Citrus Sinensis ID: 007219

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610--
MSLKHSENLIRTPDFSRVPNLEQLILEGCTRLHEIHPSLLVHKKLIFLNLKGCTSLRALPAKIFMKSLETLVLSGCLKLKKFPDIVGSMECLQELHLDGTDIKELPLSIELLSGLVRLTLYGCKNFERIPSTISALKYLSTLNLSGLWKLREFPEIVESMEQLLELHLEGTAIRGLPASIEFLSGLVLLNLKDCKNLKSLPRTINGLRSLKTLHLSGCSKLKNVPENLGKVESLEVLDISGCKGLLQSTSWFLHFPITLIRRNSDPVAWRFPSLSGLYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRNSFVSLPASIIHLSKLGKMVLEDCKRLQSLPQPPPSIVSIRVDGCTSLETISCVLKLCKLNRTYIHCMDCFKFNGLGFSMLKEYLEAVSNLRQRSSIVVPGSEIPEWFMYQNKGSSITLKRPPDSFNKNKVVGYAICCVFHVNKHSTRIRMLRSYPTKCLTWHLKGSRVGDSTTFREKFGQDGSDHLWLLYLPRQEQECYEHNWHFEFQPLWGPGLEVKKCGFHPVYIHQVGEEFNQPTNRWTPFTYNLNEFHRNFVGSNMEVATTSKRSLAEYVGTAEASGSGYCDDEESQAKRYRRLD
ccccccccccccccccccccccEEEEccccccEEccccccccccccEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccEEccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccEEccHHccccccccEEEccccccccccccccccccEEEcccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHcccccccEEEEccccccccccccccccEEEEEcccccccccccEEEEEEEEEEEcccccHHcccccccccEEEEcccccccccccccccccccccccEEEEEEEcccccccccccEEEEEEEEcccccEEEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccHHHHHcccc
ccccccccccccccccccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHccccccEEEEcccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccEEEEEccccccccccccccccccccEEEccccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccEEEccccccccccccccccccccHHHccccccHHcccccccccccccHHHHccccccEEEcccccccHHHcccccccEEEEEccccccccccccEEEEEEEEEcccccccccccccEEEEEEEEccccccEccccccccccccccccEEEEEEEccccccccccEEEEEEEEEccccEEEEEcEEEEEEEccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccEEEccccccccEEcccc
mslkhsenlirtpdfsrvpnlEQLILEGCTRLHEIHPSLLVHKKLIFLnlkgctslralPAKIFMKSLETLVLSGclklkkfpdivgSMECLQelhldgtdikelPLSIELLSGLVRLTLygcknferipSTISALKYLSTLNlsglwklreFPEIVESMEQLLELHLEgtairglpaSIEFLSGLVLLnlkdcknlkslprtiNGLRSLKTLHLsgcsklknvpenlgkveslEVLDisgckgllqstswflhfpitlirrnsdpvawrfpslsglyclrkldisdcnlgegaipsdighlcslkelylsrnsfvslpaSIIHLSKLGKMVLEDckrlqslpqpppsivsirvdgctsLETISCVLKLCKLNrtyihcmdcfkfnglGFSMLKEYLEAVSNLRqrssivvpgseipewfmyqnkgssitlkrppdsfnknkvVGYAICCVFHVnkhstrirmlrsyptkcltwhlkgsrvgdsttfrekfgqdgsdhlwllylprqeqecyehnwhfefqplwgpglevkkcgfhpvyihqvgeefnqptnrwtpftynlNEFHRNFVGSNMEVATTSKRSLAEYVgtaeasgsgycddeesqakryrrld
mslkhsenlirtpdfsrvpnLEQLILEGCTRLHEIHPSLLVHKKLIFLNLKGCTSLRALPAKIFMKSLETLVLSGCLKLKKFPDIVGSMECLQELHLDGTDIKELPLSIELLSGLVRLTLYGCKNFERIPSTISALKYLSTLNLSGLWKLREFPEIVESMEQLLELHLEGTAIRGLPASIEFLSGLVLLNLKDCKNLKSLPRTINGLRSLKTLHLSGCSKLKNVPENLGKVESLEVLDISGCKGLLQSTSWFLHFPITLIRRNSDPVAWRFPSLSGLYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRNSFVSLPASIIHLSKLGKMVLEDCKRLqslpqpppsiVSIRVDGCTSLETISCVLKLCKLNRTYIHCMDCFKFNGLGFSMLKEYLEAVSNLRQRSSIVVPGSEIPEWFMYQNKGSSITLKRPPDSFNKNKVVGYAICCVFHvnkhstrirMLRSYPTKcltwhlkgsrvgdSTTFREKFGQDGSDHLWLLYLPRQEQECYEHNWHFEFQPLWGPGLEVKKCGFHPVYIHQVGEEFNQPTNRWTPFTYNLNEFHRNFVGSNMEVATTSKRSLAEYVGtaeasgsgycddeesqakryrrld
MSLKHSENLIRTPDFSRVPNLEQLILEGCTRLHEIHPSLLVHKKLIFLNLKGCTSLRALPAKIFMKSLETLVLSGCLKLKKFPDIVGSMECLQELHLDGTDIKELPLSIELLSGLVRLTLYGCKNFERIPSTISALKYLSTLNLSGLWKLREFPEIVESMEQLLELHLEGTAIRGLPASIEFLSGLVLLNLKDCKNLKSLPRTINGLRSLKTLHLSGCSKLKNVPENLGKVESLEVLDISGCKGLLQSTSWFLHFPITLIRRNSDPVAWRFPSLSGLYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRNSFVSLPASIIHLSKLGKMVLEDCKRLQSLPQPPPSIVSIRVDGCTSLETISCVLKLCKLNRTYIHCMDCFKFNGLGFSMLKEYLEAVSNLRQRSSIVVPGSEIPEWFMYQNKGSSITLKRPPDSFNKNKVVGYAICCVFHVNKHSTRIRMLRSYPTKCLTWHLKGSRVGDSTTFREKFGQDGSDHLWLLYLPRQEQECYEHNWHFEFQPLWGPGLEVKKCGFHPVYIHQVGEEFNQPTNRWTPFTYNLNEFHRNFVGSNMEVATTSKRSLAEYVGTAEASGSGYCDDEESQAKRYRRLD
**************FSRVPNLEQLILEGCTRLHEIHPSLLVHKKLIFLNLKGCTSLRALPAKIFMKSLETLVLSGCLKLKKFPDIVGSMECLQELHLDGTDIKELPLSIELLSGLVRLTLYGCKNFERIPSTISALKYLSTLNLSGLWKLREFPEIVESMEQLLELHLEGTAIRGLPASIEFLSGLVLLNLKDCKNLKSLPRTINGLRSLKTLHLSGCSKLKNVPENLGKVESLEVLDISGCKGLLQSTSWFLHFPITLIRRNSDPVAWRFPSLSGLYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRNSFVSLPASIIHLSKLGKMVLEDCKRLQSL****PSIVSIRVDGCTSLETISCVLKLCKLNRTYIHCMDCFKFNGLGFSMLKEYLEAVSNLRQRSSIVVPGSEIPEWFMYQNKGSSITL*****SFNKNKVVGYAICCVFHVNKHSTRIRMLRSYPTKCLTWHLKGSRVGDSTTFREKFGQDGSDHLWLLYLPRQEQECYEHNWHFEFQPLWGPGLEVKKCGFHPVYIHQVGEEFNQPTNRWTPFTYNLNEFHRNFVGSNMEVA************************************
MSLKHSENLIRTPDFSRVPNLEQLILEGCTRLHEIHPSLLVHKKLIFLNLKGCTSLRALPAKIFMKSLETLVLSGCLKLKKFPDIVGSMECLQELHLDGTDIKELPLSIELLSGLVRLTLYGCKNFERIPSTISALKYLSTLNLSGLWKLREFPEIVESMEQLLELHLEGTAIRGLPASIEFLSGLVLLNLKDCKNLKSLPRTINGLRSLKTLHLSGCSKLKNVPENLGKVESLEVLDISGCKGLLQSTSWFLHFPITLIRRNSDPVAWRFPSLSGLYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRNSFVSLPASIIHLSKLGKMVLEDCKRLQSLPQPPPSIVSIRVDGCTSLETISCVLKLCKLNRTYIHCMDCFKFNGLGFSMLKEYLEAVSNLRQRSSIVVPGSEIPEWFMYQNKGSSITLKRPPDSFNKNKVVGYAICCVFHVNKHSTRIRMLRSYPTKCLTWHLKGSRVGDSTTFREKFGQDGSDHLWLLYLPRQEQECYEHNWHFEFQPLWGPGLEVKKCGFHPVYIHQ**********************************************************************
********LIRTPDFSRVPNLEQLILEGCTRLHEIHPSLLVHKKLIFLNLKGCTSLRALPAKIFMKSLETLVLSGCLKLKKFPDIVGSMECLQELHLDGTDIKELPLSIELLSGLVRLTLYGCKNFERIPSTISALKYLSTLNLSGLWKLREFPEIVESMEQLLELHLEGTAIRGLPASIEFLSGLVLLNLKDCKNLKSLPRTINGLRSLKTLHLSGCSKLKNVPENLGKVESLEVLDISGCKGLLQSTSWFLHFPITLIRRNSDPVAWRFPSLSGLYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRNSFVSLPASIIHLSKLGKMVLEDCKRLQSLPQPPPSIVSIRVDGCTSLETISCVLKLCKLNRTYIHCMDCFKFNGLGFSMLKEYLEAVSNLRQRSSIVVPGSEIPEWFMYQNKGSSITLKRPPDSFNKNKVVGYAICCVFHVNKHSTRIRMLRSYPTKCLTWHLKGSRVGDSTTFREKFGQDGSDHLWLLYLPRQEQECYEHNWHFEFQPLWGPGLEVKKCGFHPVYIHQVGEEFNQPTNRWTPFTYNLNEFHRNFVGSNMEVATTSKRSLAEYVGT***************AKRYRRLD
**L*HSENLIRTPDFSRVPNLEQLILEGCTRLHEIHPSLLVHKKLIFLNLKGCTSLRALPAKIFMKSLETLVLSGCLKLKKFPDIVGSMECLQELHLDGTDIKELPLSIELLSGLVRLTLYGCKNFERIPSTISALKYLSTLNLSGLWKLREFPEIVESMEQLLELHLEGTAIRGLPASIEFLSGLVLLNLKDCKNLKSLPRTINGLRSLKTLHLSGCSKLKNVPENLGKVESLEVLDISGCKGLLQSTSWFLHFPITLIRRNSDPVAWRFPSLSGLYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRNSFVSLPASIIHLSKLGKMVLEDCKRLQSLPQPPPSIVSIRVDGCTSLETISCVLKLCKLNRTYIHCMDCFKFNGLGFSMLKEYLEAVSNLRQRSSIVVPGSEIPEWFMYQNKGSSITLKRPPDSFNKNKVVGYAICCVFHVNKHSTRIRMLRSYPTKCLTWHLKGSRVGDSTTFREKFGQDGSDHLWLLYLPRQEQECYEHNWHFEFQPLWGPGLEVKKCGFHPVYIHQV*********************************TTSKRSLAEYVGTAE*********************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLKHSENLIRTPDFSRVPNLEQLILEGCTRLHEIHPSLLVHKKLIFLNLKGCTSLRALPAKIFMKSLETLVLSGCLKLKKFPDIVGSMECLQELHLDGTDIKELPLSIELLSGLVRLTLYGCKNFERIPSTISALKYLSTLNLSGLWKLREFPEIVESMEQLLELHLEGTAIRGLPASIEFLSGLVLLNLKDCKNLKSLPRTINGLRSLKTLHLSGCSKLKNVPENLGKVESLEVLDISGCKGLLQSTSWFLHFPITLIRRNSDPVAWRFPSLSGLYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRNSFVSLPASIIHLSKLGKMVLEDCKRLQSLPQPPPSIVSIRVDGCTSLETISCVLKLCKLNRTYIHCMDCFKFNGLGFSMLKEYLEAVSNLRQRSSIVVPGSEIPEWFMYQNKGSSITLKRPPDSFNKNKVVGYAICCVFHVNKHSTRIRMLRSYPTKCLTWHLKGSRVGDSTTFREKFGQDGSDHLWLLYLPRQEQECYEHNWHFEFQPLWGPGLEVKKCGFHPVYIHQVGEEFNQPTNRWTPFTYNLNEFHRNFVGSNMEVATTSKRSLAEYVGTAEASGSGYCDDEESQAKRYRRLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query612 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.671 0.359 0.335 3e-46
O235301301 Protein SUPPRESSOR OF npr no no 0.560 0.263 0.319 1e-35
Q9SZ671895 Probable WRKY transcripti no no 0.405 0.130 0.371 4e-30
Q9RBS21024 Protein PopC OS=Ralstonia yes no 0.540 0.323 0.285 1e-20
P0CB161201 Putative disease resistan no no 0.434 0.221 0.288 4e-18
Q8VZC71222 Probable disease resistan no no 0.369 0.184 0.322 1e-14
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.349 0.132 0.295 1e-13
Q54AX5510 Leucine-rich repeat prote yes no 0.5 0.6 0.294 2e-13
O825001095 Putative disease resistan no no 0.495 0.276 0.243 4e-13
C0LGW6 966 LRR receptor-like serine/ no no 0.473 0.300 0.257 7e-12
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 145/432 (33%), Positives = 237/432 (54%), Gaps = 21/432 (4%)

