Citrus Sinensis ID: 007310

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------61

MRVVLVDFRFTYAIVLSLLWVSSSVIGRSNAASSLLNDPFYGISPQDENYYKTSSNTIKCKDGSKKFAKTQLNDDYCDCPDGTDEPGTSACPNGKFYCQNAGHSPLMIFSSKVNDGICDCCDGSDEYDGKVKCPNTCWEAGKVARDKLKKKIATYQEGVLLRKKEIEQAKQNLVKDEAELSNLKNEEKILKGLVQQLKERKEQIEKAEEKERLQREKEEKERKEAEENERKEKSESGEKAMQEKNKAEENAYSDDKPDDVRHDDKVGVLEEESFDQGKAENVDEEPATEAKQIGTSQNLGTPVNGVEQHATEEMEQSASSRSKDGSSTVPETSSDAESQMPPEAEKKEEKNLENGVSENTEELSREELGRLVASRWTGEKTEKQSGEGGAIANDDQGEDVPEYNHDDEEDRYATDTDDDSERYDTEKYDDNDVEDDIDEPYREEDHDYTSTSYKTDVDDDLDMSEMTTPSSPSWLEKIQQTVRNILQAVNLFQTPVDKSDAARVRKEYDESSDKLSKIQSRISSLTQKLKHEFGPEKEFYSFYGHCFESKQNKYVYKVCPYKKATQEEGHSTTRLGSWDKFEDSYHIMLFSNGDKCWNGPDRSMKVTL

cccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEcccccEEEcccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccEEEEEcccEEEEEccccccEEccccccccccccccccccEEEEEEcccccccccccccEEEEc

ccEEHHHHHHHHHHHHHHHHHHcHHHccccccccccccccccccHHHHHHcccccccEEEccccEEEcHHHcccccccccccccccccccccccEEEEEcccccccEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHcHHHccccccccccccHcccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccHcccccccccccccccHHHHccEEEEEcccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccEEEEcccEEEEEEEEcccEEEcccccccccccccccccccEEEEEccccccccccccEEEEEc

MRVVLVDFRFTYAIVLSLLWVSSsvigrsnaassllndpfygispqdenyyktssntikckdgskKFAKtqlnddycdcpdgtdepgtsacpngkfycqnaghsplmifsskvndgicdccdgsdeydgkvkcpntcweAGKVARDKLKKKIATYQEGVLLRKKEIEQAKQNLVKDEAELSNLKNEEKILKGLVQQLKERKEQIEKAEEKERLQREKEEKERKEAEENERKEKSESGEKAMQEKNKAeenaysddkpddvrhddkvgvleeesfdqgkaenvdeepateakqigtsqnlgtpvngveQHATEEMEqsassrskdgsstvpetssdaesqmppeaekkeeknlengvsenteeLSREELGRLVASrwtgektekqsgeggaianddqgedvpeynhddeedryatdtdddserydtekyddndveddidepyreedhdytstsyktdvdddldmsemttpsspsWLEKIQQTVRNILQAVNlfqtpvdksdaarVRKEYDESSDKLSKIQSRISSLTQKLkhefgpekefysfyghcfeskqnkyvykvcpykkatqeeghsttrlgswdkfedSYHIMLFsngdkcwngpdrsmkvtl

MRVVLVDFRFTYAIVLSLLWVSSSVIGRSNAASSLLNDPFYGISPQDENYYKTssntikckdgskKFAKTQLNDDYCDCPDGTDEPGTSACPNGKFYCQNAGHSPLMIFSSKVNDGICDCCDGSDEYDGKVKCPNTCWEAGKVARDKLKKKIATyqegvllrkKEIEQAKQNLVkdeaelsnlkneeKILKGLVQQLKERKEQIEkaeekerlqrekeekerkeaeenerkeksesgekaMQEKNKaeenaysddkpddvRHDDKVGVLEeesfdqgkaenvdeEPATEakqigtsqnlgtpVNGVEQHATEEMeqsassrskdgsstvpetssdaesqmppeaekkeeknlengvsenteelsreeLGRLvasrwtgektekqsgeggaianddqgedvpeynhddeedryatdtdddserydtekyddndveddidepyreedhdytstsyktdvdddldMSEMTTPSSPSWLEKIQQTVRNILQAVnlfqtpvdksdaarvrkeydessdklskiQSRISSLTQKLKHEFGPEKEFYSFYGHCFESKQNKYVYKVCPYKkatqeeghsttrlgswDKFEDSYHIMLFsngdkcwngpdrsmkvtl

MRVVLVDFRFTYAIvlsllwvsssvIGRSNAASSLLNDPFYGISPQDENYYKTSSNTIKCKDGSKKFAKTQLNDDYCDCPDGTDEPGTSACPNGKFYCQNAGHSPLMIFSSKVNDGICDCCDGSDEYDGKVKCPNTCWEAGKVARDKLKKKIATYQEGVLLRKKEIEQAKQNLVKDEAELSNLKNEEKILKGLVQQLKERKEQIekaeekerlqrekeekerkeaeenerkeksesgekAMQEKNKAEENAYSddkpddvrhddkvGVLEEESFDQGKAENVDEEPATEAKQIGTSQNLGTPVNGVEQHATEEMEQSASSRSKDGSSTVPETSSDAESQMPPEAekkeekNLENGVSENTEELSREELGRLVASRWTGEKTEKQSGEGGAIANDDQGEDVPEYNHDDEEDRYATDTDDDSERYdtekyddndveddidePYREEDHDYTSTSYKTDVDDDLDMSEMTTPSSPSWLEKIQQTVRNILQAVNLFQTPVDKSDAARVRKEYDESSDKLSKIQSRISSLTQKLKHEFGPEKEFYSFYGHCFESKQNKYVYKVCPYKKATQEEGHSTTRLGSWDKFEDSYHIMLFSNGDKCWNGPDRSMKVTL

**VVLVDFRFTYAIVLSLLWVSSSVIGRSNAASSLLNDPFYGISP***NYY*******************QLNDDYCDC**********ACPNGKFYCQNAGHSPLMIFSSKVNDGICDCCDGSDEYDGKVKCPNTCWEAGKVARDKLKKKIATYQEGVLLRK**********************************************************************************************************************************************************************************************************************************************************************************************************************WLEKIQQTVRNILQAVNLFQT***************************************GPEKEFYSFYGHCFESKQNKYVYKVCPYKKATQ****STTRLGSWDKFEDSYHIMLFSNGDKCWN**********

******D*RFTYAIVLSLLWVSSSVIGRSNAASSLLNDPFYGISPQDENYYKTSSNTIKCKDGSKKFAKTQLNDDYCDCPDGTDEPGTSACPNGKFYCQNAGHSPLMIFSSKVNDGICDCCDGSDEYDGKVKCPNTCWEAGK****************************************************************************************************************************************AENVDEEPATEAKQIGTSQNLGTPVNGVEQHATEE*************************************************************************************************************************************************DDLDMSEMTTPSSPSWLEKIQQTVRNILQA********************************************FGPEKEFYSFYGHCFESKQNKYVYKVCPYKKATQE****TTRLGSWDKFEDSYHIMLFSNGDKCWNGPDRSMKVTL

MRVVLVDFRFTYAIVLSLLWVSSSVIGRSNAASSLLNDPFYGISPQDENYYKTSSNTIKCKDGSKKFAKTQLNDDYCDCPDGTDEPGTSACPNGKFYCQNAGHSPLMIFSSKVNDGICDCCDGSDEYDGKVKCPNTCWEAGKVARDKLKKKIATYQEGVLLRKKEIEQAKQNLVKDEAELSNLKNEEKILKGLVQQLKERKEQI*******************************************************VRHDDKVGVLEEE*******************QIGTSQNLGTPVNGVE**********************************************************EELGRLVASRW************GAIANDDQGEDVPEYNHDDEEDRYATDTDDDSERYDTEKYDDNDVEDDIDEPYREEDHDYTSTSYKTDVDDDLDMSEMTTPSSPSWLEKIQQTVRNILQAVNLFQTPVDK*********************SRISSLTQKLKHEFGPEKEFYSFYGHCFESKQNKYVYKVCPYKKA*********RLGSWDKFEDSYHIMLFSNGDKCWNGPDRSMKVTL

*RVVLVDFRFTYAIVLSLLWVSSSVIGRSNAA*S**NDPFYGISPQDENYYKTSSNTIKCKDGSKKFAKTQLNDDYCDCPDGTDEPGTSACPNGKFYCQNAGHSPLMIFSSKVNDGICDCCDGSDEYDGKVKCPNTCWEAGKVARDKLKKKIATYQEGVLLRKKEIEQAKQNLVKDEAELSNLKNEEKILKGLVQQLKERKEQIEKAEEKERLQREKEEKE*KE*********************************************************************************************************************************************EELGRLVASRWTG********************************************************************************************SPSWLEKIQQTVRNILQAVNLFQTPVDKSDAARVRKEYDESSDKLSKIQSRISSLTQKLKHEFGPEKEFYSFYGHCFESKQNKYVYKVCPYKKATQEEGHSTTRLGSWDKFEDSYHIMLFSNGDKCWNGPDRSMKVTL

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRVVLVDFRFTYAIVLSLLWVSSSVIGRSNAASSLLNDPFYGISPQDENYYKTSSNTIKCKDGSKKFAKTQLNDDYCDCPDGTDEPGTSACPNGKFYCQNAGHSPLMIFSSKVNDGICDCCDGSDEYDGKVKCPNTCWEAGKVARDKLKKKIATYQEGVLLRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAYSDDKPDDVRHDDKVGVLEEESFDQGKAENVDEEPATEAKQIGTSQNLGTPVNGVEQHATEEMEQSASSRSKDGSSTVPETSSDAESQMPPEAEKKEEKNLENGVSENTEELSREELGRLVASRWTGEKTEKQSGEGGAIANDDQGEDVPEYNHDDEEDRYATDTDDDSERYDTEKYDDNDVEDDIDEPYREEDHDYTSTSYKTDVDDDLDMSEMTTPSSPSWLEKIQQTVRNILQAVNLFQTPVDKSDxxxxxxxxxxxxxxxxxxxxxxxxxxxxLKHEFGPEKEFYSFYGHCFESKQNKYVYKVCPYKKATQEEGHSTTRLGSWDKFEDSYHIMLFSNGDKCWNGPDRSMKVTL

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		608	2.2.26 [Sep-21-2011]
O08795		521	Glucosidase 2 subunit bet	yes	no	0.327	0.381	0.405	1e-37
P14314		528	Glucosidase 2 subunit bet	yes	no	0.312	0.359	0.418	1e-36
Q28034		533	Glucosidase 2 subunit bet	yes	no	0.256	0.292	0.439	6e-32
Q9USH8		506	Glucosidase 2 subunit bet	yes	no	0.253	0.304	0.397	4e-25
Q04924		702	Glucosidase 2 subunit bet	yes	no	0.205	0.178	0.337	5e-14

>sp\|O08795\|GLU2B_MOUSE Glucosidase 2 subunit beta OS=Mus musculus GN=Prkcsh PE=1 SV=1	Back alignment and function desciption

 Score =  158 bits (399), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 125/202 (61%), Gaps = 3/202 (1%)

Query: 42  GISPQDENYYKTSSNTIKCKDGSKKFAKTQLNDDYCDCPDGTDEPGTSACPNGKFYCQNA 101
           G+S  + ++Y+  S    C DG+      Q+NDDYCDC DG+DEPGT+ACPNG F+C N 
Sbjct: 22  GVSLSNHHFYE-ESKPFTCLDGTATIPFDQVNDDYCDCKDGSDEPGTAACPNGSFHCTNT 80

Query: 102 GHSPLMIFSSKVNDGICDCCDGSDEYDGKVKCPNTCWEAGKVARDKLKKKIATYQEGVLL 161
           G+ PL I SS+VNDG+CDCCDG+DEY+    C NTC E G+  ++ L++     +EG  L
Sbjct: 81  GYKPLYILSSRVNDGVCDCCDGTDEYNSGTVCENTCREKGRKEKESLQQLAEVTREGFRL 140

Query: 162 RKKEIEQAKQNLVKDEAELSNLKNEEKILKGLVQQLKERKEQIEKAEEKERLQREKEEKE 221
           +K  IE+ K    + +++L  L+  +K L+  V+ L+  KE+ E+ E++ + Q  K  +E
Sbjct: 141 KKILIEEWKTAREEKQSKLLELQAGKKSLEDQVETLRAAKEEAERPEKEAKDQHRKLWEE 200

Query: 222 RKEAEENERKEKSESGEKAMQE 243
           ++ A +  R++  E    A QE
Sbjct: 201 QQAAAKARREQ--ERAASAFQE 220

Regulatory subunit of glucosidase II.
Mus musculus (taxid: 10090)

>sp\|P14314\|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens GN=PRKCSH PE=1 SV=2	Back alignment and function description

>sp\|Q28034\|GLU2B_BOVIN Glucosidase 2 subunit beta OS=Bos taurus GN=PRKCSH PE=2 SV=1	Back alignment and function description

>sp\|Q9USH8\|GLU2B_SCHPO Glucosidase 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtb1 PE=1 SV=1	Back alignment and function description

>sp\|Q04924\|GLU2B_YEAST Glucosidase 2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTB1 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		608
359478816		638	PREDICTED: glucosidase 2 subunit beta-li	0.955	0.910	0.621	0.0
255564808		683	glucosidase II beta subunit, putative [R	0.965	0.859	0.613	0.0
224075960		645	predicted protein [Populus trichocarpa]	0.924	0.871	0.623	0.0
224056927		635	predicted protein [Populus trichocarpa]	0.940	0.900	0.609	1e-179
356521616		634	PREDICTED: glucosidase 2 subunit beta-li	0.911	0.873	0.596	1e-173
357475089		639	Glucosidase ii beta subunit [Medicago tr	0.935	0.890	0.563	1e-167
356577145		650	PREDICTED: LOW QUALITY PROTEIN: glucosid	0.924	0.864	0.571	1e-165
449519036		641	PREDICTED: LOW QUALITY PROTEIN: glucosid	0.914	0.867	0.539	1e-163
297796507		653	calmodulin-binding protein [Arabidopsis	0.958	0.892	0.581	1e-162
30696733		647	protein kinase C substrate 80K-H [Arabid	0.906	0.851	0.592	1e-160

>gi\|359478816\|ref\|XP_002283762.2\| PREDICTED: glucosidase 2 subunit beta-like [Vitis vinifera] gi\|297746510\|emb\|CBI16566.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/610 (62%), Positives = 477/610 (78%), Gaps = 29/610 (4%)

Query: 1   MRVVLVDFRFTYAIVLSLLWVSSSVIGRSNAASSLLNDPFYGISPQDENYYKTSSNTIKC 60
           M++ +V       ++L +L++S   IGRS + S L  +PF GI+PQDENYYKTSS   KC
Sbjct: 1   MKIYIVIHNL--FLILGVLFISQ--IGRSASKSLLSTNPFLGIAPQDENYYKTSSEIFKC 56

Query: 61  KDGSKKFAKTQLNDDYCDCPDGTDEPGTSACPNGKFYCQNAGHSPLMIFSSKVNDGICDC 120
           KDGSKK  + Q+NDD+CDCPD +DEPGTSACP GKFYC+NAGH PL++FSS+VNDGICDC
Sbjct: 57  KDGSKKLNRAQVNDDFCDCPDASDEPGTSACPGGKFYCRNAGHVPLLLFSSRVNDGICDC 116

Query: 121 CDGSDEYDGKVKCPNTCWEAGKVARDKLKKKIATYQEGVLLRKKEIEQAKQNLVKDEAEL 180
           CDGSDEYDGKVKCPNTCWEAGKVARDKLKKKI TY+EGV LRK++IEQAK  + K+E EL
Sbjct: 117 CDGSDEYDGKVKCPNTCWEAGKVARDKLKKKIVTYKEGVTLRKQQIEQAKLAIAKEEEEL 176

Query: 181 SNLKNEEKILKGLVQQLKERKEQIEKAEEKERLQREKEEKERKEAEENERKEKSESGEKA 240
           S LK+EEKILKGLVQQLK+RKEQIEKAEEKERLQ+E+EEK+R+EAEE   KEKS++ ++A
Sbjct: 177 SKLKSEEKILKGLVQQLKDRKEQIEKAEEKERLQKEEEEKKRREAEEEANKEKSKAEKEA 236

Query: 241 MQEKNKAEENAYSDDKPDDVRHDDKVGVLEEESFDQGKAENVDEEPATEAKQIGTSQNLG 300
            QEKN+ +E   S+++P +  HDDK+GVL+++  ++ K+ +V      E +    S+N  
Sbjct: 237 NQEKNEVKEQVGSEEEPMESTHDDKIGVLDQD-VEEDKSNSV-----AEVEHTDKSEN-A 289

Query: 301 TPVNGVEQHATEEMEQSASSRSKDGSSTVPETSSDAESQMPPEAEKKEEKNLENGVSENT 360
           +P +G+EQHA E          K+ S  V ET   A +++ P +++  ++  EN V+ENT
Sbjct: 290 SPTDGIEQHAAE---------GKEESPVVHETDLHAGNEVSPTSDQATKQ--ENDVAENT 338

Query: 361 EELSREELGRLVASRWTGEKTEKQSGEGGAIAND--DQGEDVPEYNHDDEEDRYATDTDD 418
           E LSREELGRLVASRWTGE T + + E  A+ +D  +  E+ PE  H +E D YA++TDD
Sbjct: 339 EGLSREELGRLVASRWTGENTGQHTEEVDAVKHDHHESHEETPEDTHAEEYDGYASETDD 398

Query: 419 DSERYDTEKYDDNDVEDDIDEPYREEDHDYTSTSYKTDVDDDLDMSEMTTPSSPSWLEKI 478
           DS+R     YD++D+ED +DE + E+DH  +S  YK+D +D+ D S++T+ S+PSWLEKI
Sbjct: 399 DSQR-----YDNDDMEDPVDEDFGEDDHYDSSPPYKSDTEDESDFSDITSTSNPSWLEKI 453

Query: 479 QQTVRNILQAVNLFQTPVDKSDAARVRKEYDESSDKLSKIQSRISSLTQKLKHEFGPEKE 538
           QQTVRNIL AVNLFQTPVDKS+AA +RKEYDESS KLSK+QSRISSLTQKLKH+FGPEKE
Sbjct: 454 QQTVRNILNAVNLFQTPVDKSEAAHIRKEYDESSAKLSKMQSRISSLTQKLKHDFGPEKE 513

Query: 539 FYSFYGHCFESKQNKYVYKVCPYKKATQEEGHSTTRLGSWDKFEDSYHIMLFSNGDKCWN 598
           FYSFY  CFESK+NKYVYK+CP+K+A+QEEGHSTTRLG WDKFEDSY  MLFSNG+KCWN
Sbjct: 514 FYSFYDQCFESKENKYVYKLCPFKQASQEEGHSTTRLGRWDKFEDSYRTMLFSNGEKCWN 573

Query: 599 GPDRSMKVTL 608
           GPDRS+KV L
Sbjct: 574 GPDRSLKVKL 583

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255564808\|ref\|XP_002523398.1\| glucosidase II beta subunit, putative [Ricinus communis] gi\|223537348\|gb\|EEF38977.1\| glucosidase II beta subunit, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224075960\|ref\|XP_002304848.1\| predicted protein [Populus trichocarpa] gi\|222842280\|gb\|EEE79827.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224056927\|ref\|XP_002299093.1\| predicted protein [Populus trichocarpa] gi\|222846351\|gb\|EEE83898.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356521616\|ref\|XP_003529450.1\| PREDICTED: glucosidase 2 subunit beta-like [Glycine max]	Back alignment and taxonomy information

>gi\|357475089\|ref\|XP_003607830.1\| Glucosidase ii beta subunit [Medicago truncatula] gi\|355508885\|gb\|AES90027.1\| Glucosidase ii beta subunit [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356577145\|ref\|XP_003556688.1\| PREDICTED: LOW QUALITY PROTEIN: glucosidase 2 subunit beta-like [Glycine max]	Back alignment and taxonomy information

>gi\|449519036\|ref\|XP_004166541.1\| PREDICTED: LOW QUALITY PROTEIN: glucosidase 2 subunit beta-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297796507\|ref\|XP_002866138.1\| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata] gi\|297311973\|gb\|EFH42397.1\| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|30696733\|ref\|NP_568840.3\| protein kinase C substrate 80K-H [Arabidopsis thaliana] gi\|10177834\|dbj\|BAB11263.1\| unnamed protein product [Arabidopsis thaliana] gi\|332009370\|gb\|AED96753.1\| protein kinase C substrate 80K-H [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		608
TAIR\|locus:2161078		647	PSL4 "PRIORITY IN SWEET LIFE 4	0.513	0.482	0.540	9.8e-159
UNIPROTKB\|K7ELL7		535	PRKCSH "Glucosidase 2 subunit	0.264	0.300	0.450	1.4e-60
DICTYBASE\|DDB_G0271120		524	DDB_G0271120 "protein kinase C	0.256	0.297	0.466	9.9e-60
UNIPROTKB\|E2RKK6		537	PRKCSH "Uncharacterized protei	0.264	0.299	0.444	9.3e-58
RGD\|1309628		525	Prkcsh "protein kinase C subst	0.264	0.306	0.438	1.6e-57
ZFIN\|ZDB-GENE-040426-770		529	prkcsh "protein kinase C subst	0.263	0.302	0.447	2.6e-57
MGI\|MGI:107877		521	Prkcsh "protein kinase C subst	0.264	0.309	0.438	2.6e-57
UNIPROTKB\|P14314		528	PRKCSH "Glucosidase 2 subunit	0.264	0.304	0.450	1.1e-56
UNIPROTKB\|F1S596		537	PRKCSH "Uncharacterized protei	0.264	0.299	0.438	2.4e-55
UNIPROTKB\|Q28034		533	PRKCSH "Glucosidase 2 subunit	0.264	0.302	0.438	2.2e-53

TAIR\|locus:2161078 PSL4 "PRIORITY IN SWEET LIFE 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 836 (299.3 bits), Expect = 9.8e-159, Sum P(2) = 9.8e-159
 Identities = 179/331 (54%), Positives = 222/331 (67%)

Query:   283 DEEPATEAKQIGTSQNLGTPVNGVEQHATEEMEQSASSRSKDGSSTVPETSSDAESQMPP 342
             DEEPA E +         T  N  ++H  E  E+S SS  +D SS   E+ +D  ++   
Sbjct:   275 DEEPAAEGEPTSILDE-ATHTNPADEHVVERKEESTSS--EDSSSPTDESQNDGSAE--- 328

Query:   343 EAXXXXXXNLENGVSENTEELSREELGRLVASRWTGEKTEKQSGEGGAIANDDQG--EDV 400
             +        +E+ V+E  EELS+EELGRLVASRWTGEK++K +        DDQ   E  
Sbjct:   329 KEESDEVKKVEDFVTEKKEELSKEELGRLVASRWTGEKSDKPTEADDIPKADDQENHEHT 388

Query:   401 PEYNHD-DEEDRYATDTDDDSERYXXXXXXXXXXXXXXXXPYREE-DHDYTSTSYKTDVD 458
             P   H+ DE+D + +D D+D+                    Y EE  HD +S+SYK+D D
Sbjct:   389 PITAHEADEDDGFVSDGDEDTS-----DDGKYSDHEPEDDSYEEEYRHD-SSSSYKSDAD 442

Query:   459 DDLDMSEMTTPSSPSWLEKIQQTVRNILQAVNLFQT-PVDKSDAARVRKEYDESSDKLSK 517
             DD+D SE T  S+P+WLEKIQ+TV+NIL AVNLFQT PVDKS+A RVRKEYDESS KL+K
Sbjct:   443 DDVDFSETT--SNPTWLEKIQKTVKNILLAVNLFQTTPVDKSEADRVRKEYDESSSKLNK 500

Query:   518 IQSRISSLTQKLKHEFGPEKEFYSFYGHCFESKQNKYVYKVCPYKKATQEEGHSTTRLGS 577
             IQSRISSL +KLK +FGPEKEFYSF+G CFESKQ KY YKVC YK+ATQEEG+S TRLG 
Sbjct:   501 IQSRISSLEKKLKQDFGPEKEFYSFHGRCFESKQGKYTYKVCAYKEATQEEGYSKTRLGE 560

Query:   578 WDKFEDSYHIMLFSNGDKCWNGPDRSMKVTL 608
             WDKFE+SY  M ++NG+KCWNGPDRS+KV L
Sbjct:   561 WDKFENSYQFMSYTNGEKCWNGPDRSLKVKL 591

GO:0009507 "chloroplast" evidence=ISM

GO:0005516 "calmodulin binding" evidence=TAS;IPI

GO:0042742 "defense response to bacterium" evidence=IMP

GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA

GO:0009086 "methionine biosynthetic process" evidence=RCA

GO:0030244 "cellulose biosynthetic process" evidence=RCA

GO:0048193 "Golgi vesicle transport" evidence=RCA

GO:0005783 "endoplasmic reticulum" evidence=IDA

UNIPROTKB\|K7ELL7 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0271120 DDB_G0271120 "protein kinase C substrate 80K-H homolog" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RKK6 PRKCSH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

RGD\|1309628 Prkcsh "protein kinase C substrate 80K-H" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-770 prkcsh "protein kinase C substrate 80K-H" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:107877 Prkcsh "protein kinase C substrate 80K-H" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|P14314 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S596 PRKCSH "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q28034 PRKCSH "Glucosidase 2 subunit beta" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		608
pfam12999		176	pfam12999, PRKCSH-like, Glucosidase II beta subuni	4e-35
pfam13015		154	pfam13015, PRKCSH_1, Glucosidase II beta subunit-l	2e-12
pfam07915		73	pfam07915, PRKCSH, Glucosidase II beta subunit-lik	2e-07
TIGR00927		1096	TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger	4e-07
PTZ00108		1388	PTZ00108, PTZ00108, DNA topoisomerase 2-like prote	8e-07
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-06
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	3e-06
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-05
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-05
pfam10211		189	pfam10211, Ax_dynein_light, Axonemal dynein light	2e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	2e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	3e-05
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	3e-05
TIGR03346		852	TIGR03346, chaperone_ClpB, ATP-dependent chaperone	4e-05
COG5271		4600	COG5271, MDN1, AAA ATPase containing von Willebran	4e-05
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	6e-05
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	6e-05
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	8e-05
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	1e-04
PTZ00341		1136	PTZ00341, PTZ00341, Ring-infected erythrocyte surf	1e-04
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	1e-04
pfam09756		189	pfam09756, DDRGK, DDRGK domain	1e-04
TIGR02794		346	TIGR02794, tolA_full, TolA protein	2e-04
COG3064		387	COG3064, TolA, Membrane protein involved in colici	2e-04
PRK05035		695	PRK05035, PRK05035, electron transport complex pro	2e-04
COG5271		4600	COG5271, MDN1, AAA ATPase containing von Willebran	3e-04
COG4942		420	COG4942, COG4942, Membrane-bound metallopeptidase	3e-04
PTZ00341		1136	PTZ00341, PTZ00341, Ring-infected erythrocyte surf	6e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.001
PRK05901		509	PRK05901, PRK05901, RNA polymerase sigma factor; P	0.001
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	0.002
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	0.002
PRK12704		520	PRK12704, PRK12704, phosphodiesterase; Provisional	0.002
pfam03344		715	pfam03344, Daxx, Daxx Family	0.002
PRK00106		535	PRK00106, PRK00106, hypothetical protein; Provisio	0.002
COG1579		239	COG1579, COG1579, Zn-ribbon protein, possibly nucl	0.003
PRK09510		387	PRK09510, tolA, cell envelope integrity inner memb	0.003
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	0.004
TIGR02794		346	TIGR02794, tolA_full, TolA protein	0.004
COG4026		290	COG4026, COG4026, Uncharacterized protein containi	0.004
pfam13256		123	pfam13256, DUF4047, Domain of unknown function (DU	0.004

>gnl\|CDD\|193472 pfam12999, PRKCSH-like, Glucosidase II beta subunit-like	Back alignment and domain information

 Score =  130 bits (328), Expect = 4e-35
 Identities = 69/169 (40%), Positives = 93/169 (55%), Gaps = 14/169 (8%)

Query: 38  DPFYGISPQDENYYKTSSN-TIKCKDGSK-KFAKTQLNDDYCDCPDGTDEPGTSACPNGK 95
               G+SP + + Y+   N   KC + S+ K +  Q+NDDYCDCPDG+DEPGT+AC NGK
Sbjct: 17  GKLRGVSPDNLHLYQPDENGNWKCLNHSEIKLSFDQVNDDYCDCPDGSDEPGTNACSNGK 76

Query: 96  FYCQNAGHSPLMIFSSKVNDGICD---CCDGSDEYDGKVKCPNTCWEAGKVARDKLKKKI 152
           FYC N G  P  I S KV+DG+CD   CCDGSDE  G  KCPN C E  +   + L +  
Sbjct: 77  FYCANEGFIPGYIPSFKVDDGVCDYDICCDGSDEALG--KCPNKCGEIARQFEEYLTEHN 134

Query: 153 ATYQEGVLLRKKEIEQAKQNLVKDEAELSNLKNEEKILKGLVQQLKERK 201
            + + G L  K+ +  A Q    +      LK   K L+  +   ++R 
Sbjct: 135 NSVKNG-LKIKEGLLLAAQKKRDE------LKKRLKELEDSLPAKQQRL 176

The sequences found in this family are similar to a region found in the beta-subunit of glucosidase II, which is also known as protein kinase C substrate 80K-H (PRKCSH). The enzyme catalyzes the sequential removal of two alpha-1,3-linked glucose residues in the second step of N-linked oligosaccharide processing. The beta subunit is required for the solubility and stability of the heterodimeric enzyme, and is involved in retaining the enzyme within the endoplasmic reticulum. Length = 176

>gnl\|CDD\|205196 pfam13015, PRKCSH_1, Glucosidase II beta subunit-like protein	Back alignment and domain information

>gnl\|CDD\|219639 pfam07915, PRKCSH, Glucosidase II beta subunit-like protein	Back alignment and domain information

>gnl\|CDD\|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger	Back alignment and domain information

>gnl\|CDD\|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|204414 pfam10211, Ax_dynein_light, Axonemal dynein light chain	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB	Back alignment and domain information

>gnl\|CDD\|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|220383 pfam09756, DDRGK, DDRGK domain	Back alignment and domain information

>gnl\|CDD\|234017 TIGR02794, tolA_full, TolA protein	Back alignment and domain information

>gnl\|CDD\|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional	Back alignment and domain information

>gnl\|CDD\|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|237177 PRK12704, PRK12704, phosphodiesterase; Provisional	Back alignment and domain information

>gnl\|CDD\|217503 pfam03344, Daxx, Daxx Family	Back alignment and domain information

>gnl\|CDD\|178867 PRK00106, PRK00106, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|234017 TIGR02794, tolA_full, TolA protein	Back alignment and domain information

>gnl\|CDD\|226513 COG4026, COG4026, Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|205436 pfam13256, DUF4047, Domain of unknown function (DUF4047)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		608
KOG2397		480	consensus Protein kinase C substrate, 80 KD protei	100.0
PF12999		176	PRKCSH-like: Glucosidase II beta subunit-like	100.0
PF13015		154	PRKCSH_1: Glucosidase II beta subunit-like protein	99.95
PF12999		176	PRKCSH-like: Glucosidase II beta subunit-like	99.29
KOG2397		480	consensus Protein kinase C substrate, 80 KD protei	98.54
PF00057		37	Ldl_recept_a: Low-density lipoprotein receptor dom	98.45
cd00112		35	LDLa Low Density Lipoprotein Receptor Class A doma	98.41
cd00112		35	LDLa Low Density Lipoprotein Receptor Class A doma	98.3
smart00192		33	LDLa Low-density lipoprotein receptor domain class	98.3
PF00057		37	Ldl_recept_a: Low-density lipoprotein receptor dom	98.26
smart00192		33	LDLa Low-density lipoprotein receptor domain class	98.07
PF07915		81	PRKCSH: Glucosidase II beta subunit-like protein;	97.99
KOG1215		877	consensus Low-density lipoprotein receptors contai	96.8
KOG1215		877	consensus Low-density lipoprotein receptors contai	96.61
PF10211		189	Ax_dynein_light: Axonemal dynein light chain; Inte	91.49
PTZ00266		1021	NIMA-related protein kinase; Provisional	85.11
KOG3394		502	consensus Protein OS-9 [General function predictio	85.07
KOG3509		964	consensus Basement membrane-specific heparan sulfa	82.46

>KOG2397 consensus Protein kinase C substrate, 80 KD protein, heavy chain [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=4.4e-78  Score=642.82  Aligned_cols=411  Identities=35%  Similarity=0.557  Sum_probs=316.3

Q ss_pred             CCCCcccccccCCCCCceeeCCCCccccCCCccCCCCCCCCCCCCCCCCCCCCCceeccCCCCCCcccccCccccCCCCC
Q 007310           41 YGISPQDENYYKTSSNTIKCKDGSKKFAKTQLNDDYCDCPDGTDEPGTSACPNGKFYCQNAGHSPLMIFSSKVNDGICDC  120 (608)
Q Consensus        41 rGV~~~~~~~Y~~~~~~F~C~dgs~~Ip~s~vcDg~cDC~DGSDE~gt~aC~~~~F~C~n~g~~~~~Ip~s~VcDGicDC  120 (608)
                      -|++..+..||+ .+..|+|+||+..|+++++||+||||+||||||||+||||+.|||.|.||+|.+||+++||||||||
T Consensus        29 v~~~~~~~~~y~-as~~~~CLdgs~~i~f~qlNDd~CDC~DGsDEPGtsACpngkF~C~N~G~~p~~i~ssrV~DGICDC  107 (480)
T KOG2397|consen   29 VALSIENLYLYD-ASSMFKCLDGSKTISFSQLNDDSCDCLDGSDEPGTSACPNGKFYCVNQGHQPKYIPSSRVNDGICDC  107 (480)
T ss_pred             cccccccccccc-cccceeeccCCcccCHHHhccccccCCCCCCCCccccCCCCceeeeecCCCceeeechhccCccccc
Confidence            444555777887 5679999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHH
Q 007310          121 CDGSDEYDGKVKCPNTCWEAGKVARDKLKKKIATYQEGVLLRKKEIEQAKQNLVKDEAELSNLKNEEKILKGLVQQLKER  200 (608)
Q Consensus       121 cDGSDE~~~~~~C~n~C~e~g~~~r~~~~~~~e~~~~G~~~R~elie~gk~~r~e~~~~l~~Lk~e~~~le~~ve~le~~  200 (608)
                      ||||||+.++|.|||+|.++|+++|..+++.+.+|+.|+++|++++.+++..+.+.+..+..|+.+++.|+..+.+|+..
T Consensus       108 CDgSDE~~Sgv~c~ntC~e~gR~~r~~~~~~~~~yk~G~e~R~~~i~e~k~~~~~~e~~l~~l~~e~~~l~~~~~~l~~~  187 (480)
T KOG2397|consen  108 CDGSDEYLSGVDCPNTCIELGRAARIMLEKDAEIYKPGKEIREELLDESKTAREAFEAPLDKLSDELKVLEGDGEQLRST  187 (480)
T ss_pred             ccCCCCccCCCCCcchHHHHHHHHHHHHHHHHHHhcccHHHHHHHHhcccccchhhhcchhhhhhHHhhccchHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHhhhhhhhhhccCCCCCCCcccccccccccccccccccccc
Q 007310          201 KEQIEKAEEKERLQREKEEKERKEAEENERKEKSESGEKAMQEKNKAEENAYSDDKPDDVRHDDKVGVLEEESFDQGKAE  280 (608)
Q Consensus       201 k~~~e~~e~~Ere~kek~~k~~~e~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~v~~~~~~~~~~ld~D~dg~~~~~  280 (608)
                      +++++..++.++.+++.+++....+...+.    +...|..+|...++        .++..++...+.+|.++||.++  
T Consensus       188 ~e~~E~~~~~e~~~~~~~~~~~~~~~~~~~----~~~~~~e~d~~~~~--------~~~~tel~~~~~~d~~~~~~i~--  253 (480)
T KOG2397|consen  188 KEKGEFDERKEKDQIQGQEELLKAARSRAQ----ADLVFDELDDDTNL--------LVELTELYTCTLLDCDKDGKIL--  253 (480)
T ss_pred             HHHHHHHHHHhhccccchHHHHHHHHhhhc----chhcCccccCcccc--------cccccccccCcccccccccccc--
Confidence            998888766666666666554433321111    45566666555544        8888888888888888888777  


Q ss_pred             cCCCCchhhhhhcccccCCCCCCCCcccchhhHhhhhhcccCCCCCCCCCCCCcccccCCCchhhhhhhhhhccCccccc
Q 007310          281 NVDEEPATEAKQIGTSQNLGTPVNGVEQHATEEMEQSASSRSKDGSSTVPETSSDAESQMPPEAEKKEEKNLENGVSENT  360 (608)
Q Consensus       281 ~~~~~~~~~~e~ea~~~~~~~~~~~~~~~~~~~f~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  360 (608)
                                ..|+     +                                                         .++
T Consensus       254 ----------~~E~-----k---------------------------------------------------------~~~  261 (480)
T KOG2397|consen  254 ----------SFEI-----K---------------------------------------------------------RLK  261 (480)
T ss_pred             ----------HHHH-----H---------------------------------------------------------Hhh
Confidence                      3333     2                                                         234


Q ss_pred             chhhHHHhhhhhhhccccCcccccCCCCCCccCCCCCCCCCCCCCCcccccccCCCCCCccccccccCCCCCCCCCCCCC
Q 007310          361 EELSREELGRLVASRWTGEKTEKQSGEGGAIANDDQGEDVPEYNHDDEEDRYATDTDDDSERYDTEKYDDNDVEDDIDEP  440 (608)
Q Consensus       361 ~~~~~~dl~~f~~~~w~~~k~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~e~~~~~~~~d~~~~d~~~~~~~~d~~  440 (608)
                      +.+.++++..|....|.+++..+++.....      +++.+     ++.....         ...+..+++ ..+++   
T Consensus       262 ~~~~~~~~~~~~~~~~s~l~~l~~t~~~~~------~~~~~-----~~~~~~~---------~~~~~~~~~-~~~~~---  317 (480)
T KOG2397|consen  262 GELTQHDADSFRDTETSNLEHLYHTTPRPE------SPEQR-----EEEPTLR---------GVLNSPSEE-PRHDE---  317 (480)
T ss_pred             ccccccCccccccchhhhhHhhhccCCCcc------Ccccc-----ccccccc---------ccccCCccc-cchhh---
Confidence            455566666666667777766655432210      00000     0000000         001111110 01111   


Q ss_pred             ccccCCCccCCCCCCCCCCcccccccCCCCCCChhHHHHHHHHHHHHhhcccCCCcChHHHHHHHHHHHHHHHHHHHHHH
Q 007310          441 YREEDHDYTSTSYKTDVDDDLDMSEMTTPSSPSWLEKIQQTVRNILQAVNLFQTPVDKSDAARVRKEYDESSDKLSKIQS  520 (608)
Q Consensus       441 ~eed~~~~~~~~~~~~~~~e~~~~~~~~~~~p~yde~~q~~~~~ll~~~n~f~~~~d~~~a~~aR~~~~eae~~l~~le~  520 (608)
                      ++..+++.         ++.++.      ..|+++                        +|++||++|+++++.|++|++
T Consensus       318 ~~~~~d~~---------~~~~~~------~s~p~~------------------------~a~~ar~~~de~~~~~k~l~~  358 (480)
T KOG2397|consen  318 EDINSDDE---------GDSGDT------DSPPSL------------------------QASEARNELDEAERKLKDLDE  358 (480)
T ss_pred             hcccCCcc---------cccCCC------CCchHH------------------------HHHHHHHHHHHHHHHHHHHHH
Confidence            11111110         011110      123322                        378999999999999999999


Q ss_pred             HHHHHHhhhccccCCchhhhhccccceeeecCceeEeeccCCcccccCCCCcccccccccccCcceeeeecCCCcCCCCC
Q 007310          521 RISSLTQKLKHEFGPEKEFYSFYGHCFESKQNKYVYKVCPYKKATQEEGHSTTRLGSWDKFEDSYHIMLFSNGDKCWNGP  600 (608)
Q Consensus       521 ~I~~le~~L~~dfG~~~ef~~L~~qCfe~~~~eY~Y~lCpF~~~tQk~gg~~t~LG~w~~w~~~ys~m~Y~~G~~CWNGP  600 (608)
                      +|++++++++.+|| ..+|++|+|+||+.++++|||+||||+.|||++    +..|+|.+...  ++|+|+||++|||||
T Consensus       359 ~i~~l~~~~~~~~g-~~e~~~~~~~c~~~~~~~Y~Y~~c~~~~~tq~~----~~~~~w~~~e~--~~m~y~nG~~CWnGP  431 (480)
T KOG2397|consen  359 EIRELEDELNGDFG-LLEFAALKGQCFDRELGEYTYTVCPFKPVTQKS----IYGGSWSGPEG--SVMKYENGQQCWNGP  431 (480)
T ss_pred             HHHHHHHHhhcccc-HHHHHHHhcceeeeccCcEEEEEcccccccccc----cccccccCCcc--ceeeecCccccccCC
Confidence            99999999999999 999999999999999999999999999999994    44555777555  999999999999999


Q ss_pred             CcceEEEC
Q 007310          601 DRSMKVTL  608 (608)
Q Consensus       601 ~RS~~V~L  608 (608)
                      +|||+|+|
T Consensus       432 ~RSa~v~v  439 (480)
T KOG2397|consen  432 NRSATVTV  439 (480)
T ss_pred             CcceeEEE
Confidence            99999986

>PF12999 PRKCSH-like: Glucosidase II beta subunit-like	Back alignment and domain information

>PF13015 PRKCSH_1: Glucosidase II beta subunit-like protein	Back alignment and domain information

>PF12999 PRKCSH-like: Glucosidase II beta subunit-like	Back alignment and domain information

>KOG2397 consensus Protein kinase C substrate, 80 KD protein, heavy chain [Signal transduction mechanisms]	Back alignment and domain information

>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells	Back alignment and domain information

>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure

Back alignment and domain information

>smart00192 LDLa Low-density lipoprotein receptor domain class A	Back alignment and domain information

>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells	Back alignment and domain information

>smart00192 LDLa Low-density lipoprotein receptor domain class A	Back alignment and domain information

>PF07915 PRKCSH: Glucosidase II beta subunit-like protein; InterPro: IPR012913 The sequences found in this family are similar to a region found in the beta-subunit of glucosidase II (P14314 from SWISSPROT), which is also known as protein kinase C substrate 80K-H (PRKCSH)	Back alignment and domain information

>KOG1215 consensus Low-density lipoprotein receptors containing Ca2+-binding EGF-like domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG1215 consensus Low-density lipoprotein receptors containing Ca2+-binding EGF-like domains [Signal transduction mechanisms]	Back alignment and domain information

>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility	Back alignment and domain information

>PTZ00266 NIMA-related protein kinase; Provisional	Back alignment and domain information

>KOG3394 consensus Protein OS-9 [General function prediction only]	Back alignment and domain information

>KOG3509 consensus Basement membrane-specific heparan sulfate proteoglycan (HSPG) core protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		608
3aih_A		124	Protein OS-9; beta barrel, lectin, sugar binding p	3e-10
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	2e-08
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	4e-08
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	8e-08
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	5e-07
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	3e-05
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	8e-05
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	5e-08
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	1e-07
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	4e-07
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	3e-06
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	9e-06
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	1e-05
3lvg_D		190	LCB, clathrin light chain B; SELF assembly, coated	1e-07
3lvg_D		190	LCB, clathrin light chain B; SELF assembly, coated	5e-04
2fyj_A		82	Low-density lipoprotein receptor-related protein 1	2e-07
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	3e-07
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	2e-04
2fcw_B		80	LDL receptor, low-density lipoprotein receptor; pr	3e-07
2xrc_A		565	Human complement factor I; immune system, hydrolas	1e-06
2xrc_A		565	Human complement factor I; immune system, hydrolas	6e-05
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	3e-06
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	8e-05
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-04
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-04
1g8x_A		1010	Myosin II heavy chain fused to alpha-actinin 3; mo	1e-05
2a6h_D		1524	DNA-directed RNA polymerase beta' chain; RNA polym	4e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-04
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	1e-04
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	8e-04
1j8e_A		44	Low-density lipoprotein receptor-related protein 1	9e-04
1jrf_A		47	TVA LDL-A module, subgroup A ROUS sarcoma virus re	9e-04

>3aih_A Protein OS-9; beta barrel, lectin, sugar binding protein; HET: BMA MAN; 2.10A {Homo sapiens} Length = 124	Back alignment and structure

 Score = 57.5 bits (138), Expect = 3e-10
 Identities = 18/87 (20%), Positives = 26/87 (29%), Gaps = 22/87 (25%)

Query: 544 GHCFESKQNKYVYKVCPYKKATQ------EEGHSTTRLGSWDKFEDS------------- 584
             C    ++ + Y+ C  +   Q      E       LG +    D              
Sbjct: 3   APCLLKTKDWWTYEFCYGRHIQQYHMEDSEIKGEVLYLGYYQSAFDWDDETAKASKQHRL 62

Query: 585 --YHIMLFSNGDKC-WNGPDRSMKVTL 608
             YH   + NG KC  NG  R  +V  
Sbjct: 63  KRYHSQTYGNGSKCDLNGRPREAEVRF 89

PyMOL of 3aih

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791	Back alignment and structure

>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190	Back alignment and structure

>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190	Back alignment and structure

>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80	Back alignment and structure

>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565	Back alignment and structure

>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010	Back alignment and structure

>2a6h_D DNA-directed RNA polymerase beta' chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: e.29.1.2 PDB: 1smy_D* 1zyr_D* 1iw7_D* 2a69_D* 2a6e_D 2a68_D* 2be5_D* 2cw0_D 2o5i_D 2o5j_D* 2ppb_D* 3aoh_D* 3aoi_D* 3dxj_D* 3eql_D* 1ynj_D* 1l9z_D 1l9u_D* 1ynn_D* 2auj_D Length = 1524	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854	Back alignment and structure

>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44	Back alignment and structure

>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		608
2fcw_B		80	LDL receptor, low-density lipoprotein receptor; pr	99.68
2fyj_A		82	Low-density lipoprotein receptor-related protein 1	99.68
3aih_A		124	Protein OS-9; beta barrel, lectin, sugar binding p	99.44
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	99.29
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	99.27
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	99.22
2xrc_A		565	Human complement factor I; immune system, hydrolas	99.13
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	99.11
2kny_A		80	LRP-1, linker, APO-E; lipoprotein receptor, ligand	98.93
1jrf_A		47	TVA LDL-A module, subgroup A ROUS sarcoma virus re	98.9
1cr8_A		42	Protein (LOW density lipoprotein receptor related	98.69
1j8e_A		44	Low-density lipoprotein receptor-related protein 1	98.64
2jm4_A		43	Relaxin receptor 1; LDL-A module, RXFP1 receptor,	98.62
3dpr_E		39	LDL-receptor class A 3; human rhinovirus, VLDL-rec	98.59
2rl8_A		154	Cation-dependent mannose-6-phosphate receptor; P-t	98.56
2kny_A		80	LRP-1, linker, APO-E; lipoprotein receptor, ligand	98.54
2knx_A		50	Prolow-density lipoprotein receptor-related prote;	98.53
1ajj_A		37	LR5, low-density lipoprotein receptor; LDL recepto	98.52
2gtl_O		215	Extracellular hemoglobin linker L3 subunit; anneli	98.51
2m0p_A		52	Low-density lipoprotein receptor-related protein;	98.48
1d2l_A		45	Lipoprotein receptor related protein; ligand bindi	98.48
3a7q_B		44	Low-density lipoprotein receptor-related protein;	98.47
2i1p_A		48	Low-density lipoprotein receptor-related protein 2	98.45
3dpr_E		39	LDL-receptor class A 3; human rhinovirus, VLDL-rec	98.44
1ajj_A		37	LR5, low-density lipoprotein receptor; LDL recepto	98.44
1cr8_A		42	Protein (LOW density lipoprotein receptor related	98.43
2i1p_A		48	Low-density lipoprotein receptor-related protein 2	98.39
1k7b_A		47	Subgroup A ROUS sarcoma virus receptor PG800 and P	98.38
2jm4_A		43	Relaxin receptor 1; LDL-A module, RXFP1 receptor,	98.38
1d2l_A		45	Lipoprotein receptor related protein; ligand bindi	98.38
2knx_A		50	Prolow-density lipoprotein receptor-related prote;	98.38
3a7q_B		44	Low-density lipoprotein receptor-related protein;	98.35
2m0p_A		52	Low-density lipoprotein receptor-related protein;	98.29
1k7b_A		47	Subgroup A ROUS sarcoma virus receptor PG800 and P	98.28
1jrf_A		47	TVA LDL-A module, subgroup A ROUS sarcoma virus re	98.26
2fyj_A		82	Low-density lipoprotein receptor-related protein 1	98.26
1j8e_A		44	Low-density lipoprotein receptor-related protein 1	98.18
2fcw_B		80	LDL receptor, low-density lipoprotein receptor; pr	98.1
2kva_A		148	Cation-independent mannose-6-phosphate receptor; t	98.06
2gtl_M		217	Hemoglobin linker chain L1; annelid erythrocruorin	97.92
2gtl_O		215	Extracellular hemoglobin linker L3 subunit; anneli	97.92
2gtl_M		217	Hemoglobin linker chain L1; annelid erythrocruorin	97.86
2gtl_N		220	Extracellular hemoglobin linker L2 subunit; anneli	97.71
2xrc_A		565	Human complement factor I; immune system, hydrolas	97.57
2gtl_N		220	Extracellular hemoglobin linker L2 subunit; anneli	97.56
1gp0_A		143	Cation-independent mannose-6-phosphate receptor; i	97.53
3ojy_B		537	Complement component C8 beta chain; macpf, lipocal	97.23
3ojy_A		554	Complement component C8 alpha chain; macpf, lipoca	97.15
3ojy_B		537	Complement component C8 beta chain; macpf, lipocal	96.88
3ojy_A		554	Complement component C8 alpha chain; macpf, lipoca	96.7
3t5o_A		913	Complement component C6; macpf, MAC, membrane atta	93.92
3t5o_A		913	Complement component C6; macpf, MAC, membrane atta	93.87
2lla_A		140	Mannose-6-phosphate/insulin-like growth factor II;	84.75

>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B	Back alignment and structure

Probab=99.68  E-value=8.6e-18  Score=142.56  Aligned_cols=70  Identities=34%  Similarity=0.594  Sum_probs=63.8

Q ss_pred             CCCceeeCCCCccccCCCccCCCCCCCCCCCCCCCC--CCCCCceeccCCCCCCcccccCccccCCCCCCCCCCCCC
Q 007310           54 SSNTIKCKDGSKKFAKTQLNDDYCDCPDGTDEPGTS--ACPNGKFYCQNAGHSPLMIFSSKVNDGICDCCDGSDEYD  128 (608)
Q Consensus        54 ~~~~F~C~dgs~~Ip~s~vcDg~cDC~DGSDE~gt~--aC~~~~F~C~n~g~~~~~Ip~s~VcDGicDCcDGSDE~~  128 (608)
                      ..+.|+|.+| .|||.++||||+.||+|||||.++.  .|+.+.|+|.|+    .|||.+|||||+.||.|||||..
T Consensus         4 ~~~~F~C~~g-~CI~~~~~CDg~~DC~DgSDE~~C~~~~C~~~~f~C~~g----~Ci~~~~~CDg~~DC~dgsDE~~   75 (80)
T 2fcw_B            4 SQAEFRCHDG-KCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSS----TCIPQLWACDNDPDCEDGSDEWP   75 (80)
T ss_dssp             CTTEEECTTS-CEEEGGGTTSSSCCSTTCTTTTTHHHHHCCTTEEECTTS----CEEEGGGTTSSSCCSTTCGGGCG
T ss_pred             CCCccCCCCC-CEEeeecccCCcccCCCcccccccccccCCceeeECCCC----CEEecccccCCCcCCCCCCCcCc
Confidence            3578999998 6999999999999999999999854  588899999985    69999999999999999999954

PyMOL of 2fcw

>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B	Back alignment and structure

>3aih_A Protein OS-9; beta barrel, lectin, sugar binding protein; HET: BMA MAN; 2.10A {Homo sapiens}	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens}	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens}	Back alignment and structure

>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1	Back alignment and structure

>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1	Back alignment and structure

>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1	Back alignment and structure

>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens}	Back alignment and structure

>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5*	Back alignment and structure

>2rl8_A Cation-dependent mannose-6-phosphate receptor; P-type lectin, lectin, glycop lysosome, membrane, transmembrane, transport; HET: NAG M6D; 1.45A {Bos taurus} SCOP: b.64.1.1 PDB: 1keo_A* 2rl7_A* 2rl6_A* 2rl9_A* 2rlb_A* 3cy4_A* 3k41_A* 3k43_A* 3k42_A* 1m6p_A* 1c39_A*	Back alignment and structure

>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens}	Back alignment and structure

>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens}	Back alignment and structure

>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1	Back alignment and structure

>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1	Back alignment and structure

>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens}	Back alignment and structure

>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1	Back alignment and structure

>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens}	Back alignment and structure

>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus}	Back alignment and structure

>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5*	Back alignment and structure

>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1	Back alignment and structure

>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1	Back alignment and structure

>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus}	Back alignment and structure

>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1	Back alignment and structure

>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens}	Back alignment and structure

>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1	Back alignment and structure

>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens}	Back alignment and structure

>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens}	Back alignment and structure

>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens}	Back alignment and structure

>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1	Back alignment and structure

>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1	Back alignment and structure

>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B	Back alignment and structure

>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1	Back alignment and structure

>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B	Back alignment and structure

>2kva_A Cation-independent mannose-6-phosphate receptor; transport, lysosome, sugar binding, glyco membrane, phosphoprotein, transmembrane, disulfide bond; NMR {Bos taurus} PDB: 2kvb_A	Back alignment and structure

>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1	Back alignment and structure

>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1	Back alignment and structure

>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1	Back alignment and structure

>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1	Back alignment and structure

>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens}	Back alignment and structure

>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1	Back alignment and structure

>1gp0_A Cation-independent mannose-6-phosphate receptor; insulin-like growth factor, transport, beta barrel; 1.4A {Homo sapiens} SCOP: b.64.1.1 PDB: 1e6f_A 1gp3_A 1gqb_A 2cnj_D 2l29_A 2l2a_A	Back alignment and structure

>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens}	Back alignment and structure

>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens}	Back alignment and structure

>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens}	Back alignment and structure

>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens}	Back alignment and structure

>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B*	Back alignment and structure

>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B*	Back alignment and structure

>2lla_A Mannose-6-phosphate/insulin-like growth factor II; monotreme, IGF-II, domain 11, transport; NMR {Tachyglossus aculeatus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		608
d1j8ea_		44	g.12.1.1 (A:) Ligand-binding domain of low-density	6e-07
d2gtln2		41	g.12.1.1 (N:61-101) Extracellular hemoglobin linke	5e-05
d1cr8a_		42	g.12.1.1 (A:) Ligand-binding domain of low-density	1e-04
d2gtlm2		42	g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co	2e-04
d1d2la_		45	g.12.1.1 (A:) Ligand-binding domain of low-density	2e-04
d1k7ba_		42	g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai	3e-04
d1f5ya2		41	g.12.1.1 (A:45-85) Ligand-binding domain of low-de	6e-04
d1f8za_		39	g.12.1.1 (A:) Ligand-binding domain of low-density	6e-04
d1v9u5_		39	g.12.1.1 (5:) Very low-density lipoprotein recepto	7e-04
d2fcwb1		39	g.12.1.1 (B:86-124) Ligand-binding domain of low-d	8e-04
d2gtlo2		41	g.12.1.1 (O:60-100) Extracellular hemoglobin linke	0.001
d1f5na1		300	a.114.1.1 (A:284-583) Interferon-induced guanylate	0.001
d2fcwb2		39	g.12.1.1 (B:125-163) Ligand-binding domain of low-	0.002
d2es4d1		280	a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB)	0.002
d1ajja_		37	g.12.1.1 (A:) Ligand-binding domain of low-density	0.002
d1f5ya1		44	g.12.1.1 (A:1-44) Ligand-binding domain of low-den	0.003
d1sa0e_		138	a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus	0.004

>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44	Back information, alignment and structure


class: Small proteins
fold: LDL receptor-like module
superfamily: LDL receptor-like module
family: LDL receptor-like module
domain: Ligand-binding domain of low-density lipoprotein receptor
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 44.0 bits (104), Expect = 6e-07
 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 6/49 (12%)

Query: 87  GTSACPNGKFYCQNAGHSPLMIFSSKVNDGICDCCDGSDEYDGKVKCPN 135
           G+ +C + +F C +       I      DG  DC D SDE      C N
Sbjct: 1   GSHSCSSTQFKCNSG----RCIPEHWTCDGDNDCGDYSDETH--ANCTN 43

PyMOL of d1j8ea_

>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41	Back information, alignment and structure

>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42	Back information, alignment and structure

>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42	Back information, alignment and structure

>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45	Back information, alignment and structure

>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42	Back information, alignment and structure

>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41	Back information, alignment and structure

>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39	Back information, alignment and structure

>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39	Back information, alignment and structure

>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39	Back information, alignment and structure

>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41	Back information, alignment and structure

>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300	Back information, alignment and structure

>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39	Back information, alignment and structure

>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37	Back information, alignment and structure

>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44	Back information, alignment and structure

>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		608
d1j8ea_		44	Ligand-binding domain of low-density lipoprotein r	98.69
d1f8za_		39	Ligand-binding domain of low-density lipoprotein r	98.66
d1cr8a_		42	Ligand-binding domain of low-density lipoprotein r	98.59
d2fcwb1		39	Ligand-binding domain of low-density lipoprotein r	98.56
d1v9u5_		39	Very low-density lipoprotein receptor {Human (Homo	98.55
d1ajja_		37	Ligand-binding domain of low-density lipoprotein r	98.55
d1d2la_		45	Ligand-binding domain of low-density lipoprotein r	98.53
d1f5ya2		41	Ligand-binding domain of low-density lipoprotein r	98.52
d1f5ya1		44	Ligand-binding domain of low-density lipoprotein r	98.5
d1v9u5_		39	Very low-density lipoprotein receptor {Human (Homo	98.49
d2fcwb2		39	Ligand-binding domain of low-density lipoprotein r	98.48
d1ajja_		37	Ligand-binding domain of low-density lipoprotein r	98.48
d2fcwb1		39	Ligand-binding domain of low-density lipoprotein r	98.48
d2gtlm2		42	Hemoglobin linker chain l1 {Common earthworm (Lumb	98.47
d1f8za_		39	Ligand-binding domain of low-density lipoprotein r	98.44
d1k7ba_		42	soluble Tva ectodomain, sTva47 {Quail (Coturnix co	98.43
d2gtln2		41	Extracellular hemoglobin linker l2 subunit {Common	98.41
d1cr8a_		42	Ligand-binding domain of low-density lipoprotein r	98.4
d1xfea2		44	Ligand-binding domain of low-density lipoprotein r	98.38
d1xfea2		44	Ligand-binding domain of low-density lipoprotein r	98.34
d1d2la_		45	Ligand-binding domain of low-density lipoprotein r	98.34
d2fcwb2		39	Ligand-binding domain of low-density lipoprotein r	98.33
d1f5ya2		41	Ligand-binding domain of low-density lipoprotein r	98.33
d2gtlm2		42	Hemoglobin linker chain l1 {Common earthworm (Lumb	98.31
d1f5ya1		44	Ligand-binding domain of low-density lipoprotein r	98.3
d2gtlo2		41	Extracellular hemoglobin linker l3 subunit {Common	98.29
d2gtln2		41	Extracellular hemoglobin linker l2 subunit {Common	98.25
d1k7ba_		42	soluble Tva ectodomain, sTva47 {Quail (Coturnix co	98.2
d1j8ea_		44	Ligand-binding domain of low-density lipoprotein r	98.19
d2gtlo2		41	Extracellular hemoglobin linker l3 subunit {Common	98.17
d2rl8a1		151	Cation-dependent mannose 6-phosphate receptor, ext	95.97
d1q25a3		152	Cation-independent mannose-6-phosphate receptor (M	94.44
d1gp0a_		133	Cation-independent mannose-6-phosphate receptor (M	90.34

>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: LDL receptor-like module
superfamily: LDL receptor-like module
family: LDL receptor-like module
domain: Ligand-binding domain of low-density lipoprotein receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.69  E-value=2.9e-09  Score=79.03  Aligned_cols=38  Identities=34%  Similarity=0.546  Sum_probs=34.8

Q ss_pred             CCCCCCCCceeccCCCCCCcccccCccccCCCCCCCCCCCCC
Q 007310           87 GTSACPNGKFYCQNAGHSPLMIFSSKVNDGICDCCDGSDEYD  128 (608)
Q Consensus        87 gt~aC~~~~F~C~n~g~~~~~Ip~s~VcDGicDCcDGSDE~~  128 (608)
                      |+.+|+.+.|.|.|+    .|||.++||||+.||.|||||..
T Consensus         1 G~~~C~~~~f~C~~g----~CI~~~~~CDg~~DC~DgsDE~~   38 (44)
T d1j8ea_           1 GSHSCSSTQFKCNSG----RCIPEHWTCDGDNDCGDYSDETH   38 (44)
T ss_dssp             CCSSSCTTEEECTTS----CEEEGGGTTSSSCCSSSSGGGSH
T ss_pred             CCccCCCCcEEcCCC----CEEChhhcCcCcccCCCCCcCCC
Confidence            567899999999986    69999999999999999999965

PyMOL of d1j8ea_

>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}	Back information, alignment and structure

>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]}	Back information, alignment and structure

>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}	Back information, alignment and structure

>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}	Back information, alignment and structure

>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}	Back information, alignment and structure

>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}	Back information, alignment and structure

>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]}	Back information, alignment and structure

>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}	Back information, alignment and structure

>d2rl8a1 b.64.1.1 (A:4-154) Cation-dependent mannose 6-phosphate receptor, extracytoplasmic domain {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1q25a3 b.64.1.1 (A:281-432) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1gp0a_ b.64.1.1 (A:) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure