVISS 420

Query: 420 KSLSHGLSIFQEGKASGKDTLKLEAQAEKSNEGGRKEAKGPKPAAGTEIMKPESTSEAEK 479
            SLSH L+IF +GK+S +DT KLE QA+       +E    KP A +E   P   +EAE 
Sbjct: 421 NSLSHALNIFHKGKSSRRDTSKLEDQAQI------EEGTAMKPEAKSENAAPVKKAEAET 474

Query: 480 SAAAPNKDGDSSVPAAAKAPEVPPDNEFEKRIRPEVIPSNEISVTFADIGALEEIKESLQ 539
            ++    DG+ SVP A KA EVPPDNEFEKRIRPEVI +NEI VTF+DIGAL+E KESLQ
Sbjct: 475 LSSVGKTDGEKSVP-APKAAEVPPDNEFEKRIRPEVILANEIDVTFSDIGALDETKESLQ 533

Query: 540 ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGLGKQCWPRPLPKRLGQASLMSPCLPSL 597
           ELVMLPLRRPDLF GGLLKPCRGILLFGPPG GK    + + K  G AS ++  + ++
Sbjct: 534 ELVMLPLRRPDLFTGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAG-ASFINVSMSTI 590

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356528837|ref|XP_003533004.1| PREDICTED: uncharacterized protein LOC100807464 isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356511464|ref|XP_003524446.1| PREDICTED: uncharacterized protein LOC100815589 [Glycine max] Back     alignment and taxonomy information
>gi|297742262|emb|CBI34411.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359474308|ref|XP_003631431.1| PREDICTED: uncharacterized protein LOC100244958 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255537631|ref|XP_002509882.1| ATP binding protein, putative [Ricinus communis] gi|223549781|gb|EEF51269.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297836963|ref|XP_002886363.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata] gi|297332204|gb|EFH62622.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|222422955|dbj|BAH19462.1| AT1G64110 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30696968|ref|NP_849842.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|332196075|gb|AEE34196.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|17065032|gb|AAL32670.1| similar to homeobox protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query613
TAIR|locus:2024522 829 DAA1 "DUO1-activated ATPase 1" 0.913 0.675 0.630 6.1e-181
TAIR|locus:4010714050 829 AT5G52882 [Arabidopsis thalian 0.903 0.668 0.548 1.1e-156
TAIR|locus:2132922 830 AT4G28000 [Arabidopsis thalian 0.916 0.677 0.537 1.2e-154
TAIR|locus:2126783 1122 AT4G24860 [Arabidopsis thalian 0.151 0.082 0.526 2.3e-50
TAIR|locus:2133298 1265 AT4G02480 [Arabidopsis thalian 0.151 0.073 0.526 1.2e-46
TAIR|locus:2031005 1003 AT1G50140 [Arabidopsis thalian 0.140 0.085 0.511 3e-31
TAIR|locus:2137777 398 AT4G27680 [Arabidopsis thalian 0.132 0.203 0.487 1.8e-11
TAIR|locus:2168646 403 AT5G53540 [Arabidopsis thalian 0.112 0.171 0.542 8.7e-11
UNIPROTKB|I3LI39160 I3LI39 "Uncharacterized protei 0.092 0.356 0.551 2e-09
CGD|CAL0001067 369 orf19.4362 [Candida albicans ( 0.132 0.219 0.397 2.5e-09
TAIR|locus:2024522 DAA1 "DUO1-activated ATPase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1756 (623.2 bits), Expect = 6.1e-181, P = 6.1e-181
 Identities = 363/576 (63%), Positives = 426/576 (73%)

Query:    27 QTMSKWAGNNPSPN-AVTPEKMEKELLRQIVDGRESNITFDEFPYYLSGQTRALLTSAAY 85
             Q + KWAG N S N AVT +KMEKE+LRQ+VDGRES ITFDEFPYYLS QTR LLTSAAY
Sbjct:    27 QAVGKWAGGNSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAAY 86

Query:    86 VHLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFSLKIQ 145
             VHLKH + SKYTRNLSPAS+AILLSGPAELYQQMLAKALAHFF+AKLLLLDV DF+LKIQ
Sbjct:    87 VHLKHFDASKYTRNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKIQ 146

Query:   146 SKYGGTNKESH-FQRSPSESALERXXXXXXXXXXXXQKEETQ--GTLRRQGSGVDITSRG 202
             SKYG  N ES  F+RSPSESALE+            Q+EE++  GTLRRQ SGVDI S  
Sbjct:   147 SKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREESKAGGTLRRQSSGVDIKSSS 206

Query:   203 TEGSFNHPXXXXXXXXXXXXXXXXXXXFSNTGNLKRTSSWSFDEKLLIQSIYRVLCYVSK 262
              EGS N P                      +  LKR+SSWSFDEKLL+QS+Y+VL YVSK
Sbjct:   207 MEGSSNPPKLRRNSSAAANISNLASSSNQVSAPLKRSSSWSFDEKLLVQSLYKVLAYVSK 266

Query:   263 TSPIVVYLRDVDKLIFKSQRTYNLFQKMMKKLLASVLILGSRIVDLSN-DQREVDGRVTA 321
              +PIV+YLRDV+  +F+SQRTYNLFQK+++KL   VLILGSRIVDLS+ D +E+D +++A
Sbjct:   267 ANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSSEDAQEIDEKLSA 326

Query:   322 LFPYNIEIRPPEDENHLVSWKSQLEEDMKMMQAKDNRNHIMEVLSANDLDCDDLDSINVA 381
             +FPYNI+IRPPEDE HLVSWKSQLE DM M+Q +DNRNHIMEVLS NDL CDDL+SI+  
Sbjct:   327 VFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESISFE 386

Query:   382 DTMVLGNYIEEIVVSAVSYHLMNNEDTDYRNGKLIISSKSLSHGLSIFQEGKASGKDTLK 441
             DT VL NYIEEIVVSA+SYHLMNN+D +YRNGKL+ISS SLSHG S+F+EGKA G++ LK
Sbjct:   387 DTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSISLSHGFSLFREGKAGGREKLK 446

Query:   442 LEAQAEKSNEGGRKEAKGPKPAAGTEIMKPXXXXXXXXXXXXPNKDGDSSXXXXXXXXXX 501
              + + E S E    +A+  KP   TE +              P K+  +           
Sbjct:   447 QKTKEESSKE---VKAESIKPETKTESV------TTVSSKEEPEKEAKAEKVTPKAPEVA 497

Query:   502 XXDNEFEKRIRPEVIPSNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCR 561
               DNEFEKRIRPEVIP+ EI+VTF DIGAL+EIKESLQELVMLPLRRPDLF GGLLKPCR
Sbjct:   498 P-DNEFEKRIRPEVIPAEEINVTFKDIGALDEIKESLQELVMLPLRRPDLFTGGLLKPCR 556

Query:   562 GILLFGPPGLGKQCWPRPLPKRLGQASLMSPCLPSL 597
             GILLFGPPG GK    + + K  G AS ++  + ++
Sbjct:   557 GILLFGPPGTGKTMLAKAIAKEAG-ASFINVSMSTI 591
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0048235 "pollen sperm cell differentiation" evidence=IEP
TAIR|locus:4010714050 AT5G52882 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132922 AT4G28000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126783 AT4G24860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133298 AT4G02480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031005 AT1G50140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137777 AT4G27680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168646 AT5G53540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|I3LI39 I3LI39 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
CGD|CAL0001067 orf19.4362 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query613
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 6e-14
COG1222 406 COG1222, RPT1, ATP-dependent 26S proteasome regula 4e-11
PRK03992 389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-10
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 2e-10
TIGR03689 512 TIGR03689, pup_AAA, proteasome ATPase 2e-10
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 6e-10
TIGR01242 364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 2e-09
PTZ00454 398 PTZ00454, PTZ00454, 26S protease regulatory subuni 8e-09
PTZ00361 438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 5e-08
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 6e-07
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 9e-07
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 9e-05
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 6e-04
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 74.1 bits (182), Expect = 6e-14
 Identities = 34/74 (45%), Positives = 51/74 (68%), Gaps = 6/74 (8%)

Query: 505 NEFEKRIRPEVIPSNEIS-----VTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKP 559
           ++FE+ ++ +V+PS  +      VT  DIG LEE KE L+E +  PL+RP+LF+   L+P
Sbjct: 217 DDFEEALK-KVLPSRGVLFEDEDVTLDDIGGLEEAKEELKEAIETPLKRPELFRKLGLRP 275