Query: 34   EIHPSLLVHKKLIFLNLKGCTSLRALPAKI-FMKSLETLVLSGCLKLKKFPDIVGSMECL 92
            E  PS    K L+ L L+   SLR L  +   + SL  + LS   +L + PD  G M  L
Sbjct: 587  ESFPSTFELKMLVHLQLRH-NSLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTG-MPNL 644

Query: 93   QELHL-DGTDIKELPLSIELLSGLVRLTLYGCKNFERIP-STISALKYLSTLNLSGLWKL 150
            + ++L   ++++E+  S+   S ++ L L  CK+ +R P   + +L+YL   +   L KL
Sbjct: 645  EYVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPCVNVESLEYLGLRSCDSLEKL 704

Query: 151  REFPEIVESMEQLLELHLEGTAIRGLPASI-EFLSGLVLLNLKDCKNLKSLPRTINGLRS 209
               PEI   M+  +++H++G+ IR LP+SI ++ + +  L L + KNL +LP +I  L+S
Sbjct: 705  ---PEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKS 761

Query: 210  LKTLHLSGCSKLKNVPENLGKVESLEVLDISGCKGLLQSTSWFL--HFPITLIRRNSDPV 267
            L +L +SGCSKL+++PE +G +++L V D S    L   +S        I + R   D V
Sbjct: 762  LVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKDGV 821

Query: 268  AWRFPSLS-GLYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRNSFVSLPASIIHLS 326
             + FP ++ GL+ L  L++S CNL +G +P +IG L SLK+L LSRN+F  LP+SI  L 
Sbjct: 822  HFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLG 881

Query: 327  KLGKMVLEDCKRLQSLPQPPPSIVSIRVDGCTSLETIS-CVLKLCKLNRTYI-HCMDCFK 384
             L  + L+DC+RL  LP+ PP +  + VD   +L+ I   V K  KL+R  +    +   
Sbjct: 882  ALQSLDLKDCQRLTQLPELPPELNELHVDCHMALKFIHYLVTKRKKLHRVKLDDAHNDTM 941

Query: 385  FNGLGFSMLKEYLEAVSNLRQRSSI---VVPGS----EIPEWFMYQNKGSSITLKRPPDS 437
            +N   ++M +       ++    S+   V  G     +IP WF +Q   SS+++  P + 
Sbjct: 942  YNLFAYTMFQNISSMRHDISASDSLSLTVFTGQPYPEKIPSWFHHQGWDSSVSVNLPENW 1001

Query: 438  FNKNKVVGYAIC 449
            +  +K +G+A+C
Sbjct: 1002 YIPDKFLGFAVC 1013
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q8VZC7|DRL36_ARATH Probable disease resistance protein At5g45510 OS=Arabidopsis thaliana GN=At5g45510 PE=1 SV=2 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query612
147802475 1244 hypothetical protein VITISV_027841 [Viti 0.807 0.397 0.431 1e-103
296090591 771 unnamed protein product [Vitis vinifera] 0.946 0.750 0.399 2e-99
359486075 1291 PREDICTED: TMV resistance protein N-like 0.856 0.405 0.404 2e-97
147770134 1414 hypothetical protein VITISV_040107 [Viti 0.856 0.370 0.403 2e-96
451798988 1219 TMV resistance protein N-like protein 6 0.730 0.366 0.440 2e-96
451798990 1335 TMV resistance protein N-like protein 7 0.861 0.394 0.396 1e-95
359486073 1296 PREDICTED: TMV resistance protein N-like 0.856 0.404 0.402 2e-93
224127726 1203 tir-nbs-lrr resistance protein [Populus 0.897 0.456 0.374 2e-86
359493293 1640 PREDICTED: TMV resistance protein N-like 0.875 0.326 0.376 2e-86
147822714 1254 hypothetical protein VITISV_015601 [Viti 0.735 0.358 0.419 3e-86
>gi|147802475|emb|CAN61853.1| hypothetical protein VITISV_027841 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  384 bits (985), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 242/561 (43%), Positives = 327/561 (58%), Gaps = 67/561 (11%)

Query: 1    MSLKHSENLIRTPDFSRVPNLEQLILEGCTRLHEIHPSLLVHKKLIFLNLKGCTSLRALP 60
            + L +S++LI  P+FS +PNLE+L+LEGCT   E+ PS+ V  KLIFLNLK C  LR+ P
Sbjct: 535  IELSNSQHLIHLPNFSSMPNLERLVLEGCTSFLEVDPSIEVLNKLIFLNLKNCKKLRSFP 594

Query: 61   AKIFMKSLETLVLSGCLKLKKFPDIVGSMECLQELHLDGTDIKELPLSIELLSGLVRLTL 120
              I ++ L+ L LSGC  LK FP+I G+M+ L EL+LDGT I ELP SI  L+GL+ L L
Sbjct: 595  RSIKLECLKYLSLSGCSDLKNFPEIQGNMQHLSELYLDGTAISELPFSIGYLTGLILLDL 654

Query: 121  YGCKNFERIPSTISALKYLSTLNLSGLWKLREFPEIVESMEQLLELHLEGTAIRGLPASI 180
              CK  + +PS+I  LK L TL LS   KL  FPEI+E+ME L +L L+GTA++ L  SI
Sbjct: 655  ENCKRLKSLPSSICKLKSLETLILSACSKLESFPEIMENMEHLKKLLLDGTALKQLHPSI 714

Query: 181  EFLSGLVLLNLKDCKNLKSLPRTINGLRSLKTLHLSGCSKLKNVPENLGKVE-------- 232
            E L+GLV LNL+DCKNL +LP +I  L+SL+TL +SGCSKL+ +PENLG ++        
Sbjct: 715  EHLNGLVSLNLRDCKNLATLPCSIGNLKSLETLIVSGCSKLQQLPENLGSLQCLVKLQAD 774

Query: 233  ---------------SLEVLDISGCKGLLQSTSWFLHFPITLI-RRNSDPVAWRFPSLSG 276
                           +LE+L   GCKG L S SW   F   L+ R++SD +  + PSLSG
Sbjct: 775  GTLVRQPPSSIVLLRNLEILSFGGCKG-LASNSWSSLFSFWLLPRKSSDTIGLQLPSLSG 833

Query: 277  LYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRNSFVSLPASIIHLSKLGKMVLEDC 336
            L  LR+LDISDCNL EGA+P DI +L SL+ L LSRN+F SLPA I  LSKL  + L  C
Sbjct: 834  LCSLRELDISDCNLMEGAVPFDICNLSSLETLNLSRNNFFSLPAGISKLSKLRFLSLNHC 893

Query: 337  KRLQSLPQPPPSIVSIRVDGCTSLETISCVLKLCK---LNRTYIHCM-DCFKFNGLG--- 389
            K L  +P+ P SI+ +    C+SL TI     +C    + R  +  + +CF  +      
Sbjct: 894  KSLLQIPELPSSIIEVNAQYCSSLNTILTPSSVCNNQPVCRWLVFTLPNCFNLDAENPCS 953

Query: 390  --FSMLKEYLEAVSNLRQR---------SSIVVPGSEIPEWFMYQNKGSSITLKRPPDSF 438
               +++   ++ V+N+ Q+          SI +PGSEIP+W   QN GS +T++ PP  F
Sbjct: 954  NDMAIISPRMQIVTNMLQKLQNFLPDFGFSIFLPGSEIPDWISNQNLGSEVTIELPPHWF 1013

Query: 439  NKNKVVGYAICCVFHVNKHSTRIRMLRSYPTKCLTWHLKGSRVGDSTTFR---------- 488
              N  +G+A+CCVF     +         P  C +  L      D + FR          
Sbjct: 1014 ESN-FLGFAVCCVFAFEDIA---------PNGCSS-QLLCQLQSDESHFRGIGHILHSID 1062

Query: 489  -EKFGQD--GSDHLWLLYLPR 506
             E   +D   S H+WL Y PR
Sbjct: 1063 CEGNSEDRLKSHHMWLAYKPR 1083

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296090591|emb|CBI40960.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] Back     alignment and taxonomy information
>gi|451798988|gb|AGF69192.1| TMV resistance protein N-like protein 6 [Vitis labrusca] Back     alignment and taxonomy information
>gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] Back     alignment and taxonomy information
>gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|224127726|ref|XP_002329162.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870943|gb|EEF08074.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493293|ref|XP_002273413.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147822714|emb|CAN68293.1| hypothetical protein VITISV_015601 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query612
UNIPROTKB|Q403921144 N "TMV resistance protein N" [ 0.679 0.363 0.340 2.8e-49
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.831 0.393 0.285 1.2e-40
TAIR|locus:21533281231 AT5G45230 [Arabidopsis thalian 0.388 0.193 0.408 1.1e-38
TAIR|locus:21292361301 SNC1 "SUPPRESSOR OF NPR1-1, CO 0.596 0.280 0.336 2.4e-36
TAIR|locus:21703331197 CSA1 "constitutive shade-avoid 0.382 0.195 0.420 5.6e-36
TAIR|locus:21479921189 AT5G11250 [Arabidopsis thalian 0.665 0.342 0.321 1.2e-35
TAIR|locus:20817901253 AT3G51560 [Arabidopsis thalian 0.580 0.283 0.351 5.9e-34
TAIR|locus:20534051215 AT2G14080 [Arabidopsis thalian 0.674 0.339 0.308 1.3e-32
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.383 0.192 0.418 1.7e-32
TAIR|locus:21533631261 AT5G45200 [Arabidopsis thalian 0.388 0.188 0.396 1.8e-32
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
 Score = 514 (186.0 bits), Expect = 2.8e-49, Sum P(2) = 2.8e-49
 Identities = 149/438 (34%), Positives = 242/438 (55%)

Query:    29 CTRLH-EIHPSLLVHKKLIFLNLKGCTSLRALPAKI-FMKSLETLVLSGCLKLKKFPDIV 86
             CT    E  PS    K L+ L L+   SLR L  +   + SL  + LS   +L + PD  
Sbjct:   581 CTNYPWESFPSTFELKMLVHLQLRH-NSLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFT 639

Query:    87 GSMECLQELHL-DGTDIKELPLSIELLSGLVRLTLYGCKNFERIPST-ISALKYLSTLNL 144
             G M  L+ ++L   ++++E+  S+   S ++ L L  CK+ +R P   + +L+YL   + 
Sbjct:   640 G-MPNLEYVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPCVNVESLEYLGLRSC 698

Query:   145 SGLWKLREFPEIVESMEQLLELHLEGTAIRGLPASI-EFLSGLVLLNLKDCKNLKSLPRT 203
               L KL   PEI   M+  +++H++G+ IR LP+SI ++ + +  L L + KNL +LP +
Sbjct:   699 DSLEKL---PEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSS 755

Query:   204 INGLRSLKTLHLSGCSKLKNVPENLGKVESLEVLDISGCKGLLQSTSWF-LHFPITLIRR 262
             I  L+SL +L +SGCSKL+++PE +G +++L V D S    L   +S   L+  I L+ R
Sbjct:   756 ICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFR 815

Query:   263 N-SDPVAWRFPSLS-GLYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRNSFVSLPA 320
                D V + FP ++ GL+ L  L++S CNL +G +P +IG L SLK+L LSRN+F  LP+
Sbjct:   816 GFKDGVHFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPS 875

Query:   321 SIIHLSKLGKMVLEDCKRLQSLPQPPPSIVSIRVDGCTSLETIS-CVLKLCKLNRTYIH- 378
             SI  L  L  + L+DC+RL  LP+ PP +  + VD   +L+ I   V K  KL+R  +  
Sbjct:   876 SIAQLGALQSLDLKDCQRLTQLPELPPELNELHVDCHMALKFIHYLVTKRKKLHRVKLDD 935

Query:   379 CMDCFKFNGLGFSMLKEYLEAVSNLRQRSSI---VVPGS----EIPEWFMYQNKGSSITL 431
               +   +N   ++M +       ++    S+   V  G     +IP WF +Q   SS+++
Sbjct:   936 AHNDTMYNLFAYTMFQNISSMRHDISASDSLSLTVFTGQPYPEKIPSWFHHQGWDSSVSV 995

Query:   432 KRPPDSFNKNKVVGYAIC 449
               P + +  +K +G+A+C
Sbjct:   996 NLPENWYIPDKFLGFAVC 1013
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081790 AT3G51560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query612
PLN032101153 PLN03210, PLN03210, Resistant to P 3e-28
PLN032101153 PLN03210, PLN03210, Resistant to P 3e-19
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  120 bits (303), Expect = 3e-28
 Identities = 123/437 (28%), Positives = 188/437 (43%), Gaps = 103/437 (23%)

Query: 1   MSLKHSENLIRTPDFSRVPNLEQLILEGCTRLHEIHPSLLVHKKLIFLNLKGCTSLRALP 60
           + L+ S+NL   PD S   NLE L L  C+ L E+  S+    KL  L++  C +L  LP
Sbjct: 639 IDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILP 698

Query: 61  AKIFMKSLETLVLSGCLKLKKFPDIVGSMECLQELHLDGTDIKELP--LSIELLSGLVRL 118
             I +KSL  L LSGC +LK FPDI  +   +  L LD T I+E P  L +E L  L+  
Sbjct: 699 TGINLKSLYRLNLSGCSRLKSFPDISTN---ISWLDLDETAIEEFPSNLRLENLDELILC 755

Query: 119 TLYGCKNFERIPSTISALKYLSTLNLSGLWKLREFPEIVESMEQLLELHLEGTAIRGLPA 178
            +   K +ER+      +  LS  +L+ L+ L + P +VE                 LP+
Sbjct: 756 EMKSEKLWERVQPLTPLMTMLSP-SLTRLF-LSDIPSLVE-----------------LPS 796

Query: 179 SIEFLSGLVLLNLKDCKNLKSLPRTINGLRSLKTLHLSGCSKLKNVPENLGKVESLEVLD 238
           SI+ L  L  L +++C NL++LP  IN L SL++L LSGCS+L+  P            D
Sbjct: 797 SIQNLHKLEHLEIENCINLETLPTGIN-LESLESLDLSGCSRLRTFP------------D 843

Query: 239 ISGCKGLLQSTSWFLHFPITLIRRNSDPVAWRFPSLSGLYCLRKLDISDCNLGEGAIPSD 298
           IS       +    L+   T I    + V W    +     L  LD++ CN  +      
Sbjct: 844 IS-------TNISDLNLSRTGI----EEVPW---WIEKFSNLSFLDMNGCNNLQRVSL-- 887

Query: 299 IGHLCSLKELYLSRNSFVSLPASIIHLSKLGKMVLEDCKRLQ--SLPQPPPSIVSIRVDG 356
                                 +I  L  L  +   DC  L   S    P  +     + 
Sbjct: 888 ----------------------NISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNI 925

Query: 357 CTSLETISCVLKLCKLNRTYIHCMDCFKFNGLGFSMLKEYLEAVSNLRQRS---SIVVPG 413
            + L +  C           I+ ++CF  +           EA+  L+Q+S    +++ G
Sbjct: 926 HSKLPSTVC-----------INFINCFNLD----------QEAL--LQQQSIFKQLILSG 962

Query: 414 SEIPEWFMYQNKGSSIT 430
            E+P +F ++  G+S+T
Sbjct: 963 EEVPSYFTHRTTGASLT 979

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 612
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN032101153 Resistant to P. syringae 6; Provisional 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.77
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.74
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.73
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.72
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.65
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
KOG0617264 consensus Ras suppressor protein (contains leucine 99.54
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.52
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.51
KOG4237498 consensus Extracellular matrix protein slit, conta 99.47
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.47
KOG4237498 consensus Extracellular matrix protein slit, conta 99.32
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.11
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.03
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.99
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.92
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.92
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.9
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.89
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.68
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.64
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.61
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.6
PRK15386426 type III secretion protein GogB; Provisional 98.56
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.55
KOG4341483 consensus F-box protein containing LRR [General fu 98.54
KOG4341483 consensus F-box protein containing LRR [General fu 98.44
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.42
PLN03150623 hypothetical protein; Provisional 98.38
PLN03150623 hypothetical protein; Provisional 98.36
PRK15386426 type III secretion protein GogB; Provisional 98.35
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.18
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.02
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.98
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.96
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.95
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.83
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.82
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.72
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.53
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.51
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.49
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.45
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.3
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.28
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.26
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.16
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.05
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.94
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.61
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.54
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.87
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.29
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.11
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.7
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.33
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.58
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.93
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.88
KOG2123388 consensus Uncharacterized conserved protein [Funct 92.64
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.62
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.59
smart0037026 LRR Leucine-rich repeats, outliers. 88.59
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.55
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.31
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 82.05
smart0037026 LRR Leucine-rich repeats, outliers. 82.05
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=9.2e-41  Score=396.09  Aligned_cols=448  Identities=25%  Similarity=0.326  Sum_probs=303.2

Q ss_pred             cCCCccEEecCCCCCCccCCCccC-CCCccEEEccCCcCCcccCccccCCCCCCeeecCCc-CCcccccccccCCCCcEE
Q 007219           41 VHKKLIFLNLKGCTSLRALPAKIF-MKSLETLVLSGCLKLKKFPDIVGSMECLQELHLDGT-DIKELPLSIELLSGLVRL  118 (612)
Q Consensus        41 ~l~~L~~L~L~~c~~l~~lp~~~~-l~~L~~L~L~~c~~l~~~p~~~~~l~~L~~L~L~~~-~i~~lp~~i~~l~~L~~L  118 (612)
                      ...+|+.|++.++ .+..+|..+. +++|++|+|++|..++.+|. +..+++|++|+|.++ .+.++|.+++++++|+.|
T Consensus       609 ~~~~L~~L~L~~s-~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~-ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L  686 (1153)
T PLN03210        609 RPENLVKLQMQGS-KLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDL  686 (1153)
T ss_pred             CccCCcEEECcCc-cccccccccccCCCCCEEECCCCCCcCcCCc-cccCCcccEEEecCCCCccccchhhhccCCCCEE
Confidence            3456666666663 3555555554 66777777776666666664 556677777777664 355677777777777777


Q ss_pred             eccCCCCCcccccccccCCCCCEEecCCCCCCccchhhhhccccccEEEccCcCCCCCChhhhccCCCcEEeecCCCCCC
Q 007219          119 TLYGCKNFERIPSTISALKYLSTLNLSGLWKLREFPEIVESMEQLLELHLEGTAIRGLPASIEFLSGLVLLNLKDCKNLK  198 (612)
Q Consensus       119 ~L~~~~~l~~lp~~l~~l~~L~~L~L~~~~~l~~~p~~l~~l~~L~~L~L~~~~i~~lp~~i~~l~~L~~L~L~~c~~l~  198 (612)
                      ++++|..++.+|..+ .+++|+.|++++|..++.+|..   ..+|++|++++|.+..+|..+ .+++|+.|.+.++....
T Consensus       687 ~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~i~~lP~~~-~l~~L~~L~l~~~~~~~  761 (1153)
T PLN03210        687 DMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDETAIEEFPSNL-RLENLDELILCEMKSEK  761 (1153)
T ss_pred             eCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccc---cCCcCeeecCCCccccccccc-cccccccccccccchhh
Confidence            777777777777654 5677777777777666666643   356777777777777777665 46777777777654211


Q ss_pred             ------ccc-ccccCCCCCCEEEecCCCCCcccccccCCCCCCcEEeccCCCCCcccCcccccccceecccCCCCccccC
Q 007219          199 ------SLP-RTINGLRSLKTLHLSGCSKLKNVPENLGKVESLEVLDISGCKGLLQSTSWFLHFPITLIRRNSDPVAWRF  271 (612)
Q Consensus       199 ------~lp-~~i~~l~~L~~L~Ls~c~~l~~lp~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  271 (612)
                            .++ ......++|+.|++++|..+..+|..++++++|+.|++++|..+.                       .+
T Consensus       762 l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~-----------------------~L  818 (1153)
T PLN03210        762 LWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLE-----------------------TL  818 (1153)
T ss_pred             ccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcC-----------------------ee
Confidence                  111 112235789999999999999999999999999999999987543                       23


Q ss_pred             CCCCCCCcccEEeccCCCCCCCCCCccccCcCCCCEEeccCCCccccchhhhccccccccccccccccccCCCCC---CC
Q 007219          272 PSLSGLYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRNSFVSLPASIIHLSKLGKMVLEDCKRLQSLPQPP---PS  348 (612)
Q Consensus       272 ~~l~~l~~L~~L~Ls~~~l~~~~ip~~l~~l~sL~~L~Ls~n~l~~lp~~i~~L~~L~~L~l~~c~~L~~lp~lp---~s  348 (612)
                      |....+++|+.|+|++|... ..+|..   .++|+.|+|++|.++.+|.++..+++|+.|++.+|..|+.+|..+   ++
T Consensus       819 P~~~~L~sL~~L~Ls~c~~L-~~~p~~---~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~  894 (1153)
T PLN03210        819 PTGINLESLESLDLSGCSRL-RTFPDI---STNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKH  894 (1153)
T ss_pred             CCCCCccccCEEECCCCCcc-cccccc---ccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccC
Confidence            44346789999999999764 234442   468999999999999999999999999999999999999998654   56


Q ss_pred             ccEEeccCCCCcceecCcccc-----------------ccccccceeeccccccCccchhHHHHHHHHhhcccCccEEEe
Q 007219          349 IVSIRVDGCTSLETISCVLKL-----------------CKLNRTYIHCMDCFKFNGLGFSMLKEYLEAVSNLRQRSSIVV  411 (612)
Q Consensus       349 L~~L~i~~C~~L~~l~~~~~~-----------------~~l~~~~~~~l~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~  411 (612)
                      |+.+++.+|++|+.++....+                 ..+.|.+|.++++..           .++..   .....+++
T Consensus       895 L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~nC~~L~~~a-----------~l~~~---~~~~~~~l  960 (1153)
T PLN03210        895 LETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQEA-----------LLQQQ---SIFKQLIL  960 (1153)
T ss_pred             CCeeecCCCcccccccCCCCchhhhhhcccccccCCchhccccccccCCCchh-----------hhccc---ccceEEEC
Confidence            778899999999877532211                 112344554443221           11111   11245789


Q ss_pred             CCCCCCccccccCCCceEE-EECCCCCCCCCCeEEEEEEEEEeecCCccccccccccccceeEecCCCceeeeccccccc
Q 007219          412 PGSEIPEWFMYQNKGSSIT-LKRPPDSFNKNKVVGYAICCVFHVNKHSTRIRMLRSYPTKCLTWHLKGSRVGDSTTFREK  490 (612)
Q Consensus       412 pg~~iP~wf~~~~~g~si~-~~lp~~~~~~~~~~gf~~c~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  490 (612)
                      ||.++|+||.||+.|++++ |.+|+.|+... |.||++|+|+++...... ...+.+++.|.+....|..+..       
T Consensus       961 ~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~-~~~f~~c~v~~~~~~~~~-~~~~~~~~~c~~~~~~~~~~~~------- 1031 (1153)
T PLN03210        961 SGEEVPSYFTHRTTGASLTNIPLLHISPCQP-FFRFRACAVVDSESFFII-SVSFDIQVCCRFIDRLGNHFDS------- 1031 (1153)
T ss_pred             CCccCchhccCCcccceeeeeccCCcccCCC-ccceEEEEEEecCccccC-CCceeEEEEEEEECCCCCcccc-------
Confidence            9999999999999999998 99999998777 999999999987653111 1123444566665554543321       


Q ss_pred             CCCCCCCeEEEEEeecccee---------cc-----cC-CceeeEEEe--ec-CCceEEeeeeEEeeecCCCCCCCC
Q 007219          491 FGQDGSDHLWLLYLPRQEQE---------CY-----EH-NWHFEFQPL--WG-PGLEVKKCGFHPVYIHQVGEEFNQ  549 (612)
Q Consensus       491 ~~~~~sdhl~~~~~~~~~~~---------~~-----~~-~~~~~~~~~--~~-~~~~vk~cGv~lvy~~~~~~~~~~  549 (612)
                         ...+|+|+.|.....+.         ..     +. +...++.|.  .. ...+||+||||++|+++.. +++.
T Consensus      1032 ---~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~cg~~~~~~~~~~-~~~~ 1104 (1153)
T PLN03210       1032 ---PYQPHVFSVTKKGSHLVIFDCCFPLNEDNAPLAELNYDHVDIQFRLTNKNSQLKLKGCGIRLSEDDSSL-NNTL 1104 (1153)
T ss_pred             ---CCCceeEeeeccccceEEecccccccccccchhccCCceeeEEEEEecCCCCeEEEeeeEEEeccCCCc-ccCC
Confidence               34556665554432221         00     00 111234443  22 1248999999999976655 4444

syringae 6; Provisional
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query612
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 3e-14
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 9e-07
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 92/216 (42%), Gaps = 33/216 (15%)
Query: 77  LKLKKFPDIVGSMECLQELHLDGTDIKELPLSIELLSGLVRLTLYGCKNFERIPSTISAL 136
           + L +FPD    +  LQ   +D   + ELP + +  +GL  LTL        +P++I++L
Sbjct: 91  VPLPQFPDQAFRLSHLQHXTIDAAGLXELPDTXQQFAGLETLTL-ARNPLRALPASIASL 149
Query: 137 KYLSTLNLSGLWKLREFPEIVESME---------QLLELHLEGTAIRGLPASIEFLSGLV 187
             L  L++    +L E PE + S +          L  L LE T IR LPASI  L  L 
Sbjct: 150 NRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLK 209
Query: 188 LL-----------------------NLKDCKNLKSLPRTINGLRSLKTLHLSGCSKLKNV 224
            L                       +L+ C  L++ P    G   LK L L  CS L  +
Sbjct: 210 SLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTL 269
Query: 225 PENLGKVESLEVLDISGCKGLLQSTSWFLHFPITLI 260
           P ++ ++  LE LD+ GC  L +  S     P   I
Sbjct: 270 PLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCI 305
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query612
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-53
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-51
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-27
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-26
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-21
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-17
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-17
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-16
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-20
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-18
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 6e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  185 bits (471), Expect = 1e-53
 Identities = 82/332 (24%), Positives = 125/332 (37%), Gaps = 59/332 (17%)

Query: 20  NLEQLILEGCTRLHEIHPSL-------------------LVHKKLIFLNLKGCTSLRALP 60
             E L  +G T L   H  L                     +     +  +   +L+A  
Sbjct: 13  GRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSNNPQIETRTGRALKATA 72

Query: 61  AKIF---MKSLETLVLSGCLKLKKFPDIVGSMECLQELHLDGTDIKELPLSIELLSGLVR 117
             +          L L     L +FPD    +  LQ + +D   + ELP +++  +GL  
Sbjct: 73  DLLEDATQPGRVALELRSV-PLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLET 131

Query: 118 LTLYGCKNFERIPSTISALKYLSTLNLSGLWKLREFPE---------IVESMEQLLELHL 168
           LTL        +P++I++L  L  L++    +L E PE           + +  L  L L
Sbjct: 132 LTLARNP-LRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRL 190

Query: 169 EGTAIRGLPASIEFLSGLVLLNLKDCKNLKSLPRTINGLRSLKTLHLSGCSKLKNVPENL 228
           E T IR LPASI  L  L  L +++   L +L   I+ L  L+ L L GC+ L+N P   
Sbjct: 191 EWTGIRSLPASIANLQNLKSLKIRNSP-LSALGPAIHHLPKLEELDLRGCTALRNYPPIF 249

Query: 229 GKVESLEVLDISGCKGLLQSTSWFLHFPITLIRRNSDPVAWRFPSLSGLYCLRKLDISDC 288
           G    L+ L +  C  LL         P                 +  L  L KLD+  C
Sbjct: 250 GGRAPLKRLILKDCSNLL-------TLP---------------LDIHRLTQLEKLDLRGC 287

Query: 289 -NLGEGAIPSDIGHLCSLKELYLSRNSFVSLP 319
            NL    +PS I  L +   + +  +    L 
Sbjct: 288 VNLSR--LPSLIAQLPANCIILVPPHLQAQLD 317
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query612
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.95
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.88
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.87
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.87
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.85
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.83
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.83
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.82
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.8
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.8
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.75
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.71
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.71
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.7
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.7
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.68
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.66
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.64
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.63
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.61
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.6
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.6
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.59
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.59
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.56
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.54
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.53
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.51
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.51
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.51
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.5
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.5
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.49
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.49
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.44
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.42
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.38
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.3
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.3
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.28
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.27
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.24
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.21
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.19
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.18
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.17
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.14
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.1
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.01
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.91
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.91
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.88
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.88
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.87
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.75
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.74
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.66
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.6
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.59
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.51
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.36
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.23
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.21
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.07
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.82
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.78
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.63
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.56
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.42
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.2
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.32
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.34
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 90.71
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.8e-32  Score=315.01  Aligned_cols=356  Identities=24%  Similarity=0.217  Sum_probs=259.4

Q ss_pred             CCCCCcCCccCCC-CCC-CCCccEEeccCCCCccccccccccCCCccEEecCCCCCCccCCCc-cC-CCCccEEEccCCc
Q 007219            2 SLKHSENLIRTPD-FSR-VPNLEQLILEGCTRLHEIHPSLLVHKKLIFLNLKGCTSLRALPAK-IF-MKSLETLVLSGCL   77 (612)
Q Consensus         2 ~Ls~~~~L~~~p~-l~~-l~~L~~L~L~~c~~l~~i~~si~~l~~L~~L~L~~c~~l~~lp~~-~~-l~~L~~L~L~~c~   77 (612)
                      +|++++-...+|+ +.. +++|++|++++|.....+|..++.+++|++|++++|.....+|.. +. +++|++|++++|.
T Consensus       275 ~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~  354 (768)
T 3rgz_A          275 SLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE  354 (768)
T ss_dssp             ECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSE
T ss_pred             ECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCc
Confidence            4555542224553 333 366666666666555556666666666666666665443355543 22 5555555555554


Q ss_pred             CCccc-------------------------CccccC--CCCCCeeecCCcCCc-ccccccccCCCCcEEeccCCCCCccc
Q 007219           78 KLKKF-------------------------PDIVGS--MECLQELHLDGTDIK-ELPLSIELLSGLVRLTLYGCKNFERI  129 (612)
Q Consensus        78 ~l~~~-------------------------p~~~~~--l~~L~~L~L~~~~i~-~lp~~i~~l~~L~~L~L~~~~~l~~l  129 (612)
                      ..+.+                         |..+..  +++|++|++++|.+. .+|..+.++++|+.|++++|.....+
T Consensus       355 l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~  434 (768)
T 3rgz_A          355 FSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI  434 (768)
T ss_dssp             EEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCC
T ss_pred             cCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcc
Confidence            33334                         433333  556777777777776 67778888889999999988877788


Q ss_pred             ccccccCCCCCEEecCCCCCCccchhhhhccccccEEEccCcCCC-CCChhhhccCCCcEEeecCCCCCCcccccccCCC
Q 007219          130 PSTISALKYLSTLNLSGLWKLREFPEIVESMEQLLELHLEGTAIR-GLPASIEFLSGLVLLNLKDCKNLKSLPRTINGLR  208 (612)
Q Consensus       130 p~~l~~l~~L~~L~L~~~~~l~~~p~~l~~l~~L~~L~L~~~~i~-~lp~~i~~l~~L~~L~L~~c~~l~~lp~~i~~l~  208 (612)
                      |..+..+++|+.|++++|...+.+|..+..+++|++|++++|.+. .+|..++.+++|+.|++++|...+.+|..++.++
T Consensus       435 p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~  514 (768)
T 3rgz_A          435 PSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLE  514 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCT
T ss_pred             cHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCC
Confidence            888888999999999999887788888999999999999999988 5788899999999999999998889999999999


Q ss_pred             CCCEEEecCCCCCcccccccCCCCCCcEEeccCCCCCcccC-ccccccccee----------------------------
Q 007219          209 SLKTLHLSGCSKLKNVPENLGKVESLEVLDISGCKGLLQST-SWFLHFPITL----------------------------  259 (612)
Q Consensus       209 ~L~~L~Ls~c~~l~~lp~~l~~l~~L~~L~l~~~~~~~~~~-~~~~~~~~~~----------------------------  259 (612)
                      +|+.|++++|...+.+|..++.+++|+.|++++|....... ..........                            
T Consensus       515 ~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  594 (768)
T 3rgz_A          515 NLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLL  594 (768)
T ss_dssp             TCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEE
T ss_pred             CCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccccccccccccc
Confidence            99999999999888999999999999999999886321111 1100000000                            


Q ss_pred             ------------------cccCCCCccccCCC-CCCCCcccEEeccCCCCCCCCCCccccCcCCCCEEeccCCCcc-ccc
Q 007219          260 ------------------IRRNSDPVAWRFPS-LSGLYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRNSFV-SLP  319 (612)
Q Consensus       260 ------------------~~~~~~~~~~~l~~-l~~l~~L~~L~Ls~~~l~~~~ip~~l~~l~sL~~L~Ls~n~l~-~lp  319 (612)
                                        .....+......|. +..+++|+.|+|++|++. +.+|..++.+++|+.|+|++|.++ .+|
T Consensus       595 ~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~-g~ip~~l~~l~~L~~L~Ls~N~l~g~ip  673 (768)
T 3rgz_A          595 EFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLS-GYIPKEIGSMPYLFILNLGHNDISGSIP  673 (768)
T ss_dssp             ECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCB-SCCCGGGGGCTTCCEEECCSSCCCSCCC
T ss_pred             ccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCccc-ccCCHHHhccccCCEEeCcCCccCCCCC
Confidence                              00000111122333 778899999999999985 789999999999999999999998 899


Q ss_pred             hhhhccccccccccccccccccCCCC---CCCccEEeccCCC
Q 007219          320 ASIIHLSKLGKMVLEDCKRLQSLPQP---PPSIVSIRVDGCT  358 (612)
Q Consensus       320 ~~i~~L~~L~~L~l~~c~~L~~lp~l---p~sL~~L~i~~C~  358 (612)
                      ..+.++++|+.|++++|+.-..+|..   .++|+.|+++++.
T Consensus       674 ~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~  715 (768)
T 3rgz_A          674 DEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNN  715 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSE
T ss_pred             hHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCc
Confidence            99999999999999999887788753   3567777877764
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 612
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 67.8 bits (164), Expect = 5e-13
 Identities = 53/294 (18%), Positives = 103/294 (35%), Gaps = 18/294 (6%)

Query: 77  LKLKKFPDIVGSMECLQELHLDGTDIKEL-PLSIELLSGLVRLTLYGCKNFERIPSTISA 135
           L L+K P  +        L L    I E+     + L  L  L L   K  +  P   + 
Sbjct: 20  LGLEKVPKDLPP--DTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAP 77

Query: 136 LKYLSTLNLSGLWKLREFPEIVESMEQLLELHLEGTAIRGLPASIEFLSGLVLLNLKDCK 195
           L  L  L LS         ++ +++++L     E T +R    +      +V L     K
Sbjct: 78  LVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLK 137

Query: 196 NLKSLPRTINGLRSLKTLHLSGCSKLKNVPENLGKVESLEVLDISGCKGLLQSTSWF--L 253
           +         G++ L  + ++    +  +P+ L    SL  L + G K      +    L
Sbjct: 138 SSGIENGAFQGMKKLSYIRIADT-NITTIPQGLPP--SLTELHLDGNKITKVDAASLKGL 194

Query: 254 HFPITLIRRNSDPVAWRFPSLSGLYCLRKLDISDCNLGEGAIPSDIGHLCSLKELYLSRN 313
           +    L    +   A    SL+    LR+L +++  L +  +P  +     ++ +YL  N
Sbjct: 195 NNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVK--VPGGLADHKYIQVVYLHNN 252

Query: 314 SFVSLPAS-------IIHLSKLGKMVLEDCKRLQSLPQPPPSIVSIRVDGCTSL 360
           +  ++ ++           +    + L     +Q     P +   + V     L
Sbjct: 253 NISAIGSNDFCPPGYNTKKASYSGVSLFSNP-VQYWEIQPSTFRCVYVRAAVQL 305
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query612
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.77
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.54
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.5
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.42
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.27
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.23
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.23
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.2
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.2
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.19
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.13
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.12
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.08
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.04
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.03
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.84
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.73
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.46
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.36
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.96
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.94
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.25
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.21
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.89  E-value=2.6e-23  Score=210.41  Aligned_cols=251  Identities=21%  Similarity=0.260  Sum_probs=197.9

Q ss_pred             CccEEEccCCcCCc--ccCccccCCCCCCeeecCC-cCCc-ccccccccCCCCcEEeccCCCCCcccccccccCCCCCEE
Q 007219           67 SLETLVLSGCLKLK--KFPDIVGSMECLQELHLDG-TDIK-ELPLSIELLSGLVRLTLYGCKNFERIPSTISALKYLSTL  142 (612)
Q Consensus        67 ~L~~L~L~~c~~l~--~~p~~~~~l~~L~~L~L~~-~~i~-~lp~~i~~l~~L~~L~L~~~~~l~~lp~~l~~l~~L~~L  142 (612)
                      .++.|+|+++...+  .+|..++++++|++|+|++ |.+. .+|.+++++++|++|+|++|......+..+..+..|+.+
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l  130 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTL  130 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhccc
Confidence            57777777765443  4677778888888888875 5665 678888888888888888877666666667778888888


Q ss_pred             ecCCCCCCccchhhhhccccccEEEccCcCCC-CCChhhhccCCC-cEEeecCCCCCCcccccccCCCCCCEEEecCCCC
Q 007219          143 NLSGLWKLREFPEIVESMEQLLELHLEGTAIR-GLPASIEFLSGL-VLLNLKDCKNLKSLPRTINGLRSLKTLHLSGCSK  220 (612)
Q Consensus       143 ~L~~~~~l~~~p~~l~~l~~L~~L~L~~~~i~-~lp~~i~~l~~L-~~L~L~~c~~l~~lp~~i~~l~~L~~L~Ls~c~~  220 (612)
                      ++++|.....+|..+..++.++.+++++|.+. .+|..+..+..+ +.+++.+|+..+..|..+..+..+ .+++..+..
T Consensus       131 ~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~  209 (313)
T d1ogqa_         131 DFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNML  209 (313)
T ss_dssp             ECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEE
T ss_pred             ccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-ccccccccc
Confidence            88888777778888888888888888888777 577777777765 778888877777777777766554 688888888


Q ss_pred             CcccccccCCCCCCcEEeccCCCCCcccCcccccccceecccCCCCccccCCCCCCCCcccEEeccCCCCCCCCCCcccc
Q 007219          221 LKNVPENLGKVESLEVLDISGCKGLLQSTSWFLHFPITLIRRNSDPVAWRFPSLSGLYCLRKLDISDCNLGEGAIPSDIG  300 (612)
Q Consensus       221 l~~lp~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~l~~L~~L~Ls~~~l~~~~ip~~l~  300 (612)
                      .+.+|..++.+++|+.+++.++....                       .++.+..+++|+.|+|++|++. +.+|..++
T Consensus       210 ~~~~~~~~~~~~~l~~l~~~~~~l~~-----------------------~~~~~~~~~~L~~L~Ls~N~l~-g~iP~~l~  265 (313)
T d1ogqa_         210 EGDASVLFGSDKNTQKIHLAKNSLAF-----------------------DLGKVGLSKNLNGLDLRNNRIY-GTLPQGLT  265 (313)
T ss_dssp             EECCGGGCCTTSCCSEEECCSSEECC-----------------------BGGGCCCCTTCCEEECCSSCCE-ECCCGGGG
T ss_pred             cccccccccccccccccccccccccc-----------------------cccccccccccccccCccCeec-ccCChHHh
Confidence            88888888888889988888775322                       2234667789999999999995 57999999


Q ss_pred             CcCCCCEEeccCCCcc-ccchhhhccccccccccccccccccCC
Q 007219          301 HLCSLKELYLSRNSFV-SLPASIIHLSKLGKMVLEDCKRLQSLP  343 (612)
Q Consensus       301 ~l~sL~~L~Ls~n~l~-~lp~~i~~L~~L~~L~l~~c~~L~~lp  343 (612)
                      .+++|++|+|++|+++ .+|+ +.++++|+.+++.+++.+...|
T Consensus       266 ~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g~p  308 (313)
T d1ogqa_         266 QLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGSP  308 (313)
T ss_dssp             GCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEESTT
T ss_pred             CCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccCCC
Confidence            9999999999999999 7884 6889999999999998887755
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure