Citrus Sinensis ID: 007312
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 608 | ||||||
| 255551539 | 601 | TRANSPORT INHIBITOR RESPONSE 1 protein, | 0.988 | 1.0 | 0.797 | 0.0 | |
| 359477463 | 611 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.996 | 0.991 | 0.778 | 0.0 | |
| 357447595 | 610 | F-box/LRR-repeat protein [Medicago trunc | 1.0 | 0.996 | 0.760 | 0.0 | |
| 449454438 | 602 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.990 | 1.0 | 0.754 | 0.0 | |
| 356549029 | 607 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.996 | 0.998 | 0.735 | 0.0 | |
| 356549027 | 620 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.996 | 0.977 | 0.717 | 0.0 | |
| 356563680 | 584 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.960 | 1.0 | 0.728 | 0.0 | |
| 147803605 | 672 | hypothetical protein VITISV_030455 [Viti | 0.939 | 0.849 | 0.712 | 0.0 | |
| 21536497 | 610 | F-box protein family, AtFBL4 [Arabidopsi | 0.996 | 0.993 | 0.712 | 0.0 | |
| 18414458 | 610 | F-box/LRR-repeat protein 4 [Arabidopsis | 0.996 | 0.993 | 0.712 | 0.0 |
| >gi|255551539|ref|XP_002516815.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] gi|223543903|gb|EEF45429.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 973 bits (2514), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 485/608 (79%), Positives = 536/608 (88%), Gaps = 7/608 (1%)
Query: 1 MRGHDRINTCLPDEVILEIFRHLDSKASRDACSLVCRRWLTLERLSRTTLRIGASGSPDL 60
MRGHD INTCLPDE+I+EIFRHLDSK SRDACSLVC RWL+LERLSRTTLRIGASG+PDL
Sbjct: 1 MRGHDWINTCLPDELIVEIFRHLDSKPSRDACSLVCWRWLSLERLSRTTLRIGASGNPDL 60
Query: 61 FVKLLSRRFANVKSIHIDERLSVSIPVQHGRRRGDQSKLSALQLHYLTKKTGSEDGQFQS 120
FVKLL+ RF NVK+IHIDERLS+S PV GRRR L++H + +DGQ
Sbjct: 61 FVKLLAGRFHNVKTIHIDERLSISNPVPFGRRRLSDHSAPFLKVH-----SEKDDGQL-- 113
Query: 121 ESYYLSDSGLNALADGFSKLEKLSLIWCSNISSLGLMSLAQKCIHLKSLDLQGCYVGDQG 180
ESY LSD GLNAL GF +LE LSL+WCS ISS GL +LA CI LKSLDLQGCYVGD+G
Sbjct: 114 ESYSLSDGGLNALGHGFPRLENLSLLWCSTISSAGLTALAYSCIFLKSLDLQGCYVGDRG 173
Query: 181 LAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEAVGSH 240
LA VGK C QLEDLNLRFCE LTDTGL++LA GCGKSLKSLG+AACVKITD+SLEAVGS+
Sbjct: 174 LAVVGKCCKQLEDLNLRFCESLTDTGLIELAQGCGKSLKSLGVAACVKITDISLEAVGSY 233
Query: 241 CKSLETLSLDSEFIHNKGVHAVAQGCPLLRVLKLQCINVTDEALVAVGNQCLSLELLALY 300
CKSLETLSLDSE IH GV ++AQGCP L+VLKLQC NVTDEAL+AVG CLSLELLAL
Sbjct: 234 CKSLETLSLDSESIHTSGVLSIAQGCPSLKVLKLQCTNVTDEALIAVGTCCLSLELLALC 293
Query: 301 SFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEINGCHNIGTM 360
SFQ+FTDKGL ++G GCKKLKNLTLSDCYFLSD GLEAIA+GC+ELTHLE+NGCH IGT+
Sbjct: 294 SFQRFTDKGLRSIGDGCKKLKNLTLSDCYFLSDKGLEAIASGCRELTHLEVNGCHIIGTL 353
Query: 361 GLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALHLVDCSSIGDDAICSIAEG 420
GLE+IG+ C +LTELALLYCQRI N ALLE+G+GCK LQALHLVDCSSIGDDAICSIA+G
Sbjct: 354 GLEAIGRSCSHLTELALLYCQRISNHALLEIGKGCKFLQALHLVDCSSIGDDAICSIAKG 413
Query: 421 CQNLKKLHIRRCYKIGNNGIVAVGEHCNSLTELSLRFCDRVGDEALISIGQGCSLQHLNV 480
C+NLKKLHIRRCY+IGN GIVA+GEHC L +LSLRFCDRVGDEALI+IGQGCSL HLNV
Sbjct: 414 CRNLKKLHIRRCYEIGNKGIVAIGEHCKFLMDLSLRFCDRVGDEALIAIGQGCSLHHLNV 473
Query: 481 SGCHQIGDAGIMAIAKGCPELNYLDVSVLQNLGDQAMVELGKGCPLLKDVVLSHCRQITD 540
SGCH IGDAGI+AIA+GCPEL+YLDVSVLQNLGD AM ELG+GCPLLKDVVLSHCRQITD
Sbjct: 474 SGCHLIGDAGIIAIARGCPELSYLDVSVLQNLGDMAMAELGEGCPLLKDVVLSHCRQITD 533
Query: 541 VGLSHLVKNCRMLESCHMVYCPGITAAGVATVVSGCANIKKVMVEKWKVSERTKRRAGTV 600
VGL+HLVKNC MLESCH+VYCPGITAAG+ATVVS C NIKKV+VEKWKVSERTKRRAG+V
Sbjct: 534 VGLAHLVKNCSMLESCHLVYCPGITAAGIATVVSSCTNIKKVLVEKWKVSERTKRRAGSV 593
Query: 601 ISYLCVDL 608
ISYLCVDL
Sbjct: 594 ISYLCVDL 601
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359477463|ref|XP_002279087.2| PREDICTED: F-box/LRR-repeat protein 4-like [Vitis vinifera] gi|297736957|emb|CBI26158.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357447595|ref|XP_003594073.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355483121|gb|AES64324.1| F-box/LRR-repeat protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449454438|ref|XP_004144962.1| PREDICTED: F-box/LRR-repeat protein 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356549029|ref|XP_003542901.1| PREDICTED: F-box/LRR-repeat protein 4-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356549027|ref|XP_003542900.1| PREDICTED: F-box/LRR-repeat protein 4-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356563680|ref|XP_003550089.1| PREDICTED: F-box/LRR-repeat protein 4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147803605|emb|CAN75354.1| hypothetical protein VITISV_030455 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|21536497|gb|AAM60829.1| F-box protein family, AtFBL4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18414458|ref|NP_567467.1| F-box/LRR-repeat protein 4 [Arabidopsis thaliana] gi|75333365|sp|Q9C5D2.1|FBL4_ARATH RecName: Full=F-box/LRR-repeat protein 4; Short=AtFBL4 gi|13430832|gb|AAK26038.1|AF360328_1 putative F-box protein family, AtFBL4 [Arabidopsis thaliana] gi|13605655|gb|AAK32821.1|AF361808_1 AT4g15470/dl3775w [Arabidopsis thaliana] gi|15810599|gb|AAL07187.1| putative F-box protein family protein FBL4 [Arabidopsis thaliana] gi|332658208|gb|AEE83608.1| F-box/LRR-repeat protein 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 608 | ||||||
| TAIR|locus:505006471 | 610 | AT4G15475 "AT4G15475" [Arabido | 0.996 | 0.993 | 0.692 | 1.2e-230 | |
| TAIR|locus:2143320 | 642 | AT5G27920 "AT5G27920" [Arabido | 0.746 | 0.707 | 0.297 | 4.9e-53 | |
| TAIR|locus:2149805 | 665 | AT5G01720 "AT5G01720" [Arabido | 0.733 | 0.670 | 0.313 | 1.1e-48 | |
| UNIPROTKB|Q5R3Z8 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.585 | 0.841 | 0.275 | 3.2e-43 | |
| MGI|MGI:1919429 | 423 | Fbxl2 "F-box and leucine-rich | 0.585 | 0.841 | 0.273 | 6.7e-43 | |
| MGI|MGI:1919444 | 436 | Fbxl20 "F-box and leucine-rich | 0.560 | 0.782 | 0.295 | 8.5e-43 | |
| RGD|1562243 | 422 | Fbxl2 "F-box and leucine-rich | 0.585 | 0.843 | 0.273 | 8.5e-43 | |
| UNIPROTKB|Q9UKC9 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.585 | 0.841 | 0.275 | 1.1e-42 | |
| UNIPROTKB|Q58DG6 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.560 | 0.782 | 0.295 | 1.8e-42 | |
| UNIPROTKB|Q96IG2 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.560 | 0.782 | 0.295 | 1.8e-42 |
| TAIR|locus:505006471 AT4G15475 "AT4G15475" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2225 (788.3 bits), Expect = 1.2e-230, P = 1.2e-230
Identities = 424/612 (69%), Positives = 500/612 (81%)
Query: 1 MRGHDRINTCLPDEVILEIFRHLDSKASRDACSLVCXXXXXXXXXXXXXXXIGASGSPDL 60
MRGHDRIN CLP+E+ILEIFR L+SK +RDACSLVC IGAS SPD
Sbjct: 1 MRGHDRINNCLPEELILEIFRRLESKPNRDACSLVCKRWLSLERFSRTTLRIGASFSPDD 60
Query: 61 FVKLLSRRFANVKSIHIDERLSVSIPV---QHGRRRG-DQSKLSALQLHYLTKKTGSEDG 116
F+ LLSRRF + SIH+DER+SVS+P R+RG D S S+ + LT KT S G
Sbjct: 61 FISLLSRRFLYITSIHVDERISVSLPSLSPSPKRKRGRDSSSPSSSKRKKLTDKTHS--G 118
Query: 117 QFQSESYYLSDSGLNALADGFSKLEKLSLIWCSNISSLGLMSLAQKCIHLKSLDLQGCYV 176
ES L+D+GL ALA+GF ++E LSLIWC N+SS+GL SLAQKC LKSLDLQGCYV
Sbjct: 119 AENVESSSLTDTGLTALANGFPRIENLSLIWCPNVSSVGLCSLAQKCTSLKSLDLQGCYV 178
Query: 177 GDQGLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEA 236
GDQGLAAVGK C QLE+LNLRFCEGLTD G++DL GC KSLKS+G+AA KITD+SLEA
Sbjct: 179 GDQGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLVVGCSKSLKSIGVAASAKITDLSLEA 238
Query: 237 VGSHCKSLETLSLDSEFIHNKGVHAVAQGCPLLRVLKLQCINVTDEALVAVGNQCLSLEL 296
VGSHCK LE L LDSE+IH+KG+ AVAQGC L+ LKLQC++VTD A AVG C SLE
Sbjct: 239 VGSHCKLLEVLYLDSEYIHDKGLIAVAQGCHRLKNLKLQCVSVTDVAFAAVGELCTSLER 298
Query: 297 LALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEINGCHN 356
LALYSFQ FTDKG+ A+GKG KKLK+LTLSDCYF+S GLEAIA GCKEL +EINGCHN
Sbjct: 299 LALYSFQHFTDKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEAIAHGCKELERVEINGCHN 358
Query: 357 IGTMGLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALHLVDCSSIGDDAICS 416
IGT G+E+IGK C L ELALLYCQRIGN AL E+G+GCKSL+ LHLVDCS IGD A+CS
Sbjct: 359 IGTRGIEAIGKSCPRLKELALLYCQRIGNSALQEIGKGCKSLEILHLVDCSGIGDIAMCS 418
Query: 417 IAEGCQNLKKLHIRRCYKIGNNGIVAVGEHCNSLTELSLRFCDRVGDEALISIGQGCSLQ 476
IA+GC+NLKKLHIRRCY+IGN GI+++G+HC SLTELSLRFCD+VG++ALI+IG+GCSLQ
Sbjct: 419 IAKGCRNLKKLHIRRCYEIGNKGIISIGKHCKSLTELSLRFCDKVGNKALIAIGKGCSLQ 478
Query: 477 HLNVSGCHQIGDAGIMAIAKGCPELNYLDVSVLQNLGDQAMVELGKGCPLLKDVVLSHCR 536
LNVSGC+QI DAGI AIA+GCP+L +LD+SVLQN+GD + ELG+GCP+LKD+VLSHC
Sbjct: 479 QLNVSGCNQISDAGITAIARGCPQLTHLDISVLQNIGDMPLAELGEGCPMLKDLVLSHCH 538
Query: 537 QITDVGLSHLVKNCRMLESCHMVYCPGITAAGVATVVSGCANIKKVMVEKWKVSERTKRR 596
ITD GL+HLV+ C++LE+CHMVYCPGIT+AGVATVVS C +IKKV++EKWKV+ERT RR
Sbjct: 539 HITDNGLNHLVQKCKLLETCHMVYCPGITSAGVATVVSSCPHIKKVLIEKWKVTERTTRR 598
Query: 597 AGTVISYLCVDL 608
AG+VISYLC+DL
Sbjct: 599 AGSVISYLCMDL 610
|
|
| TAIR|locus:2143320 AT5G27920 "AT5G27920" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149805 AT5G01720 "AT5G01720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96IG2 FBXL20 "F-box/LRR-repeat protein 20" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 608 | |||
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 6e-19 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 1e-18 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 2e-17 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 3e-17 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 5e-15 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 4e-14 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 2e-13 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 2e-06 | |
| pfam12937 | 47 | pfam12937, F-box-like, F-box-like | 8e-06 | |
| smart00256 | 41 | smart00256, FBOX, A Receptor for Ubiquitination Ta | 2e-05 | |
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 5e-04 | |
| smart00367 | 26 | smart00367, LRR_CC, Leucine-rich repeat - CC (cyst | 0.003 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Score = 85.8 bits (213), Expect = 6e-19
Identities = 46/167 (27%), Positives = 81/167 (48%), Gaps = 10/167 (5%)
Query: 421 CQNLKKLHIRRCYKIGNNGIVAVGEHCNSLTELSLRFCDRVGDEALISIGQGC-SLQHLN 479
L+ L + C + + +CN L +L L + DE LI++ Q C +LQ L+
Sbjct: 27 HSGLEWLELYMCPIS--DPPLDQLSNCNKLKKLILPGSKLIDDEGLIALAQSCPNLQVLD 84
Query: 480 VSGCHQIGDAGIMAIAKGCPELNYLDVSVLQN---LGDQAMVELGKGCPLLKDVVLSHCR 536
+ C I D+GI+A+A CP+L +++ +N + D ++ LGK C L+ V + C
Sbjct: 85 LRACENITDSGIVALATNCPKLQTINLGRHRNGHLITDVSLSALGKNCTFLQTVGFAGC- 143
Query: 537 QITDVGLSHLVKNC-RMLESCHMVYCPGITAAGVATVV--SGCANIK 580
+TD G+ L C + LE + C +T + ++ + N+
Sbjct: 144 DVTDKGVWELASGCSKSLERLSLNNCRNLTDQSIPAILASNYFPNLS 190
|
Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|221867 pfam12937, F-box-like, F-box-like | Back alignment and domain information |
|---|
| >gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
| >gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 608 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.98 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.95 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.93 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.91 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.91 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.79 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.78 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.69 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.68 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.67 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.57 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.57 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.56 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.56 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.55 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.55 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.39 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.38 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.36 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.3 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.25 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.22 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.15 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 99.06 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.94 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.86 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.86 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.84 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.81 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.78 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.68 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.62 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.61 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.61 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.61 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.54 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.49 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.32 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.25 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.25 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.24 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.18 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.17 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.16 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.04 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.97 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.76 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.51 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 97.41 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 97.35 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 96.99 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.95 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.84 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.66 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.65 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.52 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.41 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.4 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.38 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.36 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 96.17 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.12 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.11 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.1 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 95.89 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.86 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 95.79 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 95.52 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.51 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.47 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 95.17 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 94.53 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 94.06 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 93.97 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 93.9 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 93.47 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 93.36 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 93.21 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 92.91 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 92.65 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 91.85 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 88.88 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 88.24 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 87.38 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 84.91 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 84.68 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 81.84 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.98 E-value=2.9e-32 Score=244.85 Aligned_cols=386 Identities=28% Similarity=0.496 Sum_probs=224.3
Q ss_pred CcccCCChHHHHHHHhhcCChhhhhhhhhccHhHHHhhhhcccceeeccCCCchHHHHHHHhhcCCceEEEecccccccc
Q 007312 6 RINTCLPDEVILEIFRHLDSKASRDACSLVCRRWLTLERLSRTTLRIGASGSPDLFVKLLSRRFANVKSIHIDERLSVSI 85 (608)
Q Consensus 6 ~~~~~LP~eil~~If~~L~~~~d~~~~~~vcr~W~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~l~~~~~~~~~~ 85 (608)
.++-.||+|++..||+||+ ++.+.+++.+|+.|+..+-.-.-|-+++.. ....+
T Consensus 70 ~~~~~LPpEl~lkvFS~LD-tksl~r~a~~c~~~n~~AlD~~~~q~idL~-----------------------t~~rD-- 123 (483)
T KOG4341|consen 70 SISRSLPPELLLKVFSMLD-TKSLCRAAQCCTMWNKLALDGSCWQHIDLF-----------------------TFQRD-- 123 (483)
T ss_pred cccccCCHHHHHHHHHHHh-HHHHHHHHHHHHHhhhhhhccccceeeehh-----------------------cchhc--
Confidence 3444699999999999999 999999999999999986443333333221 11100
Q ss_pred ccccCccccccccchhhhhhhhcccCCCCcccccccccccCcccHHHHHhcC-CCCceeeccccCCCChhhHHHHHHhCC
Q 007312 86 PVQHGRRRGDQSKLSALQLHYLTKKTGSEDGQFQSESYYLSDSGLNALADGF-SKLEKLSLIWCSNISSLGLMSLAQKCI 164 (608)
Q Consensus 86 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~l~~~~-~~L~~L~l~~~~~~~~~~~~~~~~~~~ 164 (608)
+...+...+.+.+ ..|++|++++|..+....+.....++|
T Consensus 124 ---------------------------------------v~g~VV~~~~~Rcgg~lk~LSlrG~r~v~~sslrt~~~~Cp 164 (483)
T KOG4341|consen 124 ---------------------------------------VDGGVVENMISRCGGFLKELSLRGCRAVGDSSLRTFASNCP 164 (483)
T ss_pred ---------------------------------------CCCcceehHhhhhccccccccccccccCCcchhhHHhhhCC
Confidence 0111111222222 378888888888777777777777888
Q ss_pred CccEEEccCCc-cChHHHHHHHhhCCCCceeecCCCCCCCchHHHHHHhhcCCCccEEecCCCCCcChHHHHHHHhcCCC
Q 007312 165 HLKSLDLQGCY-VGDQGLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEAVGSHCKS 243 (608)
Q Consensus 165 ~L~~L~l~~~~-~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~ 243 (608)
++++|.+.++. +++..+..+++.|++|+.|++..|..+++..+..+..++ ++|++|++++|+.+...++..+.+.+..
T Consensus 165 nIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC-~kL~~lNlSwc~qi~~~gv~~~~rG~~~ 243 (483)
T KOG4341|consen 165 NIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGC-RKLKYLNLSWCPQISGNGVQALQRGCKE 243 (483)
T ss_pred chhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhh-hhHHHhhhccCchhhcCcchHHhccchh
Confidence 88888887774 777777777777888888888777677776666666666 6777777777655554444444443333
Q ss_pred CCEEECCCCccchhhHHHHHhcCCccceeeecccCCChHHHHHHHhcCCCCcEEEeccccCCChHHHHHHhhcCCCCCeE
Q 007312 244 LETLSLDSEFIHNKGVHAVAQGCPLLRVLKLQCINVTDEALVAVGNQCLSLELLALYSFQQFTDKGLHAVGKGCKKLKNL 323 (608)
Q Consensus 244 L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L 323 (608)
++.+.+.+ +.....+.+......++-+.++++..|+.+++.++..+..++..|+.|
T Consensus 244 l~~~~~kG------------------------C~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l 299 (483)
T KOG4341|consen 244 LEKLSLKG------------------------CLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVL 299 (483)
T ss_pred hhhhhhcc------------------------cccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhh
Confidence 33332221 222333444444444445555555555555555555555555555555
Q ss_pred ecCCCCCCCHHHHHHHHhcCCCCcEEEecCCCCCChhHHHHHHhcCcccceEecccccccChHHHHHHHhcCCCCcEEEe
Q 007312 324 TLSDCYFLSDMGLEAIATGCKELTHLEINGCHNIGTMGLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALHL 403 (608)
Q Consensus 324 ~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l 403 (608)
..+++..+++..+..+.+++++|+.|.+.+|..+++.++..+...|+.|+.+++..|..+.+..
T Consensus 300 ~~s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~~~~~d~t---------------- 363 (483)
T KOG4341|consen 300 CYSSCTDITDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEECGLITDGT---------------- 363 (483)
T ss_pred cccCCCCCchHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCChhhhhhcccccceehhhh----------------
Confidence 5555554555555555555555555555555544444455555444455544444443333333
Q ss_pred ccCCCCChHHHHHHHhcCccCcEEecccccccChHHHHHHHh---cCCCCcEEecccCCcCChHHHHhhhcCCCccEEEe
Q 007312 404 VDCSSIGDDAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGE---HCNSLTELSLRFCDRVGDEALISIGQGCSLQHLNV 480 (608)
Q Consensus 404 ~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~---~~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l 480 (608)
+..+..+|+.|+.+.++.|..+++.++..+.. ....|+.+.+++|+.+++...+.+...++|+.+++
T Consensus 364 ----------L~sls~~C~~lr~lslshce~itD~gi~~l~~~~c~~~~l~~lEL~n~p~i~d~~Le~l~~c~~Leri~l 433 (483)
T KOG4341|consen 364 ----------LASLSRNCPRLRVLSLSHCELITDEGIRHLSSSSCSLEGLEVLELDNCPLITDATLEHLSICRNLERIEL 433 (483)
T ss_pred ----------HhhhccCCchhccCChhhhhhhhhhhhhhhhhccccccccceeeecCCCCchHHHHHHHhhCcccceeee
Confidence 33334444444444444444444443333221 23456666666666666666666666666666666
Q ss_pred cCCcccCHHHHHHHHhhCCCCcEEeec
Q 007312 481 SGCHQIGDAGIMAIAKGCPELNYLDVS 507 (608)
Q Consensus 481 ~~~~~~~~~~~~~~~~~~~~L~~L~l~ 507 (608)
.+|..++.+++..+..++|+++...+-
T Consensus 434 ~~~q~vtk~~i~~~~~~lp~i~v~a~~ 460 (483)
T KOG4341|consen 434 IDCQDVTKEAISRFATHLPNIKVHAYF 460 (483)
T ss_pred echhhhhhhhhHHHHhhCccceehhhc
Confidence 666666666666666666666655443
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 608 | ||||
| 3ogk_B | 592 | Structure Of Coi1-Ask1 In Complex With Coronatine A | 5e-14 | ||
| 3ogk_B | 592 | Structure Of Coi1-Ask1 In Complex With Coronatine A | 5e-12 | ||
| 2p1m_B | 594 | Tir1-ask1 Complex Structure Length = 594 | 7e-11 | ||
| 2p1m_B | 594 | Tir1-ask1 Complex Structure Length = 594 | 1e-09 |
| >pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592 | Back alignment and structure |
|
| >pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592 | Back alignment and structure |
| >pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594 | Back alignment and structure |
| >pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 608 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-101 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-60 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-34 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-21 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-13 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 7e-10 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 8e-99 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-79 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-33 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-22 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-07 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 5e-44 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 1e-43 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 1e-33 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 7e-20 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-38 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 3e-35 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-34 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-11 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 4e-06 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-26 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-22 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-11 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 1e-18 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 4e-18 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 2e-17 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 3e-17 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 8e-17 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 9e-15 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 2e-12 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-15 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 4e-14 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 4e-13 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 7e-13 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-12 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 6e-12 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-11 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-07 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 7e-13 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 1e-11 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 1e-10 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 1e-10 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 2e-08 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 3e-07 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 9e-07 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 2e-10 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 1e-09 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 1e-08 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 8e-08 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 1e-04 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 2e-09 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 1e-07 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 2e-06 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 2e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-09 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-09 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-09 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-09 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 6e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-07 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 3e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 5e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 3e-07 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 5e-06 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 3e-07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 4e-07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 4e-06 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-06 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 8e-07 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 4e-04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 6e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 7e-06 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 8e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 3e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 6e-05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-04 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-04 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 2e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 8e-04 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 6e-04 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
Score = 318 bits (816), Expect = e-101
Identities = 127/573 (22%), Positives = 215/573 (37%), Gaps = 62/573 (10%)
Query: 4 HDRINTCLPDEVILEIFRHLDSKASRDACSLVCRRWLTLERLSRTTLRIGASGSPDLFVK 63
RI P+EV+ +F + R++ SLVC+ W +ER R + IG +
Sbjct: 2 QKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCY--AVSPA 59
Query: 64 LLSRRFANVKSIHIDERLSVS----IPVQHGRRRGDQSKLSALQLHYLTKKTGSEDGQFQ 119
+ RRF V+S+ + + + +P G + + +L +
Sbjct: 60 TVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLK------ 113
Query: 120 SESYYLSDSGLNALADGFSKLEKLSLIWCSNISSLGLMSLAQKCIHLKSLDLQGCYV--- 176
++D L +A F + L L C S+ GL ++A C +LK LDL+ V
Sbjct: 114 --RMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDV 171
Query: 177 GDQGLAAVGKVCNQLEDLNLRFCEG-LTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLE 235
L+ L LN+ ++ + L L C +LKSL + V + L
Sbjct: 172 SGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRC-PNLKSLKLNRAVPLEK--LA 228
Query: 236 AVGSHCKSLETLSL-----DSEFIHNKGVHAVAQGCPLLRVLKLQCINVTDEALVAVGNQ 290
+ LE L + G+ GC LR L + L AV +
Sbjct: 229 TLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSG-FWDAVPAYLPAVYSV 287
Query: 291 CLSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLE 350
C L L L S+ L + C KL+ L + ++ D GLE +A+ CK+L L
Sbjct: 288 CSRLTTLNL-SYATVQSYDLVKLLCQCPKLQRLWV--LDYIEDAGLEVLASTCKDLRELR 344
Query: 351 I--------NGCHNIGTMGLESIGKFCRNLTELALLYCQRIGNLALLEVGRGCKSLQALH 402
+ + GL S+ C L + L +C+++ N AL+ + R ++
Sbjct: 345 VFPSEPFVMEPNVALTEQGLVSVSMGCPKLESV-LYFCRQMTNAALITIARNRPNMTRFR 403
Query: 403 LVDCSSIGDDAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGEHCNSLTELSLRFCDRVG 462
L D + + + G A+ EHC L LSL +
Sbjct: 404 LCIIEPKAPDYLTL-----------------EPLDIGFGAIVEHCKDLRRLSLSGL--LT 444
Query: 463 DEALISIGQGC-SLQHLNVSGCHQIGDAGIMAIAKGCPELNYLDVSVLQNLGDQAMVELG 521
D+ IG ++ L+V+ D G+ + GC L L++ GD+A++
Sbjct: 445 DKVFEYIGTYAKKMEMLSVAFAG-DSDLGMHHVLSGCDSLRKLEIRDC-PFGDKALLANA 502
Query: 522 KGCPLLKDVVLSHCRQITDVGLSHLVKNCRMLE 554
++ + +S C ++ L + L
Sbjct: 503 SKLETMRSLWMSSCS-VSFGACKLLGQKMPKLN 534
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 608 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 100.0 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 100.0 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 100.0 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 100.0 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.97 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.97 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.95 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.92 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.92 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.91 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.91 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.91 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.9 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.89 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.89 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.88 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.88 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.88 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.87 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.87 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.87 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.86 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.86 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.86 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.85 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.84 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.82 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.82 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.82 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.81 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.81 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.8 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.8 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.8 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.8 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.8 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.8 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.79 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.78 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.77 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.73 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.73 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.73 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.71 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.69 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.68 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.68 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.68 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.67 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.65 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.63 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.62 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.54 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.52 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.5 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.47 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.47 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.46 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.46 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.46 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.43 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.43 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.41 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.41 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.39 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.39 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.38 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.38 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.37 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.35 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.35 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.35 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.34 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.33 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.33 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.33 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.31 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.31 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.3 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.3 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.29 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.29 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.28 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.26 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.25 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.22 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.2 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.17 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.14 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.11 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.09 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.09 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.06 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.06 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.06 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.04 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.01 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.0 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.98 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.97 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.97 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.95 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.94 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.92 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.9 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.88 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.85 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.85 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.83 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.82 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.81 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.77 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.76 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.71 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.69 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.55 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.54 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.52 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.52 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.51 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.5 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.47 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.47 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.47 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.44 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.43 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.41 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.41 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.4 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.4 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.38 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.37 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.36 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.35 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.34 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.32 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.3 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.28 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.18 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.15 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.05 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.87 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.79 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.78 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.74 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.73 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.72 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.72 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.55 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.48 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.41 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.37 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.1 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.05 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.94 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.91 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.91 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.91 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.89 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.84 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 96.75 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.41 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.07 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 95.77 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 92.36 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 84.95 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 80.21 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.6e-43 Score=369.92 Aligned_cols=519 Identities=22% Similarity=0.338 Sum_probs=275.8
Q ss_pred CCCcccCCChHHHHHHHhhcCChhhhhhhhhccHhHHHhhhhcccceeeccCCCchHHHHHHHhhcCCceEEEecccccc
Q 007312 4 HDRINTCLPDEVILEIFRHLDSKASRDACSLVCRRWLTLERLSRTTLRIGASGSPDLFVKLLSRRFANVKSIHIDERLSV 83 (608)
Q Consensus 4 ~~~~~~~LP~eil~~If~~L~~~~d~~~~~~vcr~W~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~l~~~~~~~~ 83 (608)
+|.+ ++||+|||.+||+||+..+|++++++|||+|+++....+..+.+...+... ...+..+|++++.+++.+....
T Consensus 3 ~d~~-~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~~--~~~~~~~~~~L~~L~L~~~~~~ 79 (594)
T 2p1m_B 3 KRIA-LSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVS--PATVIRRFPKVRSVELKGKPHF 79 (594)
T ss_dssp --------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSSC--HHHHHHHCTTCCEEEEECSCGG
T ss_pred ccch-hhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeeccccccC--HHHHHhhCCCceEEeccCCCch
Confidence 4666 589999999999999977999999999999999966666666665554321 2356788999999998875432
Q ss_pred ccccccCccccccccchhhhhhhhcccCCCCcccccccccccCcccHHHHHhcCCCCceeeccccCCCChhhHHHHHHhC
Q 007312 84 SIPVQHGRRRGDQSKLSALQLHYLTKKTGSEDGQFQSESYYLSDSGLNALADGFSKLEKLSLIWCSNISSLGLMSLAQKC 163 (608)
Q Consensus 84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~ 163 (608)
... .+. +..+ .......+..+...+++|++|+++++ .+....+..+...+
T Consensus 80 ~~~----------------~l~--~~~~-----------~~~~~~~l~~l~~~~~~L~~L~L~~~-~~~~~~~~~l~~~~ 129 (594)
T 2p1m_B 80 ADF----------------NLV--PDGW-----------GGYVYPWIEAMSSSYTWLEEIRLKRM-VVTDDCLELIAKSF 129 (594)
T ss_dssp GGG----------------TCS--CTTS-----------CCBCHHHHHHHHHHCTTCCEEEEESC-BCCHHHHHHHHHHC
T ss_pred hhc----------------ccc--cccc-----------cchhhHHHHHHHHhCCCCCeEEeeCc-EEcHHHHHHHHHhC
Confidence 100 000 0000 00233456666777888888888876 46666666666678
Q ss_pred CCccEEEccCC-ccChHHHHHHHhhCCCCceeecCCCCCCCchH---HHHHHhhcCCCccEEecCCCC-CcChHHHHHHH
Q 007312 164 IHLKSLDLQGC-YVGDQGLAAVGKVCNQLEDLNLRFCEGLTDTG---LVDLAHGCGKSLKSLGIAACV-KITDVSLEAVG 238 (608)
Q Consensus 164 ~~L~~L~l~~~-~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~---~~~~~~~~~~~L~~L~l~~~~-~~~~~~~~~~~ 238 (608)
++|++|++++| .+++..+..+...+++|++|+++++. +.+.+ +..+... .++|++|++++|. .+....+..+.
T Consensus 130 ~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~-i~~~~~~~l~~~~~~-~~~L~~L~l~~~~~~~~~~~l~~l~ 207 (594)
T 2p1m_B 130 KNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESD-VDDVSGHWLSHFPDT-YTSLVSLNISCLASEVSFSALERLV 207 (594)
T ss_dssp TTCCEEEEESCEEEEHHHHHHHHHHCTTCCEEECTTCE-EECCCGGGGGGSCTT-CCCCCEEECTTCCSCCCHHHHHHHH
T ss_pred CCCcEEeCCCcCCCCHHHHHHHHHhCCCCCEEeCcCCc-cCCcchHHHHHHhhc-CCcCcEEEecccCCcCCHHHHHHHH
Confidence 88888888888 56666677777678888888888764 22211 2222112 2678888887764 35556666666
Q ss_pred hcCCCCCEEECCCCccchhhHHHHHhcCCccceeeecccC--CChHHHHH---HHhcCCCCcEEEeccccCCChHHHHHH
Q 007312 239 SHCKSLETLSLDSEFIHNKGVHAVAQGCPLLRVLKLQCIN--VTDEALVA---VGNQCLSLELLALYSFQQFTDKGLHAV 313 (608)
Q Consensus 239 ~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~--~~~~~~~~---l~~~~~~L~~L~l~~~~~~~~~~~~~~ 313 (608)
..+++|++|+++++. ...++......+++|+.|.++... +....+.. ....+++|+.|. +........+..+
T Consensus 208 ~~~~~L~~L~L~~~~-~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~l~~~l~~~~~L~~Ls--~~~~~~~~~l~~~ 284 (594)
T 2p1m_B 208 TRCPNLKSLKLNRAV-PLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLS--GFWDAVPAYLPAV 284 (594)
T ss_dssp HHCTTCCEEECCTTS-CHHHHHHHHHHCTTCSEEECSBCCCCCCHHHHHHHHHHHHTCTTCCEEE--CCBTCCGGGGGGG
T ss_pred HhCCCCcEEecCCCC-cHHHHHHHHhcCCcceEcccccccCccchhhHHHHHHHHhcCCCccccc--CCcccchhhHHHH
Confidence 667778888777662 222255555567777777765332 22222211 123355555552 1111222222222
Q ss_pred hhcCCCCCeEecCCCCCCCHHHHHHHHhcCCCCcEEEecCCCCCChhHHHHHHhcCcccceEecccccccChHHHHHHHh
Q 007312 314 GKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEINGCHNIGTMGLESIGKFCRNLTELALLYCQRIGNLALLEVGR 393 (608)
Q Consensus 314 ~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~ 393 (608)
...+++|++|+++++. +++..+..+...+++|++|++.++ +.+.++..+...+++|++|++..|....
T Consensus 285 ~~~~~~L~~L~L~~~~-l~~~~l~~~~~~~~~L~~L~l~~~--~~~~~l~~l~~~~~~L~~L~L~~~~~~g--------- 352 (594)
T 2p1m_B 285 YSVCSRLTTLNLSYAT-VQSYDLVKLLCQCPKLQRLWVLDY--IEDAGLEVLASTCKDLRELRVFPSEPFV--------- 352 (594)
T ss_dssp HHHHTTCCEEECTTCC-CCHHHHHHHHTTCTTCCEEEEEGG--GHHHHHHHHHHHCTTCCEEEEECSCTTC---------
T ss_pred HHhhCCCCEEEccCCC-CCHHHHHHHHhcCCCcCEEeCcCc--cCHHHHHHHHHhCCCCCEEEEecCcccc---------
Confidence 2234555555555554 444444444444455555555543 3333444444444555555441100000
Q ss_pred cCCCCcEEEeccCCCCChHHHHHHHhcCccCcEEecccccccChHHHHHHHhcCCCCcEEecc-----cCCcCC----hH
Q 007312 394 GCKSLQALHLVDCSSIGDDAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGEHCNSLTELSLR-----FCDRVG----DE 464 (608)
Q Consensus 394 ~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~-----~~~~~~----~~ 464 (608)
..++..+++.++..+..++++|++|.+ +|..+++.++..+...+++|+.|+++ +|+.++ +.
T Consensus 353 ---------~~~~~~l~~~~l~~l~~~~~~L~~L~~-~~~~l~~~~~~~l~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~ 422 (594)
T 2p1m_B 353 ---------MEPNVALTEQGLVSVSMGCPKLESVLY-FCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDI 422 (594)
T ss_dssp ---------SSCSSCCCHHHHHHHHHHCTTCCEEEE-EESCCCHHHHHHHHHHCTTCCEEEEEESSTTCCCTTTCCCTHH
T ss_pred ---------cccCCCCCHHHHHHHHHhchhHHHHHH-hcCCcCHHHHHHHHhhCCCcceeEeecccCCCcccccCCchhh
Confidence 022233444444444444455555533 22344444444444444555555554 333344 22
Q ss_pred HHHhh-hcCCCccEEEecCCcccCHHHHHHHHhhCCCCcEEeecCCCCCChHHHHHHhccCCCcceeecccccCccHHHH
Q 007312 465 ALISI-GQGCSLQHLNVSGCHQIGDAGIMAIAKGCPELNYLDVSVLQNLGDQAMVELGKGCPLLKDVVLSHCRQITDVGL 543 (608)
Q Consensus 465 ~~~~l-~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~~L~~L~l~~c~~l~~~~~ 543 (608)
++..+ ..+++|++|++++ .+++.++..+...+++|+.|++++| .+++.++..+..++++|+.|++++|+ +++.++
T Consensus 423 ~~~~l~~~~~~L~~L~L~~--~l~~~~~~~l~~~~~~L~~L~L~~~-~i~~~~~~~l~~~~~~L~~L~L~~n~-~~~~~~ 498 (594)
T 2p1m_B 423 GFGAIVEHCKDLRRLSLSG--LLTDKVFEYIGTYAKKMEMLSVAFA-GDSDLGMHHVLSGCDSLRKLEIRDCP-FGDKAL 498 (594)
T ss_dssp HHHHHHHHCTTCCEEECCS--SCCHHHHHHHHHHCTTCCEEEEESC-CSSHHHHHHHHHHCTTCCEEEEESCS-CCHHHH
T ss_pred HHHHHHhhCCCccEEeecC--cccHHHHHHHHHhchhccEeeccCC-CCcHHHHHHHHhcCCCcCEEECcCCC-CcHHHH
Confidence 32222 2334455555543 3455555555444555555555555 35555555554445555555555554 355555
Q ss_pred HHHHHcCCccCeeecccCCCCCHHHHHHHHHcCCCCcEEEecce
Q 007312 544 SHLVKNCRMLESCHMVYCPGITAAGVATVVSGCANIKKVMVEKW 587 (608)
Q Consensus 544 ~~~~~~~~~L~~L~l~~c~~~~~~~~~~~~~~~~~L~~l~l~~~ 587 (608)
..+...+++|+.|++++|+. +..++..+...+|+|+...+..+
T Consensus 499 ~~~~~~l~~L~~L~l~~~~~-~~~~~~~l~~~lp~l~i~~~~~~ 541 (594)
T 2p1m_B 499 LANASKLETMRSLWMSSCSV-SFGACKLLGQKMPKLNVEVIDER 541 (594)
T ss_dssp HHTGGGGGGSSEEEEESSCC-BHHHHHHHHHHCTTEEEEEECSS
T ss_pred HHHHHhCCCCCEEeeeCCCC-CHHHHHHHHHhCCCCEEEEecCC
Confidence 44444455555555555543 44555544455555554444433
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 608 | ||||
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 1e-15 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-11 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 3e-08 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 8e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 1e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 4e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 5e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 9e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 7e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 2e-06 | |
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 1e-05 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 9e-05 | |
| d1p22a1 | 118 | a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b | 3e-04 | |
| d1io0a_ | 166 | c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic | 6e-04 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 0.004 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 75.5 bits (184), Expect = 1e-15
Identities = 47/235 (20%), Positives = 81/235 (34%), Gaps = 6/235 (2%)
Query: 269 LRVLKLQCINVTDEALVAVGNQCLSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDC 328
V+ +C + +A ++ + L S LH + C KL+NL+L
Sbjct: 23 QGVIAFRCPRSFMDQPLAEHFSPFRVQHMDL-SNSVIEVSTLHGILSQCSKLQNLSLEGL 81
Query: 329 YFLSDMGLEAIATGCKELTHLEINGCHNIGTMGLESIGKFCRNLTEL-ALLYCQRIGNLA 387
LSD + +A L L ++GC L+++ C L EL
Sbjct: 82 R-LSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHV 139
Query: 388 LLEVGRGCKSLQALHLVDCSSIGDDAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGEHC 447
+ V +++ L+L + S + N
Sbjct: 140 QVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQL 199
Query: 448 NSLTELSLRFCDRVGDEALISIGQGCSLQHLNVSGCHQIGDAGIMAIAKGCPELN 502
N L LSL C + E L+ +G+ +L+ L V G + D + + + P L
Sbjct: 200 NYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGI--VPDGTLQLLKEALPHLQ 252
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 608 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.9 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.89 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.89 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.88 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.66 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.57 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.49 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.48 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.98 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.97 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.95 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.93 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.91 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.84 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.84 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.81 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.78 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.72 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.7 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.68 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.67 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.66 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.66 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.65 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.65 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.64 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.62 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.58 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.56 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.55 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.54 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.51 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.47 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.44 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.42 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.38 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.35 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.97 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.97 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.92 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.88 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.12 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.06 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.83 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.62 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90 E-value=7.5e-23 Score=188.75 Aligned_cols=212 Identities=19% Similarity=0.307 Sum_probs=158.5
Q ss_pred cccceEecccccccChHHHHHHHhcCCCCcEEEeccCCCCChHHHHHHHhcCccCcEEecccccccChHHHHHHHhcCCC
Q 007312 370 RNLTELALLYCQRIGNLALLEVGRGCKSLQALHLVDCSSIGDDAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGEHCNS 449 (608)
Q Consensus 370 ~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~ 449 (608)
.+|++|++++ ..++...+..+...+++|++|++.+| .+++..+..+. .+++|++|++++|..+++.++..++..+++
T Consensus 46 ~~L~~LdLs~-~~i~~~~l~~l~~~c~~L~~L~L~~~-~l~~~~~~~l~-~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~ 122 (284)
T d2astb2 46 FRVQHMDLSN-SVIEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQTLLSSCSR 122 (284)
T ss_dssp BCCCEEECTT-CEECHHHHHHHHTTBCCCSEEECTTC-BCCHHHHHHHT-TCTTCSEEECTTCBSCCHHHHHHHHHHCTT
T ss_pred CCCCEEECCC-CccCHHHHHHHHHhCCCccccccccc-CCCcHHHHHHh-cCCCCcCccccccccccccccchhhHHHHh
Confidence 5677777776 35666666666677777888877776 46665555543 477888888888777887777777777888
Q ss_pred CcEEecccCCcCChHHHHh-hhcC-CCccEEEecCC-cccCHHHHHHHHhhCCCCcEEeecCCCCCChHHHHHHhccCCC
Q 007312 450 LTELSLRFCDRVGDEALIS-IGQG-CSLQHLNVSGC-HQIGDAGIMAIAKGCPELNYLDVSVLQNLGDQAMVELGKGCPL 526 (608)
Q Consensus 450 L~~L~l~~~~~~~~~~~~~-l~~~-~~L~~L~l~~~-~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~~ 526 (608)
|++|++++|..+++.++.. +... +.|++|++++| ..+++.++..+..+||+|++|++++|..+++.++..+.. +|+
T Consensus 123 L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~-~~~ 201 (284)
T d2astb2 123 LDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQ-LNY 201 (284)
T ss_dssp CCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGG-CTT
T ss_pred ccccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcc-cCc
Confidence 8888888877777766543 3343 46888888875 457888888888888999999998887788888777764 889
Q ss_pred cceeecccccCccHHHHHHHHHcCCccCeeecccCCCCCHHHHHHHHHcCCCCcEEEecceeeec
Q 007312 527 LKDVVLSHCRQITDVGLSHLVKNCRMLESCHMVYCPGITAAGVATVVSGCANIKKVMVEKWKVSE 591 (608)
Q Consensus 527 L~~L~l~~c~~l~~~~~~~~~~~~~~L~~L~l~~c~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~ 591 (608)
|++|++++|+.+++.++..+. .+|+|+.|++++| +++.++..+...+|+|+ +..++++.
T Consensus 202 L~~L~L~~C~~i~~~~l~~L~-~~~~L~~L~l~~~--~~d~~l~~l~~~lp~L~---i~~~~ls~ 260 (284)
T d2astb2 202 LQHLSLSRCYDIIPETLLELG-EIPTLKTLQVFGI--VPDGTLQLLKEALPHLQ---INCSHFTT 260 (284)
T ss_dssp CCEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTS--SCTTCHHHHHHHSTTSE---ESCCCSCC
T ss_pred CCEEECCCCCCCChHHHHHHh-cCCCCCEEeeeCC--CCHHHHHHHHHhCcccc---ccCccCCC
Confidence 999999998888888877765 5888999999887 66677777777788876 35555554
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|