Query: 560 CRGILLFGPPGLGK 573
            +G+LL+GPPG GK
Sbjct: 276 PKGVLLYGPPGTGK 289

Length = 494
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 613
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0736 953 consensus Peroxisome assembly factor 2 containing 100.0
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.97
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.97
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.94
KOG0737 386 consensus AAA+-type ATPase [Posttranslational modi 99.93
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.92
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.91
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.89
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.88
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.87
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.85
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.84
CHL00195489 ycf46 Ycf46; Provisional 99.83
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.82
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.82
PRK03992389 proteasome-activating nucleotidase; Provisional 99.81
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.81
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.81
CHL00195 489 ycf46 Ycf46; Provisional 99.81
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.8
KOG0727 408 consensus 26S proteasome regulatory complex, ATPas 99.78
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.78
KOG0738 491 consensus AAA+-type ATPase [Posttranslational modi 99.77
KOG0729 435 consensus 26S proteasome regulatory complex, ATPas 99.77
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.77
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 99.77
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.76
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.75
KOG0726 440 consensus 26S proteasome regulatory complex, ATPas 99.74
KOG0652 424 consensus 26S proteasome regulatory complex, ATPas 99.73
KOG0731774 consensus AAA+-type ATPase containing the peptidas 99.72
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.72
CHL00176638 ftsH cell division protein; Validated 99.71
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.7
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.69
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.68
KOG0728 404 consensus 26S proteasome regulatory complex, ATPas 99.68
CHL00206 2281 ycf2 Ycf2; Provisional 99.67
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.66
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.65
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.65
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.65
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.64
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.63
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 99.63
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.62
PRK03992 389 proteasome-activating nucleotidase; Provisional 99.58
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.58
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 99.56
KOG0651 388 consensus 26S proteasome regulatory complex, ATPas 99.56
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 99.56
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.54
KOG0740 428 consensus AAA+-type ATPase [Posttranslational modi 99.54
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.52
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.5
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 99.49
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.48
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.46
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.44
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.36
CHL00095 821 clpC Clp protease ATP binding subunit 99.33
CHL00176 638 ftsH cell division protein; Validated 99.32
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.31
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.28
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.23
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 99.22
PF00004132 AAA: ATPase family associated with various cellula 99.21
PRK10865 857 protein disaggregation chaperone; Provisional 99.21
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.18
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.16
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 98.97
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 98.92
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.9
CHL00181287 cbbX CbbX; Provisional 98.9
CHL00206 2281 ycf2 Ycf2; Provisional 98.83
CHL00181 287 cbbX CbbX; Provisional 98.82
KOG0743 457 consensus AAA+-type ATPase [Posttranslational modi 98.8
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.8
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 98.8
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.77
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.67
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.62
KOG0744 423 consensus AAA+-type ATPase [Posttranslational modi 98.58
PF00004132 AAA: ATPase family associated with various cellula 98.56
COG2256 436 MGS1 ATPase related to the helicase subunit of the 98.52
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.51
TIGR00763775 lon ATP-dependent protease La. This protein is ind 98.47
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.45
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 98.42
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.4
PRK00149450 dnaA chromosomal replication initiation protein; R 98.38
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 98.36
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 98.34
KOG0742 630 consensus AAA+-type ATPase [Posttranslational modi 98.29
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 98.27
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.26
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 98.25
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.25
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.25
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.23
PRK07940 394 DNA polymerase III subunit delta'; Validated 98.23
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.23
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 98.22
PHA02544316 44 clamp loader, small subunit; Provisional 98.15
KOG2028 554 consensus ATPase related to the helicase subunit o 98.14
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.13
PRK13342 413 recombination factor protein RarA; Reviewed 98.08
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.07
PRK04195482 replication factor C large subunit; Provisional 98.06
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.05
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 98.04
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.02
PRK04195 482 replication factor C large subunit; Provisional 98.0
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.0
PRK14088440 dnaA chromosomal replication initiation protein; P 97.99
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.98
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 97.98
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 97.98
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 97.92
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 97.91
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 97.91
PRK14086617 dnaA chromosomal replication initiation protein; P 97.9
CHL00095 821 clpC Clp protease ATP binding subunit 97.87
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 97.85
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 97.85
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 97.84
PLN03025 319 replication factor C subunit; Provisional 97.84
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.84
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.83
PRK13342413 recombination factor protein RarA; Reviewed 97.8
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 97.76
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.76
PHA02544 316 44 clamp loader, small subunit; Provisional 97.74
PRK12402 337 replication factor C small subunit 2; Reviewed 97.73
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.73
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.72
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.72
PRK08116268 hypothetical protein; Validated 97.71
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.71
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 97.71
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 97.71
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 97.71
PRK13341 725 recombination factor protein RarA/unknown domain f 97.7
PRK10865 857 protein disaggregation chaperone; Provisional 97.7
PRK12422445 chromosomal replication initiation protein; Provis 97.69
PF01078 206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 97.69
PRK06893229 DNA replication initiation factor; Validated 97.67
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.67
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 97.66
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.66
COG2256436 MGS1 ATPase related to the helicase subunit of the 97.65
COG0714329 MoxR-like ATPases [General function prediction onl 97.63
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 97.62
PRK12402337 replication factor C small subunit 2; Reviewed 97.6
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.6
PRK13407334 bchI magnesium chelatase subunit I; Provisional 97.58
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 97.57
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 97.57
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.56
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 97.56
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.54
PRK08084235 DNA replication initiation factor; Provisional 97.54
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.54
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 97.54
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 97.53
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.53
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.53
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 97.52
smart00382148 AAA ATPases associated with a variety of cellular 97.52
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 97.52
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 97.51
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 97.5
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.5
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.49
PLN03025319 replication factor C subunit; Provisional 97.49
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 97.48
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 97.48
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.47
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.47
PRK13341 725 recombination factor protein RarA/unknown domain f 97.46
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 97.46
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.46
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 97.46
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.45
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.44
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 97.43
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.43
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.42
PRK07940394 DNA polymerase III subunit delta'; Validated 97.42
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 97.42
PRK00440 319 rfc replication factor C small subunit; Reviewed 97.42
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 97.41
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 97.4
PRK12377248 putative replication protein; Provisional 97.39
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 97.39
PRK06620 214 hypothetical protein; Validated 97.38
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.37
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 97.36
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.36
PF05673 249 DUF815: Protein of unknown function (DUF815); Inte 97.35
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.35
PHA02244 383 ATPase-like protein 97.34
PRK08903 227 DnaA regulatory inactivator Hda; Validated 97.34
COG0606 490 Predicted ATPase with chaperone activity [Posttran 97.32
PRK08084 235 DNA replication initiation factor; Provisional 97.3
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 97.3
PTZ001121164 origin recognition complex 1 protein; Provisional 97.29
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 97.29
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 97.29
PRK06893 229 DNA replication initiation factor; Validated 97.28
PRK14087450 dnaA chromosomal replication initiation protein; P 97.28
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.27
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 97.25
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.24
KOG1942 456 consensus DNA helicase, TBP-interacting protein [R 97.23
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 97.23
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 97.22
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.21
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 97.21
PRK05642234 DNA replication initiation factor; Validated 97.19
PRK07952244 DNA replication protein DnaC; Validated 97.19
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 97.17
PRK08116268 hypothetical protein; Validated 97.16
PRK08939306 primosomal protein DnaI; Reviewed 97.15
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.12
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 97.12
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 97.11
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.09
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.06
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 97.06
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 97.05
PRK09087226 hypothetical protein; Validated 97.04
cd00464 154 SK Shikimate kinase (SK) is the fifth enzyme in th 97.03
PRK15455 644 PrkA family serine protein kinase; Provisional 97.03
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 97.03
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 97.03
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.02
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 97.0
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 96.99
PRK05564 313 DNA polymerase III subunit delta'; Validated 96.99
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 96.99
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 96.99
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 96.98
PRK07471 365 DNA polymerase III subunit delta'; Validated 96.98
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.97
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 96.95
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.94
PRK08727233 hypothetical protein; Validated 96.94
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 96.93
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 96.93
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 96.92
PRK06835329 DNA replication protein DnaC; Validated 96.92
PRK08727 233 hypothetical protein; Validated 96.92
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 96.91
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 96.9
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 96.87
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 96.87
PRK00149 450 dnaA chromosomal replication initiation protein; R 96.86
PRK05642 234 DNA replication initiation factor; Validated 96.86
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 96.85
PF07726131 AAA_3: ATPase family associated with various cellu 96.85
PRK06526 254 transposase; Provisional 96.82
PRK00411 394 cdc6 cell division control protein 6; Reviewed 96.82
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 96.81
COG0714 329 MoxR-like ATPases [General function prediction onl 96.81
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 96.81
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 96.8
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 96.8
PRK00440319 rfc replication factor C small subunit; Reviewed 96.79
PRK08181 269 transposase; Validated 96.78
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 96.77
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 96.77
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 96.76
smart00382148 AAA ATPases associated with a variety of cellular 96.74
PRK06921266 hypothetical protein; Provisional 96.74
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 96.73
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 96.71
PRK13531498 regulatory ATPase RavA; Provisional 96.68
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 96.68
PRK09112 351 DNA polymerase III subunit delta'; Validated 96.64
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 96.62
PRK06620214 hypothetical protein; Validated 96.61
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 96.6
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 96.57
PRK04132846 replication factor C small subunit; Provisional 96.56
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 96.56
KOG0745 564 consensus Putative ATP-dependent Clp-type protease 96.56
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 96.53
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 96.52
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 96.52
PRK13946 184 shikimate kinase; Provisional 96.52
PRK13765 637 ATP-dependent protease Lon; Provisional 96.51
PRK07399 314 DNA polymerase III subunit delta'; Validated 96.51
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 96.5
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.49
PRK14088 440 dnaA chromosomal replication initiation protein; P 96.48
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 96.47
PRK13948 182 shikimate kinase; Provisional 96.47
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 96.46
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 96.45
PHA00729 226 NTP-binding motif containing protein 96.43
PRK13531 498 regulatory ATPase RavA; Provisional 96.42
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.41
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.41
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 96.39
KOG3347 176 consensus Predicted nucleotide kinase/nuclear prot 96.37
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 96.36
PRK12422 445 chromosomal replication initiation protein; Provis 96.36
PLN02200 234 adenylate kinase family protein 96.31
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 96.29
PRK09183 259 transposase/IS protein; Provisional 96.27
COG0593408 DnaA ATPase involved in DNA replication initiation 96.26
PF00308 219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.25
PRK08058 329 DNA polymerase III subunit delta'; Validated 96.24
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 96.21
PHA02244383 ATPase-like protein 96.2
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 96.2
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 96.18
PRK06547 172 hypothetical protein; Provisional 96.16
PHA02624 647 large T antigen; Provisional 96.12
PRK08154 309 anaerobic benzoate catabolism transcriptional regu 96.1
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 96.1
PTZ00112 1164 origin recognition complex 1 protein; Provisional 96.08
PRK09087 226 hypothetical protein; Validated 96.07
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 96.01
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 96.0
PLN02674 244 adenylate kinase 96.0
smart00350509 MCM minichromosome maintenance proteins. 95.99
PF07726131 AAA_3: ATPase family associated with various cellu 95.99
PRK07952244 DNA replication protein DnaC; Validated 95.97
TIGR00678 188 holB DNA polymerase III, delta' subunit. At positi 95.97
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 95.95
PF13191 185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.94
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 95.9
PRK15424 538 propionate catabolism operon regulatory protein Pr 95.86
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 95.83
KOG0745564 consensus Putative ATP-dependent Clp-type protease 95.77
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 95.75
KOG1969 877 consensus DNA replication checkpoint protein CHL12 95.72
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 95.69
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.66
COG2607 287 Predicted ATPase (AAA+ superfamily) [General funct 95.63
KOG1969877 consensus DNA replication checkpoint protein CHL12 95.62
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 95.6
PRK07471365 DNA polymerase III subunit delta'; Validated 95.59
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.54
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 95.54
PLN02459 261 probable adenylate kinase 95.51
PRK15429 686 formate hydrogenlyase transcriptional activator Fh 95.46
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 95.4
PRK09112351 DNA polymerase III subunit delta'; Validated 95.39
TIGR01618 220 phage_P_loop phage nucleotide-binding protein. Thi 95.39
COG2255332 RuvB Holliday junction resolvasome, helicase subun 95.39
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.37
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.37
PF1324576 AAA_19: Part of AAA domain 95.34
PRK11608 326 pspF phage shock protein operon transcriptional ac 95.33
COG1855 604 ATPase (PilT family) [General function prediction 95.22
PRK05707328 DNA polymerase III subunit delta'; Validated 95.2
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 95.2
PRK06696 223 uridine kinase; Validated 95.16
PRK14087 450 dnaA chromosomal replication initiation protein; P 95.15
PRK05541 176 adenylylsulfate kinase; Provisional 95.12
PRK14086 617 dnaA chromosomal replication initiation protein; P 95.08
PLN02199 303 shikimate kinase 95.05
COG0470325 HolB ATPase involved in DNA replication [DNA repli 95.05
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.01
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 95.0
TIGR02237 209 recomb_radB DNA repair and recombination protein R 94.99
cd01394 218 radB RadB. The archaeal protein radB shares simila 94.92
KOG0990 360 consensus Replication factor C, subunit RFC5 [Repl 94.9
PF03969 362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 94.84
PRK05022 509 anaerobic nitric oxide reductase transcription reg 94.82
PHA02774 613 E1; Provisional 94.76
KOG2680 454 consensus DNA helicase TIP49, TBP-interacting prot 94.69
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 94.68
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 94.67
PRK12377248 putative replication protein; Provisional 94.66
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 94.66
KOG3354 191 consensus Gluconate kinase [Carbohydrate transport 94.65
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.63
PLN03210 1153 Resistant to P. syringae 6; Provisional 94.61
PRK05564313 DNA polymerase III subunit delta'; Validated 94.59
PRK14738 206 gmk guanylate kinase; Provisional 94.59
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 94.54
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 94.48
cd01129 264 PulE-GspE PulE/GspE The type II secretory pathway 94.42
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.4
TIGR03877 237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 94.36
smart00350 509 MCM minichromosome maintenance proteins. 94.35
PRK09361 225 radB DNA repair and recombination protein RadB; Pr 94.32
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 94.32
PF13173128 AAA_14: AAA domain 94.16
PF12774 231 AAA_6: Hydrolytic ATP binding site of dynein motor 94.16
TIGR03881 229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.14
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 94.07
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 94.06
PRK00771 437 signal recognition particle protein Srp54; Provisi 94.06
PRK04220 301 2-phosphoglycerate kinase; Provisional 93.99
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 93.99
PRK06067 234 flagellar accessory protein FlaH; Validated 93.96
PRK10536 262 hypothetical protein; Provisional 93.94
COG1221 403 PspF Transcriptional regulators containing an AAA- 93.94
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 93.88
cd01123 235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 93.88
PF13173128 AAA_14: AAA domain 93.87
PRK07399314 DNA polymerase III subunit delta'; Validated 93.84
PF06745 226 KaiC: KaiC; InterPro: IPR014774 This entry represe 93.81
PRK05707 328 DNA polymerase III subunit delta'; Validated 93.63
PRK08533 230 flagellar accessory protein FlaH; Reviewed 93.63
TIGR02533 486 type_II_gspE general secretory pathway protein E. 93.61
TIGR00064 272 ftsY signal recognition particle-docking protein F 93.6
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 93.52
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 93.48
PRK10416 318 signal recognition particle-docking protein FtsY; 93.46
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 93.45
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 93.42
PRK08099 399 bifunctional DNA-binding transcriptional repressor 93.4
PRK04328 249 hypothetical protein; Provisional 93.36
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 93.36
PRK08699 325 DNA polymerase III subunit delta'; Validated 93.33
cd01393 226 recA_like RecA is a bacterial enzyme which has rol 93.33
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.32
PF08298 358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 93.32
cd01130 186 VirB11-like_ATPase Type IV secretory pathway compo 93.26
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 93.22
PRK05537 568 bifunctional sulfate adenylyltransferase subunit 1 93.22
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 93.21
TIGR01526 325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 93.18
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 93.16
PF01637 234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 93.09
PLN02165 334 adenylate isopentenyltransferase 93.06
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 93.0
KOG0927614 consensus Predicted transporter (ABC superfamily) 92.95
PRK05973 237 replicative DNA helicase; Provisional 92.94
COG0593 408 DnaA ATPase involved in DNA replication initiation 92.92
PRK13764 602 ATPase; Provisional 92.89
TIGR02236 310 recomb_radA DNA repair and recombination protein R 92.86
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 92.83
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 92.78
PRK09376 416 rho transcription termination factor Rho; Provisio 92.7
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 92.7
PRK08939306 primosomal protein DnaI; Reviewed 92.65
PRK11823 446 DNA repair protein RadA; Provisional 92.64
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Pr 92.62
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 92.55
PF06414 199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 92.55
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 92.55
PRK10646153 ADP-binding protein; Provisional 92.48
TIGR02688 449 conserved hypothetical protein TIGR02688. Members 92.47
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 92.45
PRK12337 475 2-phosphoglycerate kinase; Provisional 92.44
TIGR03880 224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 92.41
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 92.36
PRK06964 342 DNA polymerase III subunit delta'; Validated 92.35
PRK08699325 DNA polymerase III subunit delta'; Validated 92.32
TIGR00376 637 DNA helicase, putative. The gene product may repre 92.28
PRK11889 436 flhF flagellar biosynthesis regulator FlhF; Provis 92.25
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 92.24
cd00983 325 recA RecA is a bacterial enzyme which has roles in 92.21
PF02562 205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 92.13
PRK12724 432 flagellar biosynthesis regulator FlhF; Provisional 92.13
PRK08058329 DNA polymerase III subunit delta'; Validated 92.11
PRK12723 388 flagellar biosynthesis regulator FlhF; Provisional 92.1
COG2204 464 AtoC Response regulator containing CheY-like recei 92.06
PRK08769 319 DNA polymerase III subunit delta'; Validated 92.01
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 91.97
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 91.96
PRK04301 317 radA DNA repair and recombination protein RadA; Va 91.95
PRK04132 846 replication factor C small subunit; Provisional 91.92
cd01128 249 rho_factor Transcription termination factor rho is 91.86
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 91.82
cd00984 242 DnaB_C DnaB helicase C terminal domain. The hexame 91.81
PF13604 196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 91.66
TIGR02782 299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 91.62
TIGR02974329 phageshock_pspF psp operon transcriptional activat 91.6
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 91.58
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 91.57
PLN02840 421 tRNA dimethylallyltransferase 91.57
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 91.5
PRK07667 193 uridine kinase; Provisional 91.47
TIGR02238 313 recomb_DMC1 meiotic recombinase Dmc1. This model d 91.39
PF04851 184 ResIII: Type III restriction enzyme, res subunit; 91.37
PTZ00202 550 tuzin; Provisional 91.35
PRK09862 506 putative ATP-dependent protease; Provisional 91.31
PRK14974 336 cell division protein FtsY; Provisional 91.28
TIGR00455 184 apsK adenylylsulfate kinase (apsK). Important resi 91.22
PRK05703 424 flhF flagellar biosynthesis regulator FlhF; Valida 91.2
PRK13833 323 conjugal transfer protein TrbB; Provisional 91.19
PF00005137 ABC_tran: ABC transporter This structure is on hol 91.19
PLN03187 344 meiotic recombination protein DMC1 homolog; Provis 91.18
PRK10867 433 signal recognition particle protein; Provisional 91.14
PRK05022509 anaerobic nitric oxide reductase transcription reg 91.11
PRK03846 198 adenylylsulfate kinase; Provisional 91.07
COG3604 550 FhlA Transcriptional regulator containing GAF, AAA 91.02
PRK06871 325 DNA polymerase III subunit delta'; Validated 90.99
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.6e-49  Score=430.87  Aligned_cols=372  Identities=22%  Similarity=0.308  Sum_probs=270.5

Q ss_pred             CCCCcccccccccccccHHHHHHHHHHHHhhcCCCcccccccCCCCCCCceEeecchhHHHHHHHHHHHhhhCCeEEEee
Q 007208           57 DGRESNITFDEFPYYLSGQTRALLTSAAYVHLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLD  136 (613)
Q Consensus        57 ~~~~i~vsf~~fpYyLse~tk~~L~~~a~~hL~~~~~~k~~~~L~~~~~~ILLsGP~e~yqe~LaKALA~~f~a~LL~lD  136 (613)
                      ...+.+|+|.+|++.  +.|-..|++-+. |++||+++.|+--  -.+++|||+||++|++++||.|+|.|+|++|+-+.
T Consensus       181 ~~~~snv~f~diGG~--d~~~~el~~li~-~i~~Pe~~~~lGv--~PprGvLlHGPPGCGKT~lA~AiAgel~vPf~~is  255 (802)
T KOG0733|consen  181 EFPESNVSFSDIGGL--DKTLAELCELII-HIKHPEVFSSLGV--RPPRGVLLHGPPGCGKTSLANAIAGELGVPFLSIS  255 (802)
T ss_pred             CCCCCCcchhhccCh--HHHHHHHHHHHH-HhcCchhHhhcCC--CCCCceeeeCCCCccHHHHHHHHhhhcCCceEeec
Confidence            456679999999999  999999999876 7999998766643  35678999999999999999999999999999998


Q ss_pred             cccchhhhhhhcCCCCCcccccCCCchhhhhhhccccCcccccccccccccccccCCCCcccccCCccCCCCCccccccC
Q 007208          137 VTDFSLKIQSKYGGTNKESHFQRSPSESALERLSGLFGSFSILSQKEETQGTLRRQGSGVDITSRGTEGSFNHPALRRNA  216 (613)
Q Consensus       137 ~~d~~~~~~~~~G~s~ke~~~~~s~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  216 (613)
                      +..+-.++                            -|                                          
T Consensus       256 ApeivSGv----------------------------SG------------------------------------------  265 (802)
T KOG0733|consen  256 APEIVSGV----------------------------SG------------------------------------------  265 (802)
T ss_pred             chhhhccc----------------------------Cc------------------------------------------
Confidence            87764111                            11                                          


Q ss_pred             ccccccccccccccCCCCCCcCCCCcchhHHHHHHHHHHHHHhhhcCCCEEEEEccchhhhhhh--------hHHHHHHH
Q 007208          217 SASANISNLASQSFSNTGNLKRTSSWSFDEKLLIQSIYRVLCYVSKTSPIVVYLRDVDKLIFKS--------QRTYNLFQ  288 (613)
Q Consensus       217 ~~~~~~~~~~~~~~~~~~~~~~~~~w~~dek~~lqaL~evl~s~s~~~P~IL~idDiD~~l~~s--------~r~~~~l~  288 (613)
                                                 +.|    +.|.|||.++....||||||||||.+-+++        .|++++|.
T Consensus       266 ---------------------------ESE----kkiRelF~~A~~~aPcivFiDeIDAI~pkRe~aqreMErRiVaQLl  314 (802)
T KOG0733|consen  266 ---------------------------ESE----KKIRELFDQAKSNAPCIVFIDEIDAITPKREEAQREMERRIVAQLL  314 (802)
T ss_pred             ---------------------------ccH----HHHHHHHHHHhccCCeEEEeecccccccchhhHHHHHHHHHHHHHH
Confidence                                       112    345567778888899999999999987775        46999999


Q ss_pred             HHHHhhc------CcEEEEeeeeccCCCCccccchHhhc--cCCceEEeCCCChHHHHHHHHHHHHHHHHHhhhhhhhhH
Q 007208          289 KMMKKLL------ASVLILGSRIVDLSNDQREVDGRVTA--LFPYNIEIRPPEDENHLVSWKSQLEEDMKMMQAKDNRNH  360 (613)
Q Consensus       289 ~~l~~l~------g~VlIiGS~~~ds~~~~~~v~~~l~~--lF~~~IeI~~P~ee~Rl~Ilk~~L~~d~k~~~~~~N~~~  360 (613)
                      ..||.++      .+|||||.     +++++.+|.+++|  +|+++|.|++|++.+|.+||+.++.. + ......++.+
T Consensus       315 t~mD~l~~~~~~g~~VlVIgA-----TnRPDslDpaLRRaGRFdrEI~l~vP~e~aR~~IL~~~~~~-l-rl~g~~d~~q  387 (802)
T KOG0733|consen  315 TSMDELSNEKTKGDPVLVIGA-----TNRPDSLDPALRRAGRFDREICLGVPSETAREEILRIICRG-L-RLSGDFDFKQ  387 (802)
T ss_pred             HhhhcccccccCCCCeEEEec-----CCCCcccCHHHhccccccceeeecCCchHHHHHHHHHHHhh-C-CCCCCcCHHH
Confidence            9999875      57999996     8899999999999  99999999999999999999988643 1 1122344445


Q ss_pred             HHHHhhcCCCCchhhhhhcccCcccchhhHHHHHHHHHHhhhhcCC-----CcccCC--------Cc--eeechh-----
Q 007208          361 IMEVLSANDLDCDDLDSINVADTMVLGNYIEEIVVSAVSYHLMNNE-----DTDYRN--------GK--LIISSK-----  420 (613)
Q Consensus       361 I~~vL~~~dl~c~dLa~l~~~d~~~~~~~ie~iV~~A~s~~l~~~~-----~~~~~~--------~~--l~is~~-----  420 (613)
                      |+  ..++|+.++||.++|....+           -|+.+++....     .|...+        ..  +.+++.     
T Consensus       388 lA--~lTPGfVGADL~AL~~~Aa~-----------vAikR~ld~~~~p~~~~~~~ed~~~~~~~~d~S~i~~~~~~~~~~  454 (802)
T KOG0733|consen  388 LA--KLTPGFVGADLMALCREAAF-----------VAIKRILDQSSSPLTKVPISEDSSNKDAEEDQSSIKITSNAERPL  454 (802)
T ss_pred             HH--hcCCCccchhHHHHHHHHHH-----------HHHHHHhhcccCccccCCccccccCCCccchhhhhhcCCcccccc
Confidence            54  35677777777776665322           12333333111     111000        01  111100     


Q ss_pred             hHHhhh--hhhhccccCCcchhHHHHhhhcccCCCcccCCCCCCCCCcccCCCCCchhhhhhcCCCCCCCCCCcccccCC
Q 007208          421 SLSHGL--SIFQEGKASGKDTLKLEAQAEKSNEGGRKEAKGPKPAAGTEIMKPESTSEAEKSAAAPNKDGDSSVPAAAKA  498 (613)
Q Consensus       421 sl~~al--~~~q~~~~~~~d~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~  498 (613)
                      +++.-+  .+.|..+..+             +                                 .           ...
T Consensus       455 ~ld~v~~~~i~~~~d~~S-------------~---------------------------------E-----------~~~  477 (802)
T KOG0733|consen  455 ELDRVVQDAILNNPDPLS-------------K---------------------------------E-----------LLE  477 (802)
T ss_pred             cHHHHHHHHHHhCCCCcC-------------h---------------------------------H-----------Hhc
Confidence            111111  0111100000             0                                 0           000


Q ss_pred             CCCCCCchHHhhh---cCCCc---cCCCCccccccccccHHHHHHHHHHHHCcCCChhhhhcCCCCCCCceeeecCCCCC
Q 007208          499 PEVPPDNEFEKRI---RPEVI---PSNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGLG  572 (613)
Q Consensus       499 ~~~~~~~e~e~~~---~~~ii---~~~~~~v~~ddIgGl~~vk~~l~e~v~~pl~~pe~~~~~~i~~~~giLL~GPPGtG  572 (613)
                      .-....++|++.+   .+...   -...|+|+|+||||+++++.+|...|.+|.+||++|+..|+.+|.||||+||||||
T Consensus       478 ~L~i~~eDF~~Al~~iQPSakREGF~tVPdVtW~dIGaL~~vR~eL~~aI~~PiK~pd~~k~lGi~~PsGvLL~GPPGCG  557 (802)
T KOG0733|consen  478 GLSIKFEDFEEALSKIQPSAKREGFATVPDVTWDDIGALEEVRLELNMAILAPIKRPDLFKALGIDAPSGVLLCGPPGCG  557 (802)
T ss_pred             cceecHHHHHHHHHhcCcchhcccceecCCCChhhcccHHHHHHHHHHHHhhhccCHHHHHHhCCCCCCceEEeCCCCcc
Confidence            1113345666533   11111   12457999999999999999999999999999999999999999999999999999


Q ss_pred             chhhhhhhHHhhCCceeeccCCC-----cchHHHHHHHHHHHHhh
Q 007208          573 KQCWPRPLPKRLGQASLMSPCLP-----SLPNGLVRMRRMFELYS  612 (613)
Q Consensus       573 KT~lAkAiA~e~g~~fi~~v~~~-----~lge~e~~Ir~IF~~A~  612 (613)
                      ||+||+|+|+|+|++|| .+.||     |+|++|+.||++|++|+
T Consensus       558 KTLlAKAVANEag~NFi-sVKGPELlNkYVGESErAVR~vFqRAR  601 (802)
T KOG0733|consen  558 KTLLAKAVANEAGANFI-SVKGPELLNKYVGESERAVRQVFQRAR  601 (802)
T ss_pred             HHHHHHHHhhhccCceE-eecCHHHHHHHhhhHHHHHHHHHHHhh
Confidence            99999999999999999 77775     78999999999999996

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query613
3vfd_A 389 Human Spastin Aaa Domain Length = 389 8e-10
4b4t_L 437 Near-Atomic Resolution Structural Model Of The Yeas 2e-09
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 2e-09
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 2e-09
2x8a_A 274 Human Nuclear Valosin Containing Protein Like (Nvl) 3e-09
2qp9_X 355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 4e-09
3cf0_A 301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 4e-09
3eih_A 340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 6e-09
3eie_A 322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 6e-09
2zam_A 444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 6e-09
3hu3_A 489 Structure Of P97 N-D1 R155h Mutant In Complex With 9e-09
2rko_A 331 Crystal Structure Of The Vps4p-Dimer Length = 331 9e-09
3hu2_A 489 Structure Of P97 N-D1 R86a Mutant In Complex With A 9e-09
3hu1_A 489 Structure Of P97 N-D1 R95g Mutant In Complex With A 1e-08
1xwi_A 322 Crystal Structure Of Vps4b Length = 322 1e-08
1e32_A 458 Structure Of The N-Terminal Domain And The D1 Aaa D 1e-08
3b9p_A 297 Spastin Length = 297 3e-08
4b4t_K 428 Near-Atomic Resolution Structural Model Of The Yeas 3e-08
3h4m_A 285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 6e-08
3d8b_A 357 Crystal Structure Of Human Fidgetin-Like Protein 1 6e-08
4b4t_M 434 Near-Atomic Resolution Structural Model Of The Yeas 1e-07
4b4t_H 467 Near-Atomic Resolution Structural Model Of The Yeas 2e-07
4b4t_I 437 Near-Atomic Resolution Structural Model Of The Yeas 1e-05
4b4t_J 405 Near-Atomic Resolution Structural Model Of The Yeas 6e-05
2ce7_A 476 Edta Treated Length = 476 7e-05
1lv7_A 257 Crystal Structure Of The Aaa Domain Of Ftsh Length 3e-04
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 3e-04
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (62%), Gaps = 2/70 (2%)
Query: 504 DNEFEKRIRPEVIPSNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCRGI 563
           D+     I  E++  N  +V F DI   +  K++LQE+V+LP  RP+LF  GL  P RG+
Sbjct: 94  DSNLANLIMNEIV-DNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFT-GLRAPARGL 151
Query: 564 LLFGPPGLGK 573
           LLFGPPG GK
Sbjct: 152 LLFGPPGNGK 161
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query613
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 2e-29
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 1e-26
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 3e-24
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 2e-22
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 7e-21
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 1e-20
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 7e-20
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 3e-16
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 5e-16
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-15
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 5e-13
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-04
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 7e-14
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 1e-07
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 2e-07
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-07
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 3e-07
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 3e-07
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 4e-07
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 1e-06
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 3e-06
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 5e-05
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
 Score =  119 bits (300), Expect = 2e-29
 Identities = 46/164 (28%), Positives = 70/164 (42%), Gaps = 9/164 (5%)

Query: 410 YRNGKLIISSKSLSHGLSIFQEGKASGKDTLKLEAQAEKSNEGGRKEAKGPKPAAGTEIM 469
            R   L  +S SL    ++ + G A      +  + +  S   G K+  GP P       
Sbjct: 7   KRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTT----- 61

Query: 470 KPESTSEAEKSAAAPNKDGDSSVPAAAKAPEVPPDNEFEKRIRPEVIPSNEISVTFADIG 529
                +        P+    ++            D+     I  E++ +   +V F DI 
Sbjct: 62  --HKGTPKTNRTNKPSTPTTATRKKKDLKNFRNVDSNLANLIMNEIVDNG-TAVKFDDIA 118

Query: 530 ALEEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGLGK 573
             +  K++LQE+V+LP  RP+LF  GL  P RG+LLFGPPG GK
Sbjct: 119 GQDLAKQALQEIVILPSLRPELFT-GLRAPARGLLLFGPPGNGK 161
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query613
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.96
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.95
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.94
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.94
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.93
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.93
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.92
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.88
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.85
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 99.83
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 99.82
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 99.82
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.82
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 99.82
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.82
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.8
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.79
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.79
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.78
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.76
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.76
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.73
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.71
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.7
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.68
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.68
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.68
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.67
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.62
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.58
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.58
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 99.57
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.57
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.57
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.56
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.55
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.53
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.52
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.52
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.51
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.5
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.44
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 99.43
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.42
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.4
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.38
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.36
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.35
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 99.33
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.31
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.3
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 99.3
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.25
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.23
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.13
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.1
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.1
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.07
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.95
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 98.9
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 98.9
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.89
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.88
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.87
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.83
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 98.79
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.73
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.72
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 98.72
2r44_A331 Uncharacterized protein; putative ATPase, structur 98.7
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 98.7
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.67
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.67
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.67
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.66
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 98.66
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 98.66
3bos_A242 Putative DNA replication factor; P-loop containing 98.61
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 98.57
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.57
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.55
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 98.54
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 98.5
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 98.49
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.48
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 98.46
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 98.44
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.44
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.41
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.36
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 98.35
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 98.34
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.34
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.3
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.29
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.29
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.27
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 98.27
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 98.21
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.21
3pvs_A 447 Replication-associated recombination protein A; ma 98.21
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 98.2
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.19
3co5_A143 Putative two-component system transcriptional RES 98.19
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.16
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.14
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 98.13
3pvs_A447 Replication-associated recombination protein A; ma 98.08
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.08
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 98.06
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.05
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.05
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 98.05
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.01
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 98.01
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 97.95
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 97.93
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 97.93
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 97.92
2chg_A 226 Replication factor C small subunit; DNA-binding pr 97.9
2r44_A 331 Uncharacterized protein; putative ATPase, structur 97.89
3kw6_A78 26S protease regulatory subunit 8; structural geno 97.86
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.83
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 97.78
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.76
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.75
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.75
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 97.73
3bos_A 242 Putative DNA replication factor; P-loop containing 97.73
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 97.73
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.71
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.71
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.7
2chq_A 319 Replication factor C small subunit; DNA-binding pr 97.65
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 97.64
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.64
2krk_A86 26S protease regulatory subunit 8; structural geno 97.6
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 97.6
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 97.59
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 97.58
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.58
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 97.54
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.49
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.47
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 97.46
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 97.44
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.41
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 97.4
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 97.39
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.37
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 97.33
2qgz_A 308 Helicase loader, putative primosome component; str 97.31
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 97.26
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.24
1tue_A 212 Replication protein E1; helicase, replication, E1E 97.23
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 97.21
3co5_A143 Putative two-component system transcriptional RES 97.21
2gno_A305 DNA polymerase III, gamma subunit-related protein; 97.13
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.13
3vaa_A 199 Shikimate kinase, SK; structural genomics, center 97.11
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 97.1
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.09
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 96.97
1ojl_A304 Transcriptional regulatory protein ZRAR; response 96.91
3iij_A 180 Coilin-interacting nuclear ATPase protein; alpha a 96.83
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 96.78
1zuh_A 168 Shikimate kinase; alpha-beta protein, transferase; 96.76
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 96.73
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 96.73
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.71
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.69
1y63_A 184 LMAJ004144AAA protein; structural genomics, protei 96.68
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.63
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.6
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.59
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 96.54
2fna_A357 Conserved hypothetical protein; structural genomic 96.54
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.49
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.49
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 96.45
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 96.45
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.41
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 96.29
1knq_A 175 Gluconate kinase; ALFA/beta structure, transferase 96.28
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 96.28
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.28
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.27
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 96.2
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 96.15
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 96.1
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.04
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 95.9
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 95.87
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 95.85
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.67
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 95.64
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 95.63
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 95.59
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 95.59
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 95.58
2grj_A 192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 95.39
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 95.23
3uie_A 200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 95.16
2fna_A 357 Conserved hypothetical protein; structural genomic 95.09
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.09
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 95.04
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 94.95
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.95
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 94.95
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 94.91
2cvh_A 220 DNA repair and recombination protein RADB; filamen 94.81
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 94.74
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 94.67
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.61
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 94.6
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 94.53
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.46
2yvu_A 186 Probable adenylyl-sulfate kinase; transferase, str 94.23
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 94.23
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 94.18
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 94.18
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 94.05
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 94.0
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 93.99
1rz3_A 201 Hypothetical protein rbstp0775; MCSG, structural g 93.96
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 93.94
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 93.86
3hdt_A 223 Putative kinase; structura genomics, PSI-2, protei 93.85
4a74_A 231 DNA repair and recombination protein RADA; hydrola 93.79
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 93.75
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.72
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 93.67
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 93.34
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 93.31
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 93.29
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 93.19
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 93.18
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 93.16
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 93.03
2z43_A 324 DNA repair and recombination protein RADA; archaea 93.02
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 93.01
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 93.0
3v9p_A 227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 92.89
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 92.87
1u94_A 356 RECA protein, recombinase A; homologous recombinat 92.77
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 92.67
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 92.61
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 92.47
3ney_A 197 55 kDa erythrocyte membrane protein; structural ge 92.38
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 92.35
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 92.33
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.3
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 92.22
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 92.21
4gp7_A 171 Metallophosphoesterase; polynucleotide kinase phos 92.2
3f8t_A506 Predicted ATPase involved in replication control, 92.2
2eyu_A 261 Twitching motility protein PILT; pilus retraction 92.15
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 92.05
1xp8_A 366 RECA protein, recombinase A; recombination, radior 92.04
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 91.9
2og2_A 359 Putative signal recognition particle receptor; nuc 91.76
1p9r_A 418 General secretion pathway protein E; bacterial typ 91.76
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 91.74
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 91.64
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 91.47
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 91.42
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 91.21
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 91.16
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 91.14
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 91.11
2ewv_A 372 Twitching motility protein PILT; pilus retraction 91.06
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 91.05
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 91.02
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 90.9
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 90.81
3tqf_A 181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 90.62
2ged_A193 SR-beta, signal recognition particle receptor beta 90.62
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 90.6
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 90.6
2qgz_A308 Helicase loader, putative primosome component; str 90.44
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 90.42
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 90.34
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 90.3
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 90.16
3io5_A 333 Recombination and repair protein; storage dimer, i 90.11
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 90.03
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 89.94
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 89.72
2r6a_A 454 DNAB helicase, replicative helicase; replication, 89.62
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 89.56
1np6_A 174 Molybdopterin-guanine dinucleotide biosynthesis pr 89.37
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 89.36
3ld9_A 223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 89.34
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 89.31
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 89.25
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 89.21
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 89.12
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 88.88
3kta_A 182 Chromosome segregation protein SMC; structural mai 88.82
4i1u_A 210 Dephospho-COA kinase; structural genomics, niaid, 88.4
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 88.38
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 88.34
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 88.09
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 87.98
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 87.98
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 87.92
1oix_A 191 RAS-related protein RAB-11A; small G protein, intr 87.91
1xjc_A 169 MOBB protein homolog; structural genomics, midwest 87.84
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 87.83
2dyk_A 161 GTP-binding protein; GTPase, ribosome-binding prot 87.79
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 87.77
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 87.74
2p5s_A 199 RAS and EF-hand domain containing; G-protein, RAB, 87.72
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 87.67
1b0u_A 262 Histidine permease; ABC transporter, transport pro 87.56
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 87.52
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 87.44
1nrj_B 218 SR-beta, signal recognition particle receptor beta 87.35
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 87.33
1z2a_A 168 RAS-related protein RAB-23; RAB GTPase, vesicular 87.26
2ce2_X 166 GTPase HRAS; signaling protein, guanine nucleotide 87.13
1kao_A 167 RAP2A; GTP-binding protein, small G protein, GDP, 87.0
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 86.98
2gxq_A 207 Heat resistant RNA dependent ATPase; RNA helicase, 86.94
3f8t_A 506 Predicted ATPase involved in replication control, 86.79
3lv8_A 236 DTMP kinase, thymidylate kinase; structural genomi 86.77
1pui_A 210 ENGB, probable GTP-binding protein ENGB; structura 86.76
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 86.76
2ghi_A 260 Transport protein; multidrug resistance protein, M 86.58
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 86.52
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 86.52
1u8z_A 168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 86.5
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 86.44
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 86.43
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 86.42
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 86.4
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 86.36
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 86.34
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 86.3
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 86.28
1sgw_A 214 Putative ABC transporter; structural genomics, P p 86.2
1g6h_A 257 High-affinity branched-chain amino acid transport 86.17
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 86.15
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 86.12
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 86.11
1ji0_A 240 ABC transporter; ATP binding protein, structural g 86.11
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 86.07
1qde_A 224 EIF4A, translation initiation factor 4A; DEAD box 86.06
1z0j_A 170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 86.06
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 86.05
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 86.03
1wms_A 177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 86.03
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 86.02
2wji_A 165 Ferrous iron transport protein B homolog; membrane 85.98
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 85.94
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 85.91
1z08_A 170 RAS-related protein RAB-21; RAB GTPase, vesicular 85.84
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 85.78
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 85.76
1ky3_A 182 GTP-binding protein YPT7P; vesicular traffic, GTP 85.73
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 85.7
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 85.7
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 85.57
1via_A175 Shikimate kinase; structural genomics, transferase 85.53
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 85.53
1r2q_A 170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 85.45
2wjg_A 188 FEOB, ferrous iron transport protein B homolog; me 85.38
3bc1_A 195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 85.34
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 85.32
3vaa_A199 Shikimate kinase, SK; structural genomics, center 85.31
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 85.27
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 85.19
1j8m_F 297 SRP54, signal recognition 54 kDa protein; signalin 85.17
2hf9_A 226 Probable hydrogenase nickel incorporation protein 85.16
2lkc_A 178 Translation initiation factor IF-2; NMR {Geobacill 85.14
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 85.12
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 85.11
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 85.07
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 85.07
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 85.03
1c1y_A 167 RAS-related protein RAP-1A; GTP-binding proteins, 85.03
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 84.94
1upt_A 171 ARL1, ADP-ribosylation factor-like protein 1; hydr 84.9
2pt7_A 330 CAG-ALFA; ATPase, protein-protein complex, type IV 84.88
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 84.83
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 84.8
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 84.65
2y8e_A 179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 84.65
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 84.64
3tw8_B 181 RAS-related protein RAB-35; longin domain, RAB GTP 84.64
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 84.63
3con_A 190 GTPase NRAS; structural genomics consortium, SGC, 84.56
2a9k_A 187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 84.42
3clv_A 208 RAB5 protein, putative; malaria, GTPase, structura 84.3
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 84.24
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 84.22
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 84.17
1z0f_A 179 RAB14, member RAS oncogene family; RAB GTPase, ves 84.11
2efe_B 181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 84.1
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 84.08
2fn4_A 181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 84.0
2oil_A 193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 83.94
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 83.94
3t1o_A 198 Gliding protein MGLA; G domain containing protein, 83.93
1m7b_A 184 RND3/RHOE small GTP-binding protein; small GTPase, 83.9
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 83.67
2bme_A 186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 83.62
2b6h_A 192 ADP-ribosylation factor 5; membrane trafficking, G 83.56
2atv_A 196 RERG, RAS-like estrogen-regulated growth inhibitor 83.43
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 83.36
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 83.22
1svi_A 195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 83.17
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 83.14
3kkq_A 183 RAS-related protein M-RAS; GTP-binding, GTPase, si 83.13
2g6b_A 180 RAS-related protein RAB-26; G-protein, GTP analogu 83.11
3ice_A 422 Transcription termination factor RHO; transcriptio 82.99
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 82.98
3tkl_A 196 RAS-related protein RAB-1A; vesicle trafficking, p 82.96
2gf9_A 189 RAS-related protein RAB-3D; G-protein, structural 82.8
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 82.77
3dz8_A 191 RAS-related protein RAB-3B; GDP, GTPase, structura 82.58
1vec_A 206 ATP-dependent RNA helicase P54; DEAD-box protein, 82.56
1x3s_A 195 RAS-related protein RAB-18; GTPase, GNP, structura 82.55
1m2o_B 190 GTP-binding protein SAR1, GTP binding protein; zin 82.51
3bwd_D 182 RAC-like GTP-binding protein ARAC6; G domain, cyto 82.49
3pqc_A 195 Probable GTP-binding protein ENGB; rossmann fold, 82.48
1moz_A 183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 82.47
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 82.33
3ihw_A 184 Centg3; RAS, centaurin, GTPase, structural genomic 82.32
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 82.32
2fu5_C 183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 82.31
1knx_A 312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 82.27
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 82.2
3c5c_A 187 RAS-like protein 12; GDP, GTPase, structural genom 82.18
1ko7_A 314 HPR kinase/phosphatase; protein kinase, phosphotra 82.13
2bov_A 206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 82.11
2xxa_A 433 Signal recognition particle protein; protein trans 82.0
3b6e_A 216 Interferon-induced helicase C domain-containing P; 81.99
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 81.93
1zbd_A 203 Rabphilin-3A; G protein, effector, RABCDR, synapti 81.93
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 81.93
2iwr_A 178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 81.88
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 81.85
1vg8_A 207 RAS-related protein RAB-7; GTP-binding protein, pr 81.84
1ksh_A 186 ARF-like protein 2; small GTPase, small GTP-bindin 81.79
2fg5_A 192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 81.79
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 81.75
1zd9_A 188 ADP-ribosylation factor-like 10B; transport protei 81.61
1z06_A 189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 81.53
2pl3_A 236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 81.45
2a5j_A 191 RAS-related protein RAB-2B; GTPase, signal transdu 81.39
3reg_A 194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 81.34
3cph_A 213 RAS-related protein SEC4; RAB GTPase, prenylation, 81.34
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 81.2
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 81.05
2bcg_Y 206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 81.0
1fzq_A 181 ADP-ribosylation factor-like protein 3; protein-GD 81.0
3oes_A 201 GTPase rhebl1; small GTPase, structural genomics, 80.74
3bor_A 237 Human initiation factor 4A-II; translation initiat 80.66
2gf0_A 199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 80.6
1tue_A212 Replication protein E1; helicase, replication, E1E 80.51
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 80.5
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 80.49
1gwn_A 205 RHO-related GTP-binding protein RHOE; GTPase, inac 80.39
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 80.31
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 80.22
1t6n_A 220 Probable ATP-dependent RNA helicase; RECA-like fol 80.21
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 80.07
1f6b_A 198 SAR1; gtpases, N-terminal helix, Mg-containing com 80.01
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
Probab=100.00  E-value=9.5e-45  Score=419.46  Aligned_cols=345  Identities=20%  Similarity=0.330  Sum_probs=276.5

Q ss_pred             cccccccccccccHHHHHHHHHHHHhhcCCCcccccccCCCCCCCceEeecchhHHHHHHHHHHHhhhCCeEEEeecccc
Q 007208           61 SNITFDEFPYYLSGQTRALLTSAAYVHLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDF  140 (613)
Q Consensus        61 i~vsf~~fpYyLse~tk~~L~~~a~~hL~~~~~~k~~~~L~~~~~~ILLsGP~e~yqe~LaKALA~~f~a~LL~lD~~d~  140 (613)
                      -+|+|+++.++  ++.+..|.+.+..+|+||++++  +--...+++|||+||+++++++||||+|+++|+.++.+|..++
T Consensus       199 ~~v~~~dIgGl--~~~~~~l~e~v~~pl~~p~~f~--~~g~~~p~GILL~GPPGTGKT~LAraiA~elg~~~~~v~~~~l  274 (806)
T 3cf2_A          199 NEVGYDDIGGC--RKQLAQIKEMVELPLRHPALFK--AIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEI  274 (806)
T ss_dssp             SSCCGGGCCSC--CTTHHHHHHHHHHHHHCCGGGT--SCCCCCCCEEEEECCTTSCHHHHHHHHHTTTTCEEEEEEHHHH
T ss_pred             CCCChhhhcCH--HHHHHHHHHHHHHHccCHHHHh--hcCCCCCCeEEEECCCCCCHHHHHHHHHHHhCCeEEEEEhHHh
Confidence            46999999999  9999999999999999999743  3223567889999999999999999999999999999999887


Q ss_pred             hhhhhhhcCCCCCcccccCCCchhhhhhhccccCcccccccccccccccccCCCCcccccCCccCCCCCccccccCcccc
Q 007208          141 SLKIQSKYGGTNKESHFQRSPSESALERLSGLFGSFSILSQKEETQGTLRRQGSGVDITSRGTEGSFNHPALRRNASASA  220 (613)
Q Consensus       141 ~~~~~~~~G~s~ke~~~~~s~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  220 (613)
                      ..++                                                                            
T Consensus       275 ~sk~----------------------------------------------------------------------------  278 (806)
T 3cf2_A          275 MSKL----------------------------------------------------------------------------  278 (806)
T ss_dssp             HSSC----------------------------------------------------------------------------
T ss_pred             hccc----------------------------------------------------------------------------
Confidence            5221                                                                            


Q ss_pred             ccccccccccCCCCCCcCCCCcchhHHHHHHHHHHHHHhhhcCCCEEEEEccchhhhhhh--------hHHHHHHHHHHH
Q 007208          221 NISNLASQSFSNTGNLKRTSSWSFDEKLLIQSIYRVLCYVSKTSPIVVYLRDVDKLIFKS--------QRTYNLFQKMMK  292 (613)
Q Consensus       221 ~~~~~~~~~~~~~~~~~~~~~w~~dek~~lqaL~evl~s~s~~~P~IL~idDiD~~l~~s--------~r~~~~l~~~l~  292 (613)
                                            ..+....++.+|+   .+.+++|+||||||+|.+...+        .++.+.|...++
T Consensus       279 ----------------------~gese~~lr~lF~---~A~~~~PsIIfIDEiDal~~~r~~~~~~~~~riv~~LL~~md  333 (806)
T 3cf2_A          279 ----------------------AGESESNLRKAFE---EAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMD  333 (806)
T ss_dssp             ----------------------TTHHHHHHHHHHH---HHTTSCSEEEEEESGGGTCCTTTTCCCTTHHHHHHHHHTHHH
T ss_pred             ----------------------chHHHHHHHHHHH---HHHHcCCeEEEEehhcccccccCCCCChHHHHHHHHHHHHHh
Confidence                                  1112233455554   5677899999999999987653        357788888888


Q ss_pred             hhc--CcEEEEeeeeccCCCCccccchHhhc--cCCceEEeCCCChHHHHHHHHHHHHHHHHHhhhhhhhhHHHHHhhcC
Q 007208          293 KLL--ASVLILGSRIVDLSNDQREVDGRVTA--LFPYNIEIRPPEDENHLVSWKSQLEEDMKMMQAKDNRNHIMEVLSAN  368 (613)
Q Consensus       293 ~l~--g~VlIiGS~~~ds~~~~~~v~~~l~~--lF~~~IeI~~P~ee~Rl~Ilk~~L~~d~k~~~~~~N~~~I~~vL~~~  368 (613)
                      .+.  ++|+|||+     +++++.+|+++++  +|+.+|+|++|+.++|.+||+.++..                +-...
T Consensus       334 g~~~~~~V~VIaa-----TN~~d~LD~ALrR~GRFd~~I~i~~Pd~~~R~~IL~~~l~~----------------~~~~~  392 (806)
T 3cf2_A          334 GLKQRAHVIVMAA-----TNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKN----------------MKLAD  392 (806)
T ss_dssp             HCCGGGCEEEEEE-----CSSTTTSCTTTTSTTSSCEEEECCCCCHHHHHHHHHHTCSS----------------SEECT
T ss_pred             cccccCCEEEEEe-----cCChhhcCHHHhCCcccceEEecCCCCHHHHHHHHHHHhcC----------------CCCCc
Confidence            875  56889986     7788999999998  99999999999999999999987532                11235


Q ss_pred             CCCchhhhhhcccCcccchhhHHHHHHHHHHhhhhcCCC------ccc---CCCceeechhhHHhhhhhhhccccCCcch
Q 007208          369 DLDCDDLDSINVADTMVLGNYIEEIVVSAVSYHLMNNED------TDY---RNGKLIISSKSLSHGLSIFQEGKASGKDT  439 (613)
Q Consensus       369 dl~c~dLa~l~~~d~~~~~~~ie~iV~~A~s~~l~~~~~------~~~---~~~~l~is~~sl~~al~~~q~~~~~~~d~  439 (613)
                      +++...|+..|.+   |++++|..+|..|..+++.+..+      ...   ....+.++.+||..|+..++         
T Consensus       393 dvdl~~lA~~T~G---fsgaDL~~Lv~eA~~~A~~r~~~~i~~~~~~~~~e~~~~~~v~~~Df~~Al~~~~---------  460 (806)
T 3cf2_A          393 DVDLEQVANETHG---HVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSN---------  460 (806)
T ss_dssp             TCCHHHHHHHCCS---CCHHHHHHHHHHHHHHHHHHHHHHGGGTCCCCSHHHHHHCEECTTHHHHHHSSSS---------
T ss_pred             ccCHHHHHHhcCC---CCHHHHHHHHHHHHHHHHHhccccccccccccchhhhccceeeHHHHHHHHHhCC---------
Confidence            6777788888888   99999999998887766543211      000   01357899999999996321         


Q ss_pred             hHHHHhhhcccCCCcccCCCCCCCCCcccCCCCCchhhhhhcCCCCCCCCCCcccccCCCCCCCCchHHhhhcCCCccCC
Q 007208          440 LKLEAQAEKSNEGGRKEAKGPKPAAGTEIMKPESTSEAEKSAAAPNKDGDSSVPAAAKAPEVPPDNEFEKRIRPEVIPSN  519 (613)
Q Consensus       440 ~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~e~e~~~~~~ii~~~  519 (613)
                                      |.                                       ..              .. +...
T Consensus       461 ----------------ps---------------------------------------~~--------------r~-~~~~  470 (806)
T 3cf2_A          461 ----------------PS---------------------------------------AL--------------RE-TVVE  470 (806)
T ss_dssp             ----------------CC---------------------------------------CC--------------CC-CCCB
T ss_pred             ----------------Cc---------------------------------------cc--------------cc-cccc
Confidence                            00                                       00              00 1223


Q ss_pred             CCccccccccccHHHHHHHHHHHHCcCCChhhhhcCCCCCCCceeeecCCCCCchhhhhhhHHhhCCceeec----cCCC
Q 007208          520 EISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGLGKQCWPRPLPKRLGQASLMS----PCLP  595 (613)
Q Consensus       520 ~~~v~~ddIgGl~~vk~~l~e~v~~pl~~pe~~~~~~i~~~~giLL~GPPGtGKT~lAkAiA~e~g~~fi~~----v~~~  595 (613)
                      .|+++|+||||++++|+.|++.+.+|+++|++|...++.+++|+|||||||||||++|+|+|+++++||+..    +.++
T Consensus       471 ~p~v~w~diggl~~~k~~l~e~v~~p~~~p~~f~~~g~~~~~gvLl~GPPGtGKT~lAkaiA~e~~~~f~~v~~~~l~s~  550 (806)
T 3cf2_A          471 VPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTM  550 (806)
T ss_dssp             CCCCCSTTCCSCHHHHHHHTTTTTTTTTCSGGGSSSCCCCCSCCEEESSTTSSHHHHHHHHHHTTTCEEEECCHHHHHTT
T ss_pred             CCCCCHHHhCCHHHHHHHHHHHHHhhhhCHHHHHhcCCCCCceEEEecCCCCCchHHHHHHHHHhCCceEEeccchhhcc
Confidence            468999999999999999999999999999999999999999999999999999999999999999999932    3457


Q ss_pred             cchHHHHHHHHHHHHhhC
Q 007208          596 SLPNGLVRMRRMFELYSR  613 (613)
Q Consensus       596 ~lge~e~~Ir~IF~~A~r  613 (613)
                      |+|+++++||++|+.|++
T Consensus       551 ~vGese~~vr~lF~~Ar~  568 (806)
T 3cf2_A          551 WFGESEANVREIFDKARQ  568 (806)
T ss_dssp             TCSSCHHHHHHHHHHHHT
T ss_pred             ccchHHHHHHHHHHHHHH
Confidence            899999999999999974
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 613
d1e32a2 258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 9e-19
d1r7ra3 265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 5e-17
d1lv7a_ 256 c.37.1.20 (A:) AAA domain of cell division protein 6e-16
d1ixza_ 247 c.37.1.20 (A:) AAA domain of cell division protein 2e-14
d1ixsb2 239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 8e-05
d1sxja2 253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 2e-04
d1d2na_ 246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 4e-04
d1ofha_ 309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 0.001
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 84.3 bits (207), Expect = 9e-19
 Identities = 34/91 (37%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 523 VTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGLGKQCWPRPLPK 582
           V + D+G   +    ++E+V LPLR P LFK   +KP RGILL+GPPG GK    R +  
Sbjct: 1   VGYDDVGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVAN 60

Query: 583 RLGQA--SLMSPCLPSLPNG--LVRMRRMFE 609
             G     +  P + S   G     +R+ FE
Sbjct: 61  ETGAFFFLINGPEIMSKLAGESESNLRKAFE 91
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query613
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.92
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.91
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.91
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.87
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 99.75
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 99.74
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.74
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.67
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.48
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.36
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 99.19
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.1
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.05
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 99.05
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.04
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 98.99
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.89
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 98.74
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 98.74
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.7
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.68
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.43
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.39
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 98.35
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 98.28
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.27
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.24
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 98.23
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.23
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 98.2
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.17
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.14
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.13
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 98.12
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 98.11
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.11
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 98.1
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 98.06
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.06
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.04
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 97.95
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 97.88
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 97.83
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.81
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.78
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 97.77
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.77
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 97.77
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.69
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 97.55
d1svma_362 Papillomavirus large T antigen helicase domain {Si 97.53
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 97.48
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.39
d1knqa_ 171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.36
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.33
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.3
d1y63a_ 174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.23
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.19
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.16
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 97.08
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.04
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.03
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 96.9
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.85
d1yj5a2 172 5' polynucleotide kinase-3' phosphatase, C-termina 96.75
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.67
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.6
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.52
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.34
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.23
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.02
d2gnoa2 198 gamma subunit of DNA polymerase III, N-domain {The 95.95
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.73
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 95.56
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.35
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 95.31
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 95.22
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 95.15
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.12
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 95.11
d1tuea_205 Replication protein E1 helicase domain {Human papi 94.83
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 94.73
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.02
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 93.89
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 93.83
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 93.79
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 93.46
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.46
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.04
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 92.87
d1kkma_ 176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.71
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 92.62
d1j8yf2 211 GTPase domain of the signal sequence recognition p 92.35
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 92.29
d1vmaa2 213 GTPase domain of the signal recognition particle r 92.17
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 92.06
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 91.81
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 91.77
d2qy9a2 211 GTPase domain of the signal recognition particle r 91.68
d1ls1a2 207 GTPase domain of the signal sequence recognition p 91.64
d1knxa2 177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 91.36
d1ko7a2 169 HPr kinase HprK C-terminal domain {Staphylococcus 91.07
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 90.58
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 90.56
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 90.4
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 90.12
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 90.11
d1g6oa_ 323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 90.0
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 89.76
d2vp4a1 197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.42
d1upta_ 169 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.34
d1ksha_ 165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.9
d1f6ba_ 186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 88.21
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 88.15
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 87.82
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 87.72
d1zj6a1 177 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.62
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 87.6
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 87.47
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 87.44
d1zd9a1 164 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.12
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 87.0
d1sgwa_ 200 Putative ABC transporter PF0895 {Pyrococcus furios 86.92
d2awna2 232 Maltose transport protein MalK, N-terminal domain 86.47
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 86.42
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 86.32
d1z2aa1 164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 86.31
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 86.12
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 86.12
d3raba_ 169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 86.01
d1z0fa1 166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 85.94
d1g2912 240 Maltose transport protein MalK, N-terminal domain 85.93
d1kaoa_ 167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 85.9
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 85.81
d2ew1a1 171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 85.74
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 85.7
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 85.51
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 85.43
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 85.35
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 85.28
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 85.18
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 85.15
d1fzqa_ 176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 84.91
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 84.67
d1ctqa_ 166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 84.45
d1z08a1 167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 84.44
d1r2qa_ 170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 84.42
d2erya1 171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 84.41
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 84.3
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 84.21
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 83.99
d1z06a1 165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 83.96
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 83.92
d2g6ba1 170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 83.79
d2gj8a1 161 Probable tRNA modification GTPase TrmE (MnmE), G d 83.65
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 83.6
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 83.21
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 83.2
d2bmea1 174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 83.14
d1xtqa1 167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 83.14
d1x3sa1 177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 83.08
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.02
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 83.0
d2fu5c1 173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 82.92
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 82.74
d1e0sa_ 173 ADP-ribosylation factor {Human (Homo sapiens), ARF 82.72
d1wmsa_ 174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 82.56
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 82.44
d2fn4a1 173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 82.42
d2eyqa3 233 Transcription-repair coupling factor, TRCF {Escher 82.26
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 81.7
d1puia_ 188 Probable GTPase EngB {Escherichia coli [TaxId: 562 81.5
d1moza_ 182 ADP-ribosylation factor {Baker's yeast (Saccharomy 81.26
d1svia_ 195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 81.24
d1z0ja1 167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 81.11
d1c1ya_ 167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 80.79
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 80.59
d1x1ra1 169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 80.38
d2g9na1 218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 80.25
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=99.92  E-value=8.5e-25  Score=220.38  Aligned_cols=235  Identities=14%  Similarity=0.231  Sum_probs=179.4

Q ss_pred             cCCCCcccccccccccccHHHHHHHHHHHHhhcCCCcccccccCCCCCCCceEeecchhHHHHHHHHHHHhhhCCeEEEe
Q 007208           56 VDGRESNITFDEFPYYLSGQTRALLTSAAYVHLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLL  135 (613)
Q Consensus        56 v~~~~i~vsf~~fpYyLse~tk~~L~~~a~~hL~~~~~~k~~~~L~~~~~~ILLsGP~e~yqe~LaKALA~~f~a~LL~l  135 (613)
                      +..++++|||+++-.+  |++|+.|.+.+. .+++++.  |.+.=.+.++.|||+||+++++++||||||++.+.+++.+
T Consensus         2 ~~~~~~~~t~~Di~Gl--~~~k~~l~e~v~-~~~~~~~--~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i   76 (256)
T d1lv7a_           2 LTEDQIKTTFADVAGC--DEAKEEVAELVE-YLREPSR--FQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTI   76 (256)
T ss_dssp             EEECSSCCCGGGSCSC--HHHHHHTHHHHH-HHHCGGG--C-----CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEE
T ss_pred             CCCCCCCCCHHHHhch--HHHHHHHHHHHH-HHHCHHH--HHHcCCCCCCeEEeeCCCCCCccHHHHHHHHHcCCCEEEE
Confidence            4567899999999999  999999999765 4888764  3332234567899999999999999999999999999999


Q ss_pred             ecccchhhhhhhcCCCCCcccccCCCchhhhhhhccccCcccccccccccccccccCCCCcccccCCccCCCCCcccccc
Q 007208          136 DVTDFSLKIQSKYGGTNKESHFQRSPSESALERLSGLFGSFSILSQKEETQGTLRRQGSGVDITSRGTEGSFNHPALRRN  215 (613)
Q Consensus       136 D~~d~~~~~~~~~G~s~ke~~~~~s~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  215 (613)
                      +..+|..+|   .|.+                                                                
T Consensus        77 ~~~~l~~~~---~g~~----------------------------------------------------------------   89 (256)
T d1lv7a_          77 SGSDFVEMF---VGVG----------------------------------------------------------------   89 (256)
T ss_dssp             CSCSSTTSC---CCCC----------------------------------------------------------------
T ss_pred             EhHHhhhcc---hhHH----------------------------------------------------------------
Confidence            999886222   1111                                                                


Q ss_pred             CccccccccccccccCCCCCCcCCCCcchhHHHHHHHHHHHHHhhhcCCCEEEEEccchhhhhhh-----------hHHH
Q 007208          216 ASASANISNLASQSFSNTGNLKRTSSWSFDEKLLIQSIYRVLCYVSKTSPIVVYLRDVDKLIFKS-----------QRTY  284 (613)
Q Consensus       216 ~~~~~~~~~~~~~~~~~~~~~~~~~~w~~dek~~lqaL~evl~s~s~~~P~IL~idDiD~~l~~s-----------~r~~  284 (613)
                                                    + ..++.+|+   .+.+.+|+||||||+|+++..+           .+..
T Consensus        90 ------------------------------~-~~l~~~f~---~A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~  135 (256)
T d1lv7a_          90 ------------------------------A-SRVRDMFE---QAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTL  135 (256)
T ss_dssp             ------------------------------H-HHHHHHHH---HHHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHH
T ss_pred             ------------------------------H-HHHHHHHH---HHHHcCCEEEEEEChhhhCccCCCCCCCCcHHHHHHH
Confidence                                          1 13455555   4556799999999999977543           2345


Q ss_pred             HHHHHHHHhhc--CcEEEEeeeeccCCCCccccchHhhc--cCCceEEeCCCChHHHHHHHHHHHHHHHHHhhhhhhhhH
Q 007208          285 NLFQKMMKKLL--ASVLILGSRIVDLSNDQREVDGRVTA--LFPYNIEIRPPEDENHLVSWKSQLEEDMKMMQAKDNRNH  360 (613)
Q Consensus       285 ~~l~~~l~~l~--g~VlIiGS~~~ds~~~~~~v~~~l~~--lF~~~IeI~~P~ee~Rl~Ilk~~L~~d~k~~~~~~N~~~  360 (613)
                      +.|...++.+.  .+|+|||+     +++++.+|+++.+  +|+.+|+|++|+.++|.+||+.++.+ +           
T Consensus       136 ~~ll~~~d~~~~~~~v~vIat-----Tn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~-~-----------  198 (256)
T d1lv7a_         136 NQMLVEMDGFEGNEGIIVIAA-----TNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRR-V-----------  198 (256)
T ss_dssp             HHHHHHHHTCCSSSCEEEEEE-----ESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTT-S-----------
T ss_pred             HHHHHHhhCCCCCCCEEEEEe-----CCCcccCCHhHcCCCCCCEEEECCCcCHHHHHHHHHHhccC-C-----------
Confidence            55666677554  56999986     6678899999987  89999999999999999999987632 1           


Q ss_pred             HHHHhhcCCCCchhhhhhcccCcccchhhHHHHHHHHHHhhhhcCCCcccCCCceeechhhHHhhhhh
Q 007208          361 IMEVLSANDLDCDDLDSINVADTMVLGNYIEEIVVSAVSYHLMNNEDTDYRNGKLIISSKSLSHGLSI  428 (613)
Q Consensus       361 I~~vL~~~dl~c~dLa~l~~~d~~~~~~~ie~iV~~A~s~~l~~~~~~~~~~~~l~is~~sl~~al~~  428 (613)
                          -...+++..+|+..|.+   |++++|..+|..|.-.++.+++        -.|+.++|.+|++.
T Consensus       199 ----~~~~~~~~~~la~~t~G---~s~adi~~l~~~A~~~a~~~~~--------~~i~~~d~~~Al~r  251 (256)
T d1lv7a_         199 ----PLAPDIDAAIIARGTPG---FSGADLANLVNEAALFAARGNK--------RVVSMVEFEKAKDK  251 (256)
T ss_dssp             ----CBCTTCCHHHHHHTCTT---CCHHHHHHHHHHHHHHHHHTTC--------SSBCHHHHHHHHHH
T ss_pred             ----CcCcccCHHHHHHhCCC---CCHHHHHHHHHHHHHHHHHcCC--------CccCHHHHHHHHHH
Confidence                12345666777777777   9999999999999777765433        34789999999973
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure