Citrus Sinensis ID: 007237

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-
MILAPFCFQQHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSPRECYDRRWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYNLYESDHDFLDQIWK
ccccccccccccccccEEEccccccccccccccccccccEEEccccccccEEccccccHHHHcccccccEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccHHHHccccccEEcccccccccccccccccccEEEccccccccccccccccccccccccccccHHHHccccHHHHHHHHHHHHHccccccccEEEcccccccccccccccccEEEEEcccccccccccEEEEEEEEEEccccccccccccccEEEEEEEccccccEEEEcccccccccccEEEEEEEcccccccccccccccEEEEEEEccccccccccccccEEEEEEEEEEEEccccccccccccccccccccccccccccccccccc
ccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHcHHHHHHHHHcccccccccccHcccccccEEEccccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccEEEccccccccccccccccccHHHHHHHHccHcccccccccccccHHHHccccccHccccccccccccccHHHEEcccccEEEEEccccccccccccEEEEEEEEEccccccccccccEEEEEEEEEcccccccccccccccccccccEEEEEEcccccccccccccccccEEEEEEEEEEEEEcccccccEEEEEcEEEEEEEcccccccccccccccccccccccccccHHHHHcc
milapfcfQQHLNMLKVMKLshsenliktpdfteapnleelYLEGCTKLrkvhpslllhnKLIFVESLKILILSGClklrkfphvvgSMECLQELLldgtdikelplSIEHLFGLVQLTlndcknlsslpvAISSFQCLrnlklsgcsklkkfPQIVTTMEdlselnldgtsitevpssiellpglellnlndcknfarvpssinglkslktlnlsgccklenvpdtlgqvesleeldisetavrrppssvFLMKNLRtlsfsgcngppssaswhlhlpfnlmgKSSCLVALMlpslsglrsltkldlsdcglgegaipsdignlhSLNELYlsknnfvtLPASINSLLNLKELEMEDckrlqflpqlppniifVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVsdplkdfstvipgskipkwfmyqnegssitvtrpsylynMNKIVGYAICCvfhvprhstrikkrrhsyelqccmdgsdrgffitfggkfshsgsdhlwllflsprecydrrwifesnhfklsfndarekydmagsgtglkvkrcgfhpvymhEVEELDQTTKQWTHFtsynlyesdhDFLDQIWK
MILAPFCFQQHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEeldisetavrrppssVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSPRECYDRRWIFESnhfklsfndaREKYDMAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYNLYESDHDFLDQIWK
MILAPFCFQQHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIellpglellnlnDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSPRECYDRRWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYNLYESDHDFLDQIWK
**LAPFCFQQHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESL***************SVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSPRECYDRRWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYNLYESDHDFLDQI**
MILAPFCFQQHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSS****LHL*FNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSPRECYDRRWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHE********************************
MILAPFCFQQHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSPRECYDRRWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYNLYESDHDFLDQIWK
*ILAPFCFQQHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSPRECYDRRWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHE********************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILAPFCFQQHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSPRECYDRRWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYNLYESDHDFLDQIWK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query611 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.631 0.337 0.309 3e-45
O235301301 Protein SUPPRESSOR OF npr no no 0.564 0.265 0.310 7e-24
Q9SZ671895 Probable WRKY transcripti no no 0.327 0.105 0.366 3e-23
P0CB161201 Putative disease resistan no no 0.558 0.283 0.261 2e-17
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.556 0.332 0.267 6e-17
Q9V780 849 Protein lap1 OS=Drosophil yes no 0.517 0.372 0.276 7e-16
Q9FL92 1372 Probable WRKY transcripti no no 0.268 0.119 0.320 6e-15
Q9FH831288 Probable WRKY transcripti no no 0.348 0.165 0.306 3e-14
Q9BTT6524 Leucine-rich repeat-conta yes no 0.456 0.532 0.287 5e-14
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.438 0.144 0.261 7e-14
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 148/478 (30%), Positives = 223/478 (46%), Gaps = 92/478 (19%)

Query: 10   QHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLK 69
            +HL  L+ + LS S+ L +TPDFT  PN                              L+
Sbjct: 616  KHLPSLRRIDLSWSKRLTRTPDFTGMPN------------------------------LE 645

Query: 70   ILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSL 129
             + L  C  L +  H +G   C  ++                    + L LNDCK+L   
Sbjct: 646  YVNLYQCSNLEEVHHSLG---CCSKV--------------------IGLYLNDCKSLKRF 682

Query: 130  PVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITEVPSSI-ELLPGLEL 188
            P    + + L  L L  C  L+K P+I   M+   ++++ G+ I E+PSSI +    +  
Sbjct: 683  PCV--NVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTK 740

Query: 189  LNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPP 248
            L L + KN   +PSSI  LKSL +L++SGC KLE++P+ +G +++L   D S+T + RPP
Sbjct: 741  LLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPP 800

Query: 249  SSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDL 308
            SS+  +  L  L F G          H   P               P   GL SL  L+L
Sbjct: 801  SSIIRLNKLIILMFRGFKD-----GVHFEFP---------------PVAEGLHSLEYLNL 840

Query: 309  SDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQL 368
            S C L +G +P +IG+L SL +L LS+NNF  LP+SI  L  L+ L+++DC+RL  LP+L
Sbjct: 841  SYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPEL 900

Query: 369  PPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSD 428
            PP +  + V+ C   +  +  L   +     ++  D+      N +A  M     + +S 
Sbjct: 901  PPELNELHVD-CHMALKFIHYLVTKRKKLHRVKLDDAHNDTMYNLFAYTM----FQNISS 955

Query: 429  PLKDFS-------TVIPGS----KIPKWFMYQNEGSSITVTRPSYLYNMNKIVGYAIC 475
               D S       TV  G     KIP WF +Q   SS++V  P   Y  +K +G+A+C
Sbjct: 956  MRHDISASDSLSLTVFTGQPYPEKIPSWFHHQGWDSSVSVNLPENWYIPDKFLGFAVC 1013
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query611
296090591 771 unnamed protein product [Vitis vinifera] 0.913 0.723 0.426 1e-103
147802475 1244 hypothetical protein VITISV_027841 [Viti 0.873 0.429 0.409 6e-98
359486075 1291 PREDICTED: TMV resistance protein N-like 0.878 0.415 0.398 4e-93
147770134 1414 hypothetical protein VITISV_040107 [Viti 0.878 0.379 0.397 2e-92
451798988 1219 TMV resistance protein N-like protein 6 0.751 0.376 0.427 4e-92
451798990 1335 TMV resistance protein N-like protein 7 0.923 0.422 0.383 8e-92
359486073 1296 PREDICTED: TMV resistance protein N-like 0.883 0.416 0.4 2e-91
224127726 1203 tir-nbs-lrr resistance protein [Populus 0.872 0.443 0.419 3e-91
359493267 1417 PREDICTED: TMV resistance protein N-like 0.921 0.397 0.372 2e-87
147789504 1297 hypothetical protein VITISV_006193 [Viti 0.923 0.434 0.367 5e-86
>gi|296090591|emb|CBI40960.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  382 bits (982), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 260/609 (42%), Positives = 346/609 (56%), Gaps = 51/609 (8%)

Query: 10  QHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFV---- 65
           +H+  L+ + LSHS+ L++TPDF+  PNLE L  EGCT LR+VH SL + +KLIF+    
Sbjct: 82  KHMEKLECIDLSHSQYLVRTPDFSGIPNLERLIFEGCTDLREVHQSLGVLSKLIFLNLKD 141

Query: 66  -------------ESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHL 112
                        ESLK+LILSGC KL KFP ++G +  L EL L+GT I ELP SI + 
Sbjct: 142 CKNLQCFPSSIELESLKVLILSGCSKLDKFPEILGYLPNLLELHLNGTAITELPSSIGYA 201

Query: 113 FGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTS 172
             LV L + DCK   SLP  I   + L+ LKLSGC+K + FP+I+  ME L EL LDGT+
Sbjct: 202 TQLVSLDMEDCKRFKSLPCCIYKLKSLKILKLSGCAKFESFPEILENMEGLRELFLDGTA 261

Query: 173 ITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVE 232
           I E+P S+E L GL LLNL +C+    +PSSI  LKSL TL LSGC +LE +P+ LG +E
Sbjct: 262 IKELPLSVEHLNGLVLLNLRNCERLITLPSSICNLKSLSTLTLSGCSQLEKLPENLGNLE 321

Query: 233 SLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVAL 292
            L EL    +AV +PPSS+ L++NL+ LSF GCNG PSS           + + S     
Sbjct: 322 CLVELVADGSAVIQPPSSIVLLRNLKVLSFQGCNGSPSSRWNSRFWSMLCLRRISDSTGF 381

Query: 293 MLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGN-LHSLNELYLSKNNFVTLPASINSLLNL 351
            LPSLSGL SL +L+LSDC + EGA+P+D+G  L SL  L L  N+FVTLP  I+ L NL
Sbjct: 382 RLPSLSGLCSLKQLNLSDCNIKEGALPNDLGGYLSSLEYLNLKGNDFVTLPTGISKLCNL 441

Query: 352 KELEMEDCKRLQFLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIECIDSLKLLRN 411
           K L +  CKRLQ LP LPPNI  +    C+SL TL         +G+   C  +      
Sbjct: 442 KALYLGCCKRLQELPMLPPNINRINAQNCTSLETL---------SGLSAPCWLAFTNSFR 492

Query: 412 NGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQNEGSSITVTRPSYLYNMNKIVG 471
             W       YL  VS  +  F+T +PG+ IP+WF  Q  G SI V  PS+ YN N  +G
Sbjct: 493 QNWG---QETYLAEVSR-IPKFNTYLPGNGIPEWFRNQCMGDSIMVQLPSHWYNDN-FLG 547

Query: 472 YAICCVFHVPRHSTRIKKRRHSYELQCC-MDGSDRGFF---ITFGGKFSHSG---SDHLW 524
           +A+C VF + +   +  +     EL+   +D S+ G F   I + G     G   SDHLW
Sbjct: 548 FAMCIVFAL-KEPNQCSRGAMLCELESSDLDPSNLGCFLDHIVWEGHSDGDGFVESDHLW 606

Query: 525 LLFLS--PRECYDRRWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHEVEE 582
           L +    P +  D  W  + +H K SF  A         G   +VK CGF  VYM ++ +
Sbjct: 607 LGYHPNFPIKKDDMDWPNKLSHIKASFVIA---------GIPHEVKWCGFRLVYMEDLND 657

Query: 583 LDQTTKQWT 591
            +    +++
Sbjct: 658 DNSKITKYS 666

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147802475|emb|CAN61853.1| hypothetical protein VITISV_027841 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] Back     alignment and taxonomy information
>gi|451798988|gb|AGF69192.1| TMV resistance protein N-like protein 6 [Vitis labrusca] Back     alignment and taxonomy information
>gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] Back     alignment and taxonomy information
>gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|224127726|ref|XP_002329162.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870943|gb|EEF08074.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493267|ref|XP_002271591.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147789504|emb|CAN71924.1| hypothetical protein VITISV_006193 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query611
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.834 0.394 0.286 1e-42
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.584 0.180 0.333 1.4e-34
TAIR|locus:2827629 1355 AT2G17050 [Arabidopsis thalian 0.708 0.319 0.292 1.1e-30
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.612 0.315 0.307 9.4e-30
TAIR|locus:22058241384 AT1G27170 [Arabidopsis thalian 0.639 0.282 0.282 9.4e-29
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.410 0.205 0.365 1.7e-28
TAIR|locus:22058041556 AT1G27180 [Arabidopsis thalian 0.639 0.251 0.278 3.1e-28
TAIR|locus:20534051215 AT2G14080 [Arabidopsis thalian 0.618 0.311 0.295 1.3e-25
TAIR|locus:21533281231 AT5G45230 [Arabidopsis thalian 0.340 0.168 0.387 2.8e-25
TAIR|locus:2167457 1191 AT5G36930 [Arabidopsis thalian 0.587 0.301 0.310 5.6e-25
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 464 (168.4 bits), Expect = 1.0e-42, P = 1.0e-42
 Identities = 161/562 (28%), Positives = 267/562 (47%)

Query:    37 NLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQEL- 95
             +LE + + GC+ L K  P +  + + +++ S KI          + P  +  + CL +L 
Sbjct:   696 SLETVGMSGCSSL-KHFPEISWNTRRLYLSSTKI---------EELPSSISRLSCLVKLD 745

Query:    96 LLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQ 155
             + D   ++ LP  + HL  L  L L+ C+ L +LP  + +   L  L++SGC  + +FP+
Sbjct:   746 MSDCQRLRTLPSYLGHLVSLKSLNLDGCRRLENLPDTLQNLTSLETLEVSGCLNVNEFPR 805

Query:   156 IVTTMEDLSELNLDGTSITEVPSSIXXXXXXXXXXXXDCKNFARVPSSINGLKSLKTLNL 215
             + T++E    L +  TSI E+P+ I            + K  A +P SI+ L+SL+ L L
Sbjct:   806 VSTSIE---VLRISETSIEEIPARICNLSQLRSLDISENKRLASLPVSISELRSLEKLKL 862

Query:   216 SGCCKLENVPDTLGQVES-LEELDISETAVRRPPSSVFLMKNLRTLSFSGC--NGPPSSA 272
             SGC  LE+ P  + Q  S L   D+  T+++  P ++  +  L  L  S       P S 
Sbjct:   863 SGCSVLESFPLEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASRTVIRRAPWSI 922

Query:   273 SWHLHLPFNLMGKS----SCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSL 328
             +    L    +G S      L+  + P LS    L  L LS+  + E  IP+ IGNL +L
Sbjct:   923 ARLTRLQVLAIGNSFFTPEGLLHSLCPPLSRFDDLRALSLSNMNMTE--IPNSIGNLWNL 980

Query:   329 NELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLP-QLPPNIIFVKVNGCSSLVTLL 387
              EL LS NNF  +PASI  L  L  L + +C+RLQ LP +LP  ++++ ++ C+SLV++ 
Sbjct:   981 LELDLSGNNFEFIPASIKRLTRLNRLNLNNCQRLQALPDELPRGLLYIYIHSCTSLVSIS 1040

Query:   388 GAL-KLCKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWF 446
             G   + C    +   C    KL   +  A +++   L+  S   K   +  PGS IP  F
Sbjct:  1041 GCFNQYCLRKLVASNCY---KL---DQAAQILIHRNLKLES--AKPEHSYFPGSDIPTCF 1092

Query:   447 MYQNEGSSITVTRPSYLYNMNKIVGYAICCVFHV----PRHSTRIKKRRHSYELQCC-MD 501
              +Q  G S+ +  P    + + I+G++ C +  V    P ++ +I       +   C + 
Sbjct:  1093 NHQVMGPSLNIQLPQS-ESSSDILGFSACIMIGVDGQYPMNNLKIHCSCILKDADACELV 1151

Query:   502 GSDRGFFITFGGKFSHS--GSDHLWLLFLSPRECYDRRWIFESNHFKLSF-NDAREKYDM 558
               D  ++      F++   GSDHL LLF   R C       E+  F+ S  N   + +  
Sbjct:  1152 VMDEVWYPD-PKAFTNMYFGSDHL-LLF--SRTCTSMEAYSEAL-FEFSVENTEGDSFSP 1206

Query:   559 AGSGTGLKVKRCGFHPVYMHEV 580
              G     +VK+C  H + + ++
Sbjct:  1207 LG-----EVKKCAVHLISLKDM 1223
GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query611
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-26
PLN032101153 PLN03210, PLN03210, Resistant to P 6e-18
PLN032101153 PLN03210, PLN03210, Resistant to P 4e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  115 bits (289), Expect = 1e-26
 Identities = 100/326 (30%), Positives = 149/326 (45%), Gaps = 75/326 (23%)

Query: 10  QHLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKL------- 62
             L  L+ + L  S+NL + PD + A NLE L L  C+ L ++  S+   NKL       
Sbjct: 631 HSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSR 690

Query: 63  ----------IFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHL 112
                     I ++SL  L LSGC +L+ FP +  +   +  L LD T I+E P ++  L
Sbjct: 691 CENLEILPTGINLKSLYRLNLSGCSRLKSFPDISTN---ISWLDLDETAIEEFPSNL-RL 746

Query: 113 FGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQIVT---TM--EDLSELN 167
             L +L L + K+                       KL +  Q +T   TM    L+ L 
Sbjct: 747 ENLDELILCEMKS----------------------EKLWERVQPLTPLMTMLSPSLTRLF 784

Query: 168 L-DGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPD 226
           L D  S+ E+PSSI+ L  LE L + +C N   +P+ IN L+SL++L+LSGC +L   PD
Sbjct: 785 LSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGIN-LESLESLDLSGCSRLRTFPD 843

Query: 227 TLGQVESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKS 286
                 ++ +L++S T +   P  +    NL  L  +GCN              NL   S
Sbjct: 844 I---STNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCN--------------NLQRVS 886

Query: 287 SCLVALMLPSLSGLRSLTKLDLSDCG 312
                    ++S L+ L  +D SDCG
Sbjct: 887 --------LNISKLKHLETVDFSDCG 904

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 611
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
PLN032101153 Resistant to P. syringae 6; Provisional 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.75
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.72
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.72
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.58
KOG4237498 consensus Extracellular matrix protein slit, conta 99.52
KOG0617264 consensus Ras suppressor protein (contains leucine 99.51
KOG0617264 consensus Ras suppressor protein (contains leucine 99.48
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.46
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.45
KOG4237498 consensus Extracellular matrix protein slit, conta 99.41
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.28
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.97
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.94
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.92
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.91
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.72
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.71
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.71
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.66
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.64
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.61
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.6
KOG4341483 consensus F-box protein containing LRR [General fu 98.57
PRK15386426 type III secretion protein GogB; Provisional 98.52
PLN03150623 hypothetical protein; Provisional 98.45
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.45
PLN03150623 hypothetical protein; Provisional 98.42
PRK15386426 type III secretion protein GogB; Provisional 98.39
KOG4341483 consensus F-box protein containing LRR [General fu 98.34
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.29
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.15
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.1
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.05
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.04
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.02
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.91
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.9
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.68
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.64
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.58
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.51
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.35
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.29
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.27
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.19
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.19
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.12
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.1
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.07
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.72
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.71
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.78
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.73
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.54
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.25
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.21
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.11
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.13
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.83
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.63
smart0037026 LRR Leucine-rich repeats, outliers. 87.63
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.27
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 82.85
smart0037026 LRR Leucine-rich repeats, outliers. 82.85
KOG4308478 consensus LRR-containing protein [Function unknown 81.69
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=5.6e-41  Score=394.53  Aligned_cols=503  Identities=22%  Similarity=0.277  Sum_probs=356.1

Q ss_pred             cccccCCCcccEEEccCCCC------CCcCC-CCCCCc-ccccccccccccccccCccccccCccccCCCccEEEecCCc
Q 007237            6 FCFQQHLNMLKVMKLSHSEN------LIKTP-DFTEAP-NLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCL   77 (611)
Q Consensus         6 ~~~~~~l~~L~~L~Ls~~~~------l~~~~-~~~~~~-~L~~L~L~~c~~l~~i~~s~~~l~~L~~l~~L~~L~Ls~~~   77 (611)
                      -+.++.+++|+.|.+..+..      ...+| .|..+| +|+.|.+.++ .++.+|..+.       +.+|++|+++++.
T Consensus       551 ~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~-~l~~lP~~f~-------~~~L~~L~L~~s~  622 (1153)
T PLN03210        551 ENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKY-PLRCMPSNFR-------PENLVKLQMQGSK  622 (1153)
T ss_pred             HHHHhcCccccEEEEecccccccccceeecCcchhhcCcccEEEEecCC-CCCCCCCcCC-------ccCCcEEECcCcc
Confidence            45578899999999876531      11233 455554 6899999886 5677776531       4688899998876


Q ss_pred             CcCcCCcccCCCCCCcEEEcCCCC-ccccCccccCCCCCcEEeccCCCCCCCCcccCCCCCCCCEEEecCCCCCcccccc
Q 007237           78 KLRKFPHVVGSMECLQELLLDGTD-IKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQI  156 (611)
Q Consensus        78 ~~~~lp~~l~~l~~L~~L~L~~~~-i~~lp~~~~~l~~L~~L~L~~c~~l~~lp~~l~~l~~L~~L~L~~~~~l~~~p~~  156 (611)
                      + ..++..+..+++|++|+++++. ++.+| .+..+++|++|++++|..+..+|..+.++++|+.|++++|..++.+|..
T Consensus       623 l-~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip-~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~  700 (1153)
T PLN03210        623 L-EKLWDGVHSLTGLRNIDLRGSKNLKEIP-DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTG  700 (1153)
T ss_pred             c-cccccccccCCCCCEEECCCCCCcCcCC-ccccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCc
Confidence            4 4577778889999999998764 66777 4778889999999999989999988888999999999999888888876


Q ss_pred             cCCCCCCCEEeecCccC-CCcCcccCCCCCCCEEeccCCcCCcccccCccCCCCCCEEEecCCCCCcc------c-Cccc
Q 007237          157 VTTMEDLSELNLDGTSI-TEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLEN------V-PDTL  228 (611)
Q Consensus       157 ~~~l~~L~~L~L~~~~i-~~l~~~l~~l~~L~~L~L~~~~~~~~lp~~i~~l~~L~~L~l~~c~~l~~------~-p~~l  228 (611)
                      + ++++|+.|++++|.. ..+|..   .++|+.|+++++. ...+|..+ .+++|+.|.+.++.....      + +...
T Consensus       701 i-~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~-i~~lP~~~-~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~  774 (1153)
T PLN03210        701 I-NLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDETA-IEEFPSNL-RLENLDELILCEMKSEKLWERVQPLTPLMT  774 (1153)
T ss_pred             C-CCCCCCEEeCCCCCCccccccc---cCCcCeeecCCCc-cccccccc-cccccccccccccchhhccccccccchhhh
Confidence            6 788899999988743 345532   4678888998876 45677655 578888888876542111      1 1112


Q ss_pred             CCCCCccEEeccCCCc-ccCCccccccCCCcEEEcCCCCCCCCCCcccccccccccCCccchhhccCCCCCCCCCCCEEe
Q 007237          229 GQVESLEELDISETAV-RRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLD  307 (611)
Q Consensus       229 ~~l~~L~~L~l~~~~~-~~~~~~~~~l~~L~~L~l~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~l~~L~~L~  307 (611)
                      ...++|+.|++++|.. ..+|..+..+++|+.|++++|..+..                       +|....+++|+.|+
T Consensus       775 ~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~-----------------------LP~~~~L~sL~~L~  831 (1153)
T PLN03210        775 MLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLET-----------------------LPTGINLESLESLD  831 (1153)
T ss_pred             hccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCe-----------------------eCCCCCccccCEEE
Confidence            2346899999998854 47888899999999999999874422                       33333678999999


Q ss_pred             ccCCCCCCCCCCCCCCCCCCCCEEEcCCCCCCcCCcccccCCCcCeeecccccccCcCCCCC---CCcceeeecCCCCcc
Q 007237          308 LSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFLPQLP---PNIIFVKVNGCSSLV  384 (611)
Q Consensus       308 Ls~~~l~~~~~~~~l~~l~~L~~L~L~~n~l~~lp~~i~~l~~L~~L~L~~c~~L~~lp~lp---~~L~~L~i~~C~sL~  384 (611)
                      +++|... ..+|..   .++|+.|+|++|.++.+|.++..+++|+.|++++|++++.+|..+   ++|+.+++.+|++|+
T Consensus       832 Ls~c~~L-~~~p~~---~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~  907 (1153)
T PLN03210        832 LSGCSRL-RTFPDI---STNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALT  907 (1153)
T ss_pred             CCCCCcc-cccccc---ccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccc
Confidence            9998654 334432   468999999999999999999999999999999999999988644   466778999999998


Q ss_pred             cccCcccc--------------cccCCcccccccchhhccchhHHHHHHHHHHHhhcCCCcceEEeecCCCCCCcccccC
Q 007237          385 TLLGALKL--------------CKSNGIVIECIDSLKLLRNNGWAILMLREYLEAVSDPLKDFSTVIPGSKIPKWFMYQN  450 (611)
Q Consensus       385 ~l~~~~~~--------------~~l~~l~~~~c~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~iP~wf~~~~  450 (611)
                      .+.....+              .....+.|.+|.+|+....       ++    ..   .....+++||.++|+||.||+
T Consensus       908 ~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~nC~~L~~~a~-------l~----~~---~~~~~~~l~g~evp~~f~hr~  973 (1153)
T PLN03210        908 EASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQEAL-------LQ----QQ---SIFKQLILSGEEVPSYFTHRT  973 (1153)
T ss_pred             cccCCCCchhhhhhcccccccCCchhccccccccCCCchhh-------hc----cc---ccceEEECCCccCchhccCCc
Confidence            76532211              1113357889988863211       11    11   111357899999999999999


Q ss_pred             CCceEE-EEcCCCCcCCCcEEEEEEEEEEecCCcchhhcccccccceeEEEeCCCCceEEeeccccCCCCCCeEEEEEec
Q 007237          451 EGSSIT-VTRPSYLYNMNKIVGYAICCVFHVPRHSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLS  529 (611)
Q Consensus       451 ~g~si~-~~lp~~~~~~~~~~g~~~c~v~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~sdh~~~~~~~  529 (611)
                      .|++++ |.+|+.|... .|.||++|+|+.......  ......+.+.|.+.+..+..+.       ....+|+|+.|..
T Consensus       974 ~g~sl~~i~l~~~~~~~-~~~~f~~c~v~~~~~~~~--~~~~~~~~~~c~~~~~~~~~~~-------~~~~~~~~~~~~~ 1043 (1153)
T PLN03210        974 TGASLTNIPLLHISPCQ-PFFRFRACAVVDSESFFI--ISVSFDIQVCCRFIDRLGNHFD-------SPYQPHVFSVTKK 1043 (1153)
T ss_pred             ccceeeeeccCCcccCC-CccceEEEEEEecCcccc--CCCceeEEEEEEEECCCCCccc-------cCCCceeEeeecc
Confidence            999998 9999999876 799999999997644221  0112345678888877554432       2345555555542


Q ss_pred             c---------ccc--CCc-ccccccceEEEEEechhhccccCCCCCCccEeeeeceEEecccccc
Q 007237          530 P---------REC--YDR-RWIFESNHFKLSFNDAREKYDMAGSGTGLKVKRCGFHPVYMHEVEE  582 (611)
Q Consensus       530 ~---------~~~--~~~-~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~vk~cG~~l~y~~~~~~  582 (611)
                      .         ...  +.. .....++|+.+.|++.       ......+||+|||+++|.++..+
T Consensus      1044 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~-------~~~~~~~~~~cg~~~~~~~~~~~ 1101 (1153)
T PLN03210       1044 GSHLVIFDCCFPLNEDNAPLAELNYDHVDIQFRLT-------NKNSQLKLKGCGIRLSEDDSSLN 1101 (1153)
T ss_pred             ccceEEecccccccccccchhccCCceeeEEEEEe-------cCCCCeEEEeeeEEEeccCCCcc
Confidence            1         110  000 1112377888887622       11223699999999999766554

syringae 6; Provisional
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query611
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 1e-10
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 1e-08
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 1e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 88/200 (44%), Gaps = 14/200 (7%)
Query: 77  LKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKN-LSSLPVAISS 135
           + L +FP     +  LQ   +D   + ELP + +   GL  LTL   +N L +LP +I+S
Sbjct: 91  VPLPQFPDQAFRLSHLQHXTIDAAGLXELPDTXQQFAGLETLTL--ARNPLRALPASIAS 148
Query: 136 FQCLRNLKLSGCSKLKKFPQIVTTME---------DLSELNLDGTSITEVPSSIXXXXXX 186
              LR L +  C +L + P+ + + +         +L  L L+ T I  +P+SI      
Sbjct: 149 LNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNL 208
Query: 187 XXXXXXDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVESLEELDISE-TAVR 245
                 +    A  P +I+ L  L+ L+L GC  L N P   G    L+ L + + + + 
Sbjct: 209 KSLKIRNSPLSALGP-AIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLL 267
Query: 246 RPPSSVFLMKNLRTLSFSGC 265
             P  +  +  L  L   GC
Sbjct: 268 TLPLDIHRLTQLEKLDLRGC 287
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query611
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-54
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-50
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-42
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-30
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-26
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-20
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-18
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-16
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-19
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-14
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-13
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-11
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 7e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  185 bits (472), Expect = 8e-54
 Identities = 69/326 (21%), Positives = 121/326 (37%), Gaps = 42/326 (12%)

Query: 58  LHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQELLLDGTDIKELPLSIEHLFGLVQ 117
            H+        + L   G   LR +  V+   +       +            +     Q
Sbjct: 4   SHHHHHHSSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRW---HSAWRQANS-NNPQ 59

Query: 118 LTLNDCKNLSSLPVAI--SSFQCLRNLKLSGCSKLKKFPQIVTTMEDLSELNLDGTSITE 175
           +     + L +    +  ++      L+L     L +FP     +  L  + +D   + E
Sbjct: 60  IETRTGRALKATADLLEDATQPGRVALELRSV-PLPQFPDQAFRLSHLQHMTIDAAGLME 118

Query: 176 VPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQVE--- 232
           +P +++   GLE L L        +P+SI  L  L+ L++  C +L  +P+ L   +   
Sbjct: 119 LPDTMQQFAGLETLTLARNP-LRALPASIASLNRLRELSIRACPELTELPEPLASTDASG 177

Query: 233 ------SLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKS 286
                 +L+ L +  T +R  P+S+  ++NL++L                          
Sbjct: 178 EHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSP-------------------- 217

Query: 287 SCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLS-KNNFVTLPASI 345
             L AL  P++  L  L +LDL  C       P   G    L  L L   +N +TLP  I
Sbjct: 218 --LSAL-GPAIHHLPKLEELDLRGCTALRN-YPPIFGGRAPLKRLILKDCSNLLTLPLDI 273

Query: 346 NSLLNLKELEMEDCKRLQFLPQLPPN 371
           + L  L++L++  C  L  LP L   
Sbjct: 274 HRLTQLEKLDLRGCVNLSRLPSLIAQ 299
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query611
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.98
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.98
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.84
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.84
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.79
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.76
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.74
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.71
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.69
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.66
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.66
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.64
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.62
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.62
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.61
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.6
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.56
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.56
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.54
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.54
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.54
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.54
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.53
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.53
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.52
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.52
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.51
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.46
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.43
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.43
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.38
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.38
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.36
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.34
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.3
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.29
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.28
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.25
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.25
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.24
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.23
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.19
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.18
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.17
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.08
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.03
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.99
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.99
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.94
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.94
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.89
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.71
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.7
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.67
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.64
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.62
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.55
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.48
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.46
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.45
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.34
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.83
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.69
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.66
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.62
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.54
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.31
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.57
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.42
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.38
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 91.54
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
Probab=100.00  E-value=1.4e-34  Score=322.95  Aligned_cols=340  Identities=16%  Similarity=0.193  Sum_probs=273.8

Q ss_pred             CCCCCcccccccccccccccc------------------cCccccccCccccCCCccEEEecCCcCcCcCCcccCCCCCC
Q 007237           31 DFTEAPNLEELYLEGCTKLRK------------------VHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECL   92 (611)
Q Consensus        31 ~~~~~~~L~~L~L~~c~~l~~------------------i~~s~~~l~~L~~l~~L~~L~Ls~~~~~~~lp~~l~~l~~L   92 (611)
                      .+..+++|++|+|++|. ++.                  +|.+++.    ..+++|++|++++|.+.+.+|..++++++|
T Consensus       201 ~l~~l~~L~~L~Ls~n~-l~~~~~~~~~~~~~~~~~~~~ip~~l~~----~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L  275 (636)
T 4eco_A          201 AVMRLTKLRQFYMGNSP-FVAENICEAWENENSEYAQQYKTEDLKW----DNLKDLTDVEVYNCPNLTKLPTFLKALPEM  275 (636)
T ss_dssp             GGGGCTTCCEEEEESCC-CCGGGBSSSCSCTTSHHHHHHTTSCCCG----GGCTTCCEEEEECCTTCSSCCTTTTTCSSC
T ss_pred             HHhcccCCCEEECcCCc-cccccccccccccccchhcccCchhhhh----cccCCCCEEEecCCcCCccChHHHhcCCCC
Confidence            37889999999999985 666                  7776650    137889999999999999999999999999


Q ss_pred             cEEEcCCCC-cc--ccCccccCC------CCCcEEeccCCCCCCCCcc--cCCCCCCCCEEEecCCCCCcccccccCCCC
Q 007237           93 QELLLDGTD-IK--ELPLSIEHL------FGLVQLTLNDCKNLSSLPV--AISSFQCLRNLKLSGCSKLKKFPQIVTTME  161 (611)
Q Consensus        93 ~~L~L~~~~-i~--~lp~~~~~l------~~L~~L~L~~c~~l~~lp~--~l~~l~~L~~L~L~~~~~l~~~p~~~~~l~  161 (611)
                      ++|++++|. ++  .+|..++.+      ++|++|++++|. +..+|.  .++++++|++|++++|...+.+| .++.++
T Consensus       276 ~~L~Ls~n~~l~~~~lp~~~~~L~~~~~l~~L~~L~L~~n~-l~~ip~~~~l~~l~~L~~L~L~~N~l~g~ip-~~~~l~  353 (636)
T 4eco_A          276 QLINVACNRGISGEQLKDDWQALADAPVGEKIQIIYIGYNN-LKTFPVETSLQKMKKLGMLECLYNQLEGKLP-AFGSEI  353 (636)
T ss_dssp             CEEECTTCTTSCHHHHHHHHHHHHHSGGGGTCCEEECCSSC-CSSCCCHHHHTTCTTCCEEECCSCCCEEECC-CCEEEE
T ss_pred             CEEECcCCCCCccccchHHHHhhhccccCCCCCEEECCCCc-CCccCchhhhccCCCCCEEeCcCCcCccchh-hhCCCC
Confidence            999999998 88  499888876      999999999976 459998  89999999999999988776888 888999


Q ss_pred             CCCEEeecCccCCCcCcccCCCCC-CCEEeccCCcCCcccccCccCCC--CCCEEEecCCCCCcccCcccC-------CC
Q 007237          162 DLSELNLDGTSITEVPSSIELLPG-LELLNLNDCKNFARVPSSINGLK--SLKTLNLSGCCKLENVPDTLG-------QV  231 (611)
Q Consensus       162 ~L~~L~L~~~~i~~l~~~l~~l~~-L~~L~L~~~~~~~~lp~~i~~l~--~L~~L~l~~c~~l~~~p~~l~-------~l  231 (611)
                      +|++|++++|.++.+|..+..+++ |+.|++++|... .+|..+..++  +|+.|++++|...+..|..+.       .+
T Consensus       354 ~L~~L~L~~N~l~~lp~~l~~l~~~L~~L~Ls~N~l~-~lp~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~~~~~~~~~  432 (636)
T 4eco_A          354 KLASLNLAYNQITEIPANFCGFTEQVENLSFAHNKLK-YIPNIFDAKSVSVMSAIDFSYNEIGSVDGKNFDPLDPTPFKG  432 (636)
T ss_dssp             EESEEECCSSEEEECCTTSEEECTTCCEEECCSSCCS-SCCSCCCTTCSSCEEEEECCSSCTTTTTTCSSCTTCSSCCCC
T ss_pred             CCCEEECCCCccccccHhhhhhcccCcEEEccCCcCc-ccchhhhhcccCccCEEECcCCcCCCcchhhhcccccccccC
Confidence            999999999999999999999999 999999999876 7888877655  899999999999888888887       78


Q ss_pred             CCccEEeccCCCcccCCccccc-cCCCcEEEcCCCCCCCCCCcc-cccc-------cccccCCccchhhccCCC-CC--C
Q 007237          232 ESLEELDISETAVRRPPSSVFL-MKNLRTLSFSGCNGPPSSASW-HLHL-------PFNLMGKSSCLVALMLPS-LS--G  299 (611)
Q Consensus       232 ~~L~~L~l~~~~~~~~~~~~~~-l~~L~~L~l~~c~~~~~~~~~-~~~~-------~~~~~~~~~~~~~~~l~~-l~--~  299 (611)
                      ++|+.|++++|.+..+|..+.. +++|++|++++|......... ....       .+..+....+... .+|. +.  .
T Consensus       433 ~~L~~L~Ls~N~l~~lp~~~~~~l~~L~~L~Ls~N~l~~i~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~-~lp~~~~~~~  511 (636)
T 4eco_A          433 INVSSINLSNNQISKFPKELFSTGSPLSSINLMGNMLTEIPKNSLKDENENFKNTYLLTSIDLRFNKLT-KLSDDFRATT  511 (636)
T ss_dssp             CCEEEEECCSSCCCSCCTHHHHTTCCCSEEECCSSCCSBCCSSSSEETTEECTTGGGCCEEECCSSCCC-BCCGGGSTTT
T ss_pred             CCCCEEECcCCccCcCCHHHHccCCCCCEEECCCCCCCCcCHHHhccccccccccCCccEEECcCCcCC-ccChhhhhcc
Confidence            8999999999999999887654 899999999999854211111 1000       2222333333222 3333 44  7


Q ss_pred             CCCCCEEeccCCCCCCCCCCCCCCCCCCCCEEEcC------CCCCC-cCCcccccCCCcCeeecccccccCcCCC-CCCC
Q 007237          300 LRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLS------KNNFV-TLPASINSLLNLKELEMEDCKRLQFLPQ-LPPN  371 (611)
Q Consensus       300 l~~L~~L~Ls~~~l~~~~~~~~l~~l~~L~~L~L~------~n~l~-~lp~~i~~l~~L~~L~L~~c~~L~~lp~-lp~~  371 (611)
                      +++|+.|++++|.+..  +|..+..+++|+.|+|+      +|++. .+|..+..+++|++|+|++|+. ..+|. +.++
T Consensus       512 l~~L~~L~Ls~N~l~~--ip~~~~~l~~L~~L~Ls~N~~ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l-~~ip~~~~~~  588 (636)
T 4eco_A          512 LPYLVGIDLSYNSFSK--FPTQPLNSSTLKGFGIRNQRDAQGNRTLREWPEGITLCPSLTQLQIGSNDI-RKVNEKITPN  588 (636)
T ss_dssp             CTTCCEEECCSSCCSS--CCCGGGGCSSCCEEECCSCBCTTCCBCCCCCCTTGGGCSSCCEEECCSSCC-CBCCSCCCTT
T ss_pred             CCCcCEEECCCCCCCC--cChhhhcCCCCCEEECCCCcccccCcccccChHHHhcCCCCCEEECCCCcC-CccCHhHhCc
Confidence            8888888888888853  78888888888888884      45544 7788888888888888888874 77775 6678


Q ss_pred             cceeeecCCCC
Q 007237          372 IIFVKVNGCSS  382 (611)
Q Consensus       372 L~~L~i~~C~s  382 (611)
                      |+.|++++++-
T Consensus       589 L~~L~Ls~N~l  599 (636)
T 4eco_A          589 ISVLDIKDNPN  599 (636)
T ss_dssp             CCEEECCSCTT
T ss_pred             CCEEECcCCCC
Confidence            88888888764
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 611
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 4e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 68.1 bits (165), Expect = 4e-13
 Identities = 52/299 (17%), Positives = 99/299 (33%), Gaps = 25/299 (8%)

Query: 36  PNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSMECLQEL 95
           P+   L L+   K+ ++      + K     +L  LIL      +  P     +  L+ L
Sbjct: 31  PDTALLDLQNN-KITEIKDGDFKNLK-----NLHTLILINNKISKISPGAFAPLVKLERL 84

Query: 96  LLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSLPVAISSFQCLRNLKLSGCSKLKKFPQ 155
            L    +KELP  +      +++  N+   +        +   +  L  +          
Sbjct: 85  YLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENG 144

Query: 156 IVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNL 215
               M+ LS + +  T+IT +P    L P L  L+L+  K      +S+ GL +L  L L
Sbjct: 145 AFQGMKKLSYIRIADTNITTIPQG--LPPSLTELHLDGNKITKVDAASLKGLNNLAKLGL 202

Query: 216 SGCCKLENVPDTLGQVESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWH 275
           S          +L     L EL ++   + + P  +   K ++ +               
Sbjct: 203 SFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHN----------- 251

Query: 276 LHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAI-PSDIGNLHSLNELYL 333
                N +              +   S + + L    +    I PS    ++    + L
Sbjct: 252 -----NNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQL 305
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query611
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.77
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.53
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.52
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.3
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.3
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.26
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.25
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.25
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.24
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.23
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.19
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.15
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.12
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.96
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.9
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.85
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.72
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.77
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.33
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.93
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.8
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.23
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.85
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.90  E-value=1.5e-22  Score=208.90  Aligned_cols=305  Identities=17%  Similarity=0.261  Sum_probs=169.4

Q ss_pred             CCCcccEEEccCCCCCCcCCCCCCCcccccccccccccccccCccccccCccccCCCccEEEecCCcCcCcCCcccCCCC
Q 007237           11 HLNMLKVMKLSHSENLIKTPDFTEAPNLEELYLEGCTKLRKVHPSLLLHNKLIFVESLKILILSGCLKLRKFPHVVGSME   90 (611)
Q Consensus        11 ~l~~L~~L~Ls~~~~l~~~~~~~~~~~L~~L~L~~c~~l~~i~~s~~~l~~L~~l~~L~~L~Ls~~~~~~~lp~~l~~l~   90 (611)
                      .+.+|++|+++++. ...+..+..+++|++|++++| .++.+++       +..+++|++|++++|.+.+..  .++.++
T Consensus        42 ~l~~l~~L~l~~~~-I~~l~gl~~L~nL~~L~Ls~N-~l~~l~~-------l~~L~~L~~L~L~~n~i~~i~--~l~~l~  110 (384)
T d2omza2          42 DLDQVTTLQADRLG-IKSIDGVEYLNNLTQINFSNN-QLTDITP-------LKNLTKLVDILMNNNQIADIT--PLANLT  110 (384)
T ss_dssp             HHTTCCEEECCSSC-CCCCTTGGGCTTCCEEECCSS-CCCCCGG-------GTTCTTCCEEECCSSCCCCCG--GGTTCT
T ss_pred             HhCCCCEEECCCCC-CCCccccccCCCCCEEeCcCC-cCCCCcc-------ccCCccccccccccccccccc--cccccc
Confidence            45677888887764 344556677788888888776 5666542       334677788888877765432  267777


Q ss_pred             CCcEEEcCCCCccccCccccCCCCCcEEeccCCCCCCCC--------------------cccCCCCCCCCEEEecCCCCC
Q 007237           91 CLQELLLDGTDIKELPLSIEHLFGLVQLTLNDCKNLSSL--------------------PVAISSFQCLRNLKLSGCSKL  150 (611)
Q Consensus        91 ~L~~L~L~~~~i~~lp~~~~~l~~L~~L~L~~c~~l~~l--------------------p~~l~~l~~L~~L~L~~~~~l  150 (611)
                      +|+.|+++++.+..++... ....+..+....+. +..+                    ...+.............+  .
T Consensus       111 ~L~~L~~~~~~~~~~~~~~-~~~~~~~~~~~~~~-l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~  186 (384)
T d2omza2         111 NLTGLTLFNNQITDIDPLK-NLTNLNRLELSSNT-ISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSN--K  186 (384)
T ss_dssp             TCCEEECCSSCCCCCGGGT-TCTTCSEEEEEEEE-ECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSS--C
T ss_pred             ccccccccccccccccccc-cccccccccccccc-ccccccccccccccccccccccchhhhhcccccccccccccc--c
Confidence            8888887777766544322 12222222221110 0000                    000111122222222211  1


Q ss_pred             cccccccCCCCCCCEEeecCccCCCcCcccCCCCCCCEEeccCCcCCcccccCccCCCCCCEEEecCCCCCcccCcccCC
Q 007237          151 KKFPQIVTTMEDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNFARVPSSINGLKSLKTLNLSGCCKLENVPDTLGQ  230 (611)
Q Consensus       151 ~~~p~~~~~l~~L~~L~L~~~~i~~l~~~l~~l~~L~~L~L~~~~~~~~lp~~i~~l~~L~~L~l~~c~~l~~~p~~l~~  230 (611)
                      .........+++++.+++.++.++.+++ ....++|+.|++++|.... ++ .+..+++|+.|++++|...+ ++ .++.
T Consensus       187 ~~~~~~~~~l~~~~~l~l~~n~i~~~~~-~~~~~~L~~L~l~~n~l~~-~~-~l~~l~~L~~L~l~~n~l~~-~~-~~~~  261 (384)
T d2omza2         187 VSDISVLAKLTNLESLIATNNQISDITP-LGILTNLDELSLNGNQLKD-IG-TLASLTNLTDLDLANNQISN-LA-PLSG  261 (384)
T ss_dssp             CCCCGGGGGCTTCSEEECCSSCCCCCGG-GGGCTTCCEEECCSSCCCC-CG-GGGGCTTCSEEECCSSCCCC-CG-GGTT
T ss_pred             cccccccccccccceeeccCCccCCCCc-ccccCCCCEEECCCCCCCC-cc-hhhcccccchhccccCccCC-CC-cccc
Confidence            1223344556667777777776666543 3445667777777665432 22 45566777777777665332 22 2566


Q ss_pred             CCCccEEeccCCCcccCCccccccCCCcEEEcCCCCCCCCCCcccccccccccCCccchhhccCCCCCCCCCCCEEeccC
Q 007237          231 VESLEELDISETAVRRPPSSVFLMKNLRTLSFSGCNGPPSSASWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSD  310 (611)
Q Consensus       231 l~~L~~L~l~~~~~~~~~~~~~~l~~L~~L~l~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~l~~L~~L~Ls~  310 (611)
                      +++|+.|+++++.+..+++ +..++.++.+.+.+|...                        .++.+..+++++.|++++
T Consensus       262 ~~~L~~L~l~~~~l~~~~~-~~~~~~l~~l~~~~n~l~------------------------~~~~~~~~~~l~~L~ls~  316 (384)
T d2omza2         262 LTKLTELKLGANQISNISP-LAGLTALTNLELNENQLE------------------------DISPISNLKNLTYLTLYF  316 (384)
T ss_dssp             CTTCSEEECCSSCCCCCGG-GTTCTTCSEEECCSSCCS------------------------CCGGGGGCTTCSEEECCS
T ss_pred             cccCCEeeccCcccCCCCc-cccccccccccccccccc------------------------cccccchhcccCeEECCC
Confidence            6777777777776665543 445666666666665421                        112244556666677776


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEcCCCCCCcCCcccccCCCcCeeecccccccCcC
Q 007237          311 CGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQFL  365 (611)
Q Consensus       311 ~~l~~~~~~~~l~~l~~L~~L~L~~n~l~~lp~~i~~l~~L~~L~L~~c~~L~~l  365 (611)
                      |++.+  ++ .+..+++|++|++++|+++.++ .+..+++|++|++++|+ ++.+
T Consensus       317 n~l~~--l~-~l~~l~~L~~L~L~~n~l~~l~-~l~~l~~L~~L~l~~N~-l~~l  366 (384)
T d2omza2         317 NNISD--IS-PVSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQ-ISDL  366 (384)
T ss_dssp             SCCSC--CG-GGGGCTTCCEEECCSSCCCCCG-GGGGCTTCCEEECCSSC-CCBC
T ss_pred             CCCCC--Cc-ccccCCCCCEEECCCCCCCCCh-hHcCCCCCCEEECCCCc-CCCC
Confidence            66642  22 2566667777777777666665 46666777777776664 4444
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure