Citrus Sinensis ID: 007341
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 607 | ||||||
| 255548782 | 663 | two-component system sensor histidine ki | 0.896 | 0.820 | 0.593 | 1e-172 | |
| 225430376 | 693 | PREDICTED: two-component response regula | 0.907 | 0.795 | 0.563 | 1e-162 | |
| 147863919 | 693 | hypothetical protein VITISV_010435 [Viti | 0.907 | 0.795 | 0.564 | 1e-162 | |
| 298103726 | 668 | putative B-type response regulator 22 [P | 0.886 | 0.805 | 0.579 | 1e-159 | |
| 224141943 | 661 | type-b response regulator [Populus trich | 0.876 | 0.804 | 0.573 | 1e-153 | |
| 296082079 | 667 | unnamed protein product [Vitis vinifera] | 0.864 | 0.787 | 0.532 | 1e-148 | |
| 449455539 | 688 | PREDICTED: two-component response regula | 0.897 | 0.792 | 0.499 | 1e-141 | |
| 449485185 | 688 | PREDICTED: LOW QUALITY PROTEIN: two-comp | 0.897 | 0.792 | 0.499 | 1e-141 | |
| 147787458 | 706 | hypothetical protein VITISV_005486 [Viti | 0.911 | 0.783 | 0.5 | 1e-140 | |
| 359484783 | 712 | PREDICTED: two-component response regula | 0.907 | 0.773 | 0.5 | 1e-139 |
| >gi|255548782|ref|XP_002515447.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] gi|223545391|gb|EEF46896.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 611 bits (1575), Expect = e-172, Method: Compositional matrix adjust.
Identities = 344/580 (59%), Positives = 407/580 (70%), Gaps = 36/580 (6%)
Query: 4 VLSGNGDPKLVMKGITHGACDYLLKPVRIEELKNIWQHVVRRKKIDAKDQNNSDNQDKPH 63
+LS DPKLVMKGITHGACDYLLKPVRIEELKNIWQHV+RRKK+D KDQNN DNQDK
Sbjct: 95 MLSAYSDPKLVMKGITHGACDYLLKPVRIEELKNIWQHVIRRKKVDNKDQNNFDNQDKLP 154
Query: 64 NGSGQAEGMGNSDQNGKLNKKRKDQNEDEDDEDDEDDHNHEDPTTQKKPRVVWSVELHRK 123
GSG+A +DQ KLNKKRKDQNEDED++ DE H +EDPTTQKKPRVVWSVELHRK
Sbjct: 155 RGSGEA----TADQ--KLNKKRKDQNEDEDEDRDEHGHENEDPTTQKKPRVVWSVELHRK 208
Query: 124 FVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISCVANQQANMVAAL 183
FVAAVNQLG+DKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRIS VANQQANMVAAL
Sbjct: 209 FVAAVNQLGVDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISTVANQQANMVAAL 268
Query: 184 GSSDPSYLRMSSVNGLGNYHTVGGPGQFQNSTFRSFPASGMLGRLNAPAGLGMHGLPSSG 243
GSSD SYL+M S GLG + + G GQF N+TFR P SGMLGRLN+PAGLGM GLPS G
Sbjct: 269 GSSDASYLQMGS--GLG-FQGIAGAGQFHNATFRPLPPSGMLGRLNSPAGLGMRGLPSPG 325
Query: 244 MIPMRHAQNSDNTTNDQGKFHPALLPGSHSGNILQGMPTSLELDQLQLNKNITSISELP- 302
+I + Q + +++N+Q F A+ PG ++GN+LQGMPTSLELDQ+Q NK +T I ELP
Sbjct: 326 VIQLGQLQGTGHSSNNQSHFQMAVHPG-NAGNVLQGMPTSLELDQIQSNKGVTYIRELPT 384
Query: 303 NTKDNTTFHVSSGFPDARIGFGRSTNPLLDVNNNPLFLEGHPQEAHSNKMFGNQS---LM 359
+ D T F VS GF D +I G S + L +N PL LEG+ Q A K FG S +
Sbjct: 385 DINDATAFSVSGGFSDTKIMVGSSNSSFLGASNKPLMLEGNTQGAQDGKEFGKHSSLTVA 444
Query: 360 SLNSGSSSRLPDHGRCNDNWSSAVQSSGIQPNSFSLGGDYKQPTLHPGHLRDNLSTMALP 419
SL+SG SS LPD GRCNDNWSSAVQS+G+Q SF+L ++Q TLHP + RD++STM L
Sbjct: 445 SLDSGFSSHLPDPGRCNDNWSSAVQSNGVQSTSFALNDCFRQTTLHPNNSRDSMSTMGLQ 504
Query: 420 IGNSPCDVSSLHPLSNRFQDPKADLQFQAV---------------------QDAPCRSNV 458
GN+ D+SS+ L Q+ KADLQ Q QD+ SN
Sbjct: 505 NGNNAPDISSISTLPIHLQESKADLQCQITSIRSNAGQIINNAPQGWDDQRQDSMYHSNA 564
Query: 459 MFSPLNSAVSINGDVGPLGQCLDTNKTFFHRSNEFDSLGQSNFVDHFSMKINEVQRSSMQ 518
+ S +N+A I G +G LD T FHR+ F+S Q+NF+D MK N+V+ SM+
Sbjct: 565 VHSSVNTANPIPGTGTLMGHSLDPKNTIFHRTTSFNSTRQTNFIDMPLMKHNDVENLSME 624
Query: 519 ASSNLKEGYLMGQQKTQGSYISTSVDSLEDLFMSSMVKEV 558
EGY+M QQK Q SY+S + SLEDL + MVK+V
Sbjct: 625 ILMRSNEGYVMAQQKLQSSYVSDNFGSLEDL-ANVMVKQV 663
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225430376|ref|XP_002282928.1| PREDICTED: two-component response regulator ARR12-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147863919|emb|CAN81109.1| hypothetical protein VITISV_010435 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|298103726|emb|CBM42564.1| putative B-type response regulator 22 [Populus x canadensis] | Back alignment and taxonomy information |
|---|
| >gi|224141943|ref|XP_002324320.1| type-b response regulator [Populus trichocarpa] gi|222865754|gb|EEF02885.1| type-b response regulator [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296082079|emb|CBI21084.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449455539|ref|XP_004145510.1| PREDICTED: two-component response regulator ARR12-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449485185|ref|XP_004157093.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator ARR12-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|147787458|emb|CAN60088.1| hypothetical protein VITISV_005486 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359484783|ref|XP_002270833.2| PREDICTED: two-component response regulator ARR12-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 607 | ||||||
| TAIR|locus:2040194 | 596 | RR12 "response regulator 12" [ | 0.517 | 0.526 | 0.531 | 1.9e-85 | |
| TAIR|locus:2116587 | 552 | RR10 "response regulator 10" [ | 0.436 | 0.480 | 0.393 | 2.1e-58 | |
| TAIR|locus:2130095 | 664 | RR2 "response regulator 2" [Ar | 0.457 | 0.418 | 0.393 | 1.2e-47 | |
| TAIR|locus:2093668 | 690 | RR1 "response regulator 1" [Ar | 0.469 | 0.413 | 0.391 | 1.8e-46 | |
| TAIR|locus:2065398 | 382 | RR14 "response regulator 14" [ | 0.420 | 0.667 | 0.4 | 4.8e-39 | |
| TAIR|locus:2008585 | 521 | ARR11 "response regulator 11" | 0.266 | 0.310 | 0.497 | 2.4e-35 | |
| UNIPROTKB|Q7Y0W3 | 341 | Q7Y0W3 "Two-component response | 0.095 | 0.170 | 0.672 | 2.9e-27 | |
| UNIPROTKB|Q7Y0W5 | 341 | EHD1 "Two-component response r | 0.095 | 0.170 | 0.672 | 2.9e-27 | |
| TAIR|locus:2155954 | 292 | APRR4 "pseudo-response regulat | 0.250 | 0.520 | 0.345 | 2.5e-19 | |
| TAIR|locus:2148348 | 298 | BOA "AT5G59570" [Arabidopsis t | 0.113 | 0.231 | 0.637 | 3.1e-18 |
| TAIR|locus:2040194 RR12 "response regulator 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 779 (279.3 bits), Expect = 1.9e-85, Sum P(2) = 1.9e-85
Identities = 187/352 (53%), Positives = 227/352 (64%)
Query: 4 VLSGNGDPKLVMKGITHGACDYLLKPVRIEELKNIWQHVVRRKKIDAKDQNNSDNQDKPH 63
+LS + DPK VMKG+THGACDYLLKPVRIEELKNIWQHVVR + D K++ +++N DK
Sbjct: 94 MLSAHSDPKYVMKGVTHGACDYLLKPVRIEELKNIWQHVVR-SRFD-KNRGSNNNGDK-R 150
Query: 64 NGSGQAEGMGNSDQN-GKLNKKRKDQXXXXXXXXXXXXXXXXXPTTQKKPRVVWSVELHR 122
+GSG EG+GNSDQN GK N+KRKDQ QKK RVVW+VELH+
Sbjct: 151 DGSGN-EGVGNSDQNNGKGNRKRKDQYNEDEDEDRDDNDDS---CAQKKQRVVWTVELHK 206
Query: 123 KFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISCVANQQANMVAA 182
KFVAAVNQLG +KA+PKKILDLMNVEKLTRENVASHLQK+RLYLKRIS VANQQA M
Sbjct: 207 KFVAAVNQLGYEKAMPKKILDLMNVEKLTRENVASHLQKFRLYLKRISGVANQQAIMA-- 264
Query: 183 LGSSDPSYLRMSSVNGLGNYHTVGGPGQFQNST--FRSFPASGMLGRLNAPAGLGMHGL- 239
+S+ +++M+ ++G + G GQ+ RSFP +G+LGRLN P+G+G+ L
Sbjct: 265 --NSELHFMQMNGLDGFHHRPIPVGSGQYHGGAPAMRSFPPNGILGRLNTPSGIGVRSLS 322
Query: 240 -PSSGMIPMRHAQNSDNTTNDQGKFHP-ALLPGSHS--GNILQGMPTSLELDQLQLNKNI 295
P +GM QN D GKFH + LP +HS GNILQG+P LE DQLQ N N
Sbjct: 323 SPPAGMF----LQNQ----TDIGKFHHVSSLPLNHSDGGNILQGLPMPLEFDQLQTNNNK 374
Query: 296 TSISELPNTKDNTTFH-VSSGFPDARIGFGRSTNPLLDV-NNNPLFLEGHPQ 345
+ N N + S FP F N L+ NNN + LEGHPQ
Sbjct: 375 SR-----NMNSNKSIAGTSMAFPS----FSTQQNSLISAPNNNVVVLEGHPQ 417
|
|
| TAIR|locus:2116587 RR10 "response regulator 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130095 RR2 "response regulator 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093668 RR1 "response regulator 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2065398 RR14 "response regulator 14" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008585 ARR11 "response regulator 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Y0W3 Q7Y0W3 "Two-component response regulator EHD1" [Oryza sativa Indica Group (taxid:39946)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Y0W5 EHD1 "Two-component response regulator EHD1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155954 APRR4 "pseudo-response regulator 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2148348 BOA "AT5G59570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 607 | |||
| TIGR01557 | 57 | TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai | 2e-22 | |
| PLN03162 | 526 | PLN03162, PLN03162, golden-2 like transcription fa | 3e-16 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 5e-06 | |
| cd00156 | 113 | cd00156, REC, Signal receiver domain; originally t | 1e-04 | |
| COG4753 | 475 | COG4753, COG4753, Response regulator containing Ch | 2e-04 | |
| pfam00072 | 111 | pfam00072, Response_reg, Response regulator receiv | 0.001 | |
| COG0784 | 130 | COG0784, CheY, FOG: CheY-like receiver [Signal tra | 0.003 |
| >gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
Score = 90.2 bits (224), Expect = 2e-22
Identities = 35/55 (63%), Positives = 44/55 (80%), Gaps = 1/55 (1%)
Query: 111 KPRVVWSVELHRKFVAAVNQLGI-DKAVPKKILDLMNVEKLTRENVASHLQKYRL 164
KPRVVW+ +LH +F+ AV +LG D A PK+IL+LM V+ LTR+ VASHLQKYRL
Sbjct: 1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRL 55
|
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57 |
| >gnl|CDD|178707 PLN03162, PLN03162, golden-2 like transcription factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >gnl|CDD|227095 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain | Back alignment and domain information |
|---|
| >gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 607 | |||
| PLN03162 | 526 | golden-2 like transcription factor; Provisional | 99.86 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 99.73 | |
| COG0745 | 229 | OmpR Response regulators consisting of a CheY-like | 98.28 | |
| COG4565 | 224 | CitB Response regulator of citrate/malate metaboli | 97.68 | |
| COG4566 | 202 | TtrR Response regulator [Signal transduction mecha | 97.67 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 97.62 | |
| PRK10046 | 225 | dpiA two-component response regulator DpiA; Provis | 97.5 | |
| PF00072 | 112 | Response_reg: Response regulator receiver domain; | 97.43 | |
| PRK10529 | 225 | DNA-binding transcriptional activator KdpE; Provis | 97.04 | |
| PRK11173 | 237 | two-component response regulator; Provisional | 96.98 | |
| PRK10766 | 221 | DNA-binding transcriptional regulator TorR; Provis | 96.97 | |
| TIGR03787 | 227 | marine_sort_RR proteobacterial dedicated sortase s | 96.96 | |
| PRK10816 | 223 | DNA-binding transcriptional regulator PhoP; Provis | 96.94 | |
| PRK09836 | 227 | DNA-binding transcriptional activator CusR; Provis | 96.93 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 96.85 | |
| PRK10643 | 222 | DNA-binding transcriptional regulator BasR; Provis | 96.84 | |
| PRK10161 | 229 | transcriptional regulator PhoB; Provisional | 96.81 | |
| PRK09468 | 239 | ompR osmolarity response regulator; Provisional | 96.77 | |
| PRK10336 | 219 | DNA-binding transcriptional regulator QseB; Provis | 96.76 | |
| PLN03029 | 222 | type-a response regulator protein; Provisional | 96.69 | |
| TIGR01387 | 218 | cztR_silR_copR heavy metal response regulator. Mem | 96.66 | |
| PRK10955 | 232 | DNA-binding transcriptional regulator CpxR; Provis | 96.65 | |
| CHL00148 | 240 | orf27 Ycf27; Reviewed | 96.64 | |
| PRK11517 | 223 | transcriptional regulatory protein YedW; Provision | 96.63 | |
| PRK10701 | 240 | DNA-binding transcriptional regulator RstA; Provis | 96.61 | |
| TIGR02154 | 226 | PhoB phosphate regulon transcriptional regulatory | 96.61 | |
| PRK11083 | 228 | DNA-binding response regulator CreB; Provisional | 96.56 | |
| PRK13856 | 241 | two-component response regulator VirG; Provisional | 96.56 | |
| PRK10360 | 196 | DNA-binding transcriptional activator UhpA; Provis | 96.53 | |
| COG4753 | 475 | Response regulator containing CheY-like receiver d | 96.46 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 96.43 | |
| PRK10430 | 239 | DNA-binding transcriptional activator DcuR; Provis | 96.41 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 96.41 | |
| PRK10693 | 303 | response regulator of RpoS; Provisional | 96.4 | |
| COG4567 | 182 | Response regulator consisting of a CheY-like recei | 96.38 | |
| PRK10840 | 216 | transcriptional regulator RcsB; Provisional | 96.35 | |
| PRK09958 | 204 | DNA-binding transcriptional activator EvgA; Provis | 96.32 | |
| PRK10610 | 129 | chemotaxis regulatory protein CheY; Provisional | 96.25 | |
| PRK09935 | 210 | transcriptional regulator FimZ; Provisional | 96.22 | |
| PRK15479 | 221 | transcriptional regulatory protein TctD; Provision | 96.15 | |
| COG3437 | 360 | Response regulator containing a CheY-like receiver | 96.15 | |
| PRK11475 | 207 | DNA-binding transcriptional activator BglJ; Provis | 96.05 | |
| TIGR02875 | 262 | spore_0_A sporulation transcription factor Spo0A. | 96.01 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 95.87 | |
| COG3707 | 194 | AmiR Response regulator with putative antiterminat | 95.85 | |
| PRK10710 | 240 | DNA-binding transcriptional regulator BaeR; Provis | 95.79 | |
| PRK09483 | 217 | response regulator; Provisional | 95.74 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 95.69 | |
| COG2197 | 211 | CitB Response regulator containing a CheY-like rec | 95.5 | |
| PRK15369 | 211 | two component system sensor kinase SsrB; Provision | 95.27 | |
| PRK10403 | 215 | transcriptional regulator NarP; Provisional | 95.14 | |
| COG0784 | 130 | CheY FOG: CheY-like receiver [Signal transduction | 95.08 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 95.05 | |
| PRK13435 | 145 | response regulator; Provisional | 95.01 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 94.85 | |
| PRK10651 | 216 | transcriptional regulator NarL; Provisional | 94.83 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 94.81 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 94.73 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 94.65 | |
| PRK15347 | 921 | two component system sensor kinase SsrA; Provision | 94.47 | |
| PRK11697 | 238 | putative two-component response-regulatory protein | 94.44 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 94.36 | |
| PRK14084 | 246 | two-component response regulator; Provisional | 94.35 | |
| PRK09390 | 202 | fixJ response regulator FixJ; Provisional | 94.14 | |
| cd00156 | 113 | REC Signal receiver domain; originally thought to | 94.12 | |
| PRK11466 | 914 | hybrid sensory histidine kinase TorS; Provisional | 93.8 | |
| TIGR02956 | 968 | TMAO_torS TMAO reductase sytem sensor TorS. This p | 93.67 | |
| PRK09959 | 1197 | hybrid sensory histidine kinase in two-component r | 92.92 | |
| PRK12555 | 337 | chemotaxis-specific methylesterase; Provisional | 90.52 | |
| PRK10100 | 216 | DNA-binding transcriptional regulator CsgD; Provis | 90.14 | |
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 89.84 | |
| smart00426 | 68 | TEA TEA domain. | 89.8 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 88.51 | |
| PRK00742 | 354 | chemotaxis-specific methylesterase; Provisional | 87.62 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 86.11 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 85.13 | |
| PF01285 | 431 | TEA: TEA/ATTS domain family; InterPro: IPR000818 T | 83.08 |
| >PLN03162 golden-2 like transcription factor; Provisional | Back alignment and domain information |
|---|
Probab=99.86 E-value=5.5e-22 Score=206.75 Aligned_cols=66 Identities=53% Similarity=0.866 Sum_probs=62.4
Q ss_pred CCCCCCCceeccHHHHHHHHHHHHHhCCCCCchHHHHhhcCCCCCCHHHHHHhhhhhhhhhhchhh
Q 007341 106 PTTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISC 171 (607)
Q Consensus 106 ~s~~kKpRlvWT~ELH~kFv~AV~qLG~~kA~Pk~IlelM~v~gLT~enVaSHLQKyR~~Lkr~s~ 171 (607)
....||+|++||+|||++||+||++||++||+||+||++|+|+|||++||||||||||+++|++..
T Consensus 230 ~~g~KKpRLrWTpELH~rFVeAV~qLG~dKATPK~ILelMnV~GLTRenVKSHLQKYRl~rk~l~~ 295 (526)
T PLN03162 230 APGKKKAKVDWTPELHRRFVHAVEQLGVEKAFPSRILELMGVQCLTRHNIASHLQKYRSHRRHLAA 295 (526)
T ss_pred CCCCCCCcccCCHHHHHHHHHHHHHhCcCccchHHHHHHcCCCCcCHHHHHHHHHHHHHhcccccc
Confidence 345789999999999999999999999999999999999999999999999999999999998754
|
|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4566 TtrR Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10046 dpiA two-component response regulator DpiA; Provisional | Back alignment and domain information |
|---|
| >PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PRK10529 DNA-binding transcriptional activator KdpE; Provisional | Back alignment and domain information |
|---|
| >PRK11173 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10766 DNA-binding transcriptional regulator TorR; Provisional | Back alignment and domain information |
|---|
| >TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator | Back alignment and domain information |
|---|
| >PRK10816 DNA-binding transcriptional regulator PhoP; Provisional | Back alignment and domain information |
|---|
| >PRK09836 DNA-binding transcriptional activator CusR; Provisional | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >PRK10643 DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >PRK10161 transcriptional regulator PhoB; Provisional | Back alignment and domain information |
|---|
| >PRK09468 ompR osmolarity response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10336 DNA-binding transcriptional regulator QseB; Provisional | Back alignment and domain information |
|---|
| >PLN03029 type-a response regulator protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01387 cztR_silR_copR heavy metal response regulator | Back alignment and domain information |
|---|
| >PRK10955 DNA-binding transcriptional regulator CpxR; Provisional | Back alignment and domain information |
|---|
| >CHL00148 orf27 Ycf27; Reviewed | Back alignment and domain information |
|---|
| >PRK11517 transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >PRK10701 DNA-binding transcriptional regulator RstA; Provisional | Back alignment and domain information |
|---|
| >TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >PRK11083 DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >PRK13856 two-component response regulator VirG; Provisional | Back alignment and domain information |
|---|
| >PRK10360 DNA-binding transcriptional activator UhpA; Provisional | Back alignment and domain information |
|---|
| >COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >PRK10430 DNA-binding transcriptional activator DcuR; Provisional | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PRK10693 response regulator of RpoS; Provisional | Back alignment and domain information |
|---|
| >COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK10840 transcriptional regulator RcsB; Provisional | Back alignment and domain information |
|---|
| >PRK09958 DNA-binding transcriptional activator EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK10610 chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >PRK09935 transcriptional regulator FimZ; Provisional | Back alignment and domain information |
|---|
| >PRK15479 transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11475 DNA-binding transcriptional activator BglJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02875 spore_0_A sporulation transcription factor Spo0A | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10710 DNA-binding transcriptional regulator BaeR; Provisional | Back alignment and domain information |
|---|
| >PRK09483 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK15369 two component system sensor kinase SsrB; Provisional | Back alignment and domain information |
|---|
| >PRK10403 transcriptional regulator NarP; Provisional | Back alignment and domain information |
|---|
| >COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >PRK13435 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PRK10651 transcriptional regulator NarL; Provisional | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK15347 two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >PRK11697 putative two-component response-regulatory protein YehT; Provisional | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PRK14084 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09390 fixJ response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >PRK11466 hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK12555 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >PRK10100 DNA-binding transcriptional regulator CsgD; Provisional | Back alignment and domain information |
|---|
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >smart00426 TEA TEA domain | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >PRK00742 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 607 | ||||
| 1irz_A | 64 | Solution Structure Of Arr10-B Belonging To The Garp | 6e-23 |
| >pdb|1IRZ|A Chain A, Solution Structure Of Arr10-B Belonging To The Garp Family Of Plant Myb-Related Dna Binding Motifs Of The Arabidopsis Response Regulators Length = 64 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 607 | |||
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 6e-30 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 2e-05 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 2e-04 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 3e-04 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 3e-04 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 4e-04 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 8e-04 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 8e-04 |
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 | Back alignment and structure |
|---|
Score = 111 bits (278), Expect = 6e-30
Identities = 47/64 (73%), Positives = 59/64 (92%)
Query: 107 TTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYL 166
T QKKPRV+W+ ELH KF+AAV+ LG+++AVPKKILDLMNV+KLTRENVASHLQK+R+ L
Sbjct: 1 TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVAL 60
Query: 167 KRIS 170
K++S
Sbjct: 61 KKVS 64
|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 607 | |||
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 99.93 | |
| 3to5_A | 134 | CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p | 98.24 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 97.9 | |
| 3f6p_A | 120 | Transcriptional regulatory protein YYCF; unphospho | 97.89 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 97.89 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 97.86 | |
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 97.85 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 97.78 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 97.77 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 97.77 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 97.77 | |
| 2a9o_A | 120 | Response regulator; essential protein, YYCF/YYCG h | 97.77 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 97.77 | |
| 2qzj_A | 136 | Two-component response regulator; 11017X, PSI-II, | 97.76 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 97.75 | |
| 1zh2_A | 121 | KDP operon transcriptional regulatory protein KDPE | 97.75 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 97.74 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 97.74 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 97.74 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 97.73 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 97.72 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 97.71 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 97.71 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 97.7 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 97.7 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 97.67 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 97.67 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 97.66 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 97.66 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 97.65 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 97.64 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 97.64 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 97.63 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 97.63 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 97.63 | |
| 1p6q_A | 129 | CHEY2; chemotaxis, signal transduction, response r | 97.6 | |
| 1dz3_A | 130 | Stage 0 sporulation protein A; response regulator, | 97.6 | |
| 1dcf_A | 136 | ETR1 protein; beta-alpha five sandwich, transferas | 97.59 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 97.59 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 97.59 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 97.58 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 97.56 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 97.56 | |
| 3m6m_D | 143 | Sensory/regulatory protein RPFC; RPFF, REC, enoyl- | 97.56 | |
| 3r0j_A | 250 | Possible two component system response transcript | 97.56 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 97.55 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 97.54 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 97.53 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 97.53 | |
| 2jba_A | 127 | Phosphate regulon transcriptional regulatory PROT; | 97.52 | |
| 1qo0_D | 196 | AMIR; binding protein, gene regulator, receptor; 2 | 97.52 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 97.52 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 97.51 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 97.5 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 97.48 | |
| 1mb3_A | 124 | Cell division response regulator DIVK; signal tran | 97.48 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 97.47 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 97.47 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 97.47 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 97.47 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 97.42 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 97.39 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 97.37 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 97.37 | |
| 1s8n_A | 205 | Putative antiterminator; RV1626, structural genomi | 97.35 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 97.34 | |
| 3ilh_A | 146 | Two component response regulator; NYSGXRC, PSI-II, | 97.34 | |
| 1p2f_A | 220 | Response regulator; DRRB, OMPR/PHOB, transcription | 97.27 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 97.27 | |
| 2jk1_A | 139 | HUPR, hydrogenase transcriptional regulatory prote | 97.25 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 97.24 | |
| 2qvg_A | 143 | Two component response regulator; NYSGXRC, PSI-2, | 97.23 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 97.22 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 97.21 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 97.2 | |
| 2hqr_A | 223 | Putative transcriptional regulator; phosporylation | 97.17 | |
| 2qsj_A | 154 | DNA-binding response regulator, LUXR family; struc | 97.15 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 97.15 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 97.12 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 97.1 | |
| 3c3m_A | 138 | Response regulator receiver protein; structural ge | 97.09 | |
| 3klo_A | 225 | Transcriptional regulator VPST; REC domain, HTH do | 97.09 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 97.07 | |
| 1dc7_A | 124 | NTRC, nitrogen regulation protein; receiver domain | 97.03 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 97.0 | |
| 3bre_A | 358 | Probable two-component response regulator; protein | 96.99 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 96.98 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 96.97 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 96.91 | |
| 3eq2_A | 394 | Probable two-component response regulator; adaptor | 96.87 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 96.86 | |
| 3c3w_A | 225 | Two component transcriptional regulatory protein; | 96.72 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 96.72 | |
| 2lpm_A | 123 | Two-component response regulator; transcription re | 96.3 | |
| 2rdm_A | 132 | Response regulator receiver protein; structural ge | 96.28 | |
| 2j48_A | 119 | Two-component sensor kinase; pseudo-receiver, circ | 96.27 | |
| 3kyj_B | 145 | CHEY6 protein, putative histidine protein kinase; | 95.81 | |
| 3c97_A | 140 | Signal transduction histidine kinase; structural g | 95.81 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 95.8 | |
| 3t8y_A | 164 | CHEB, chemotaxis response regulator protein-glutam | 95.66 | |
| 3sy8_A | 400 | ROCR; TIM barrel phosphodiesterase-A, transcriptio | 95.38 | |
| 2vyc_A | 755 | Biodegradative arginine decarboxylase; pyridoxal p | 95.28 | |
| 1a2o_A | 349 | CHEB methylesterase; bacterial chemotaxis, adaptat | 95.0 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 94.6 | |
| 2b4a_A | 138 | BH3024; flavodoxin-like fold, structural genomics, | 94.08 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 93.79 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 93.62 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 92.52 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 92.51 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 91.08 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 90.81 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 90.22 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 89.86 | |
| 2hzd_A | 82 | Transcriptional enhancer factor TEF-1; DNA-binding | 87.61 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 86.8 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 86.22 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 86.06 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 85.66 |
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
Probab=99.93 E-value=6.8e-27 Score=191.18 Aligned_cols=64 Identities=73% Similarity=1.150 Sum_probs=61.4
Q ss_pred CCCCCCceeccHHHHHHHHHHHHHhCCCCCchHHHHhhcCCCCCCHHHHHHhhhhhhhhhhchh
Q 007341 107 TTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRIS 170 (607)
Q Consensus 107 s~~kKpRlvWT~ELH~kFv~AV~qLG~~kA~Pk~IlelM~v~gLT~enVaSHLQKyR~~Lkr~s 170 (607)
++.+|||++||+|||++||+||++||.++|+||.|+++|+|+|||++||+|||||||++++|++
T Consensus 1 ~~~~k~r~~WT~elH~~Fv~Av~~LG~~~AtPk~Il~~M~v~gLT~~~VkSHLQKYR~~l~r~~ 64 (64)
T 1irz_A 1 TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKKVS 64 (64)
T ss_dssp CCCCCSSCSSCHHHHHHHHHHHHHHCTTTCCHHHHHHHHCCTTCCHHHHHHHHHHHHHHHHSCC
T ss_pred CCCCCCCCcCCHHHHHHHHHHHHHhCCCCCCcHHHHHHcCCCCCCHHHHHHHHHHHHHHHHccC
Confidence 3578999999999999999999999999999999999999999999999999999999999864
|
| >3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A | Back alignment and structure |
|---|
| >3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* | Back alignment and structure |
|---|
| >2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} | Back alignment and structure |
|---|
| >1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 607 | ||||
| d1irza_ | 64 | a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th | 1e-30 | |
| d1ny5a1 | 137 | c.23.1.1 (A:1-137) Transcriptional activator sigm5 | 1e-07 | |
| d1dcfa_ | 134 | c.23.1.2 (A:) Receiver domain of the ethylene rece | 4e-07 | |
| d1zesa1 | 121 | c.23.1.1 (A:3-123) PhoB receiver domain {Escherich | 5e-07 | |
| d1ys7a2 | 121 | c.23.1.1 (A:7-127) Transcriptional regulatory prot | 6e-07 | |
| d1p6qa_ | 129 | c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti | 8e-07 | |
| d1zgza1 | 120 | c.23.1.1 (A:2-121) TorCAD operon transcriptional r | 1e-06 | |
| d2a9pa1 | 117 | c.23.1.1 (A:2-118) DNA-binding response regulator | 1e-06 | |
| d1jbea_ | 128 | c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI | 1e-06 | |
| d2ayxa1 | 133 | c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C | 2e-06 | |
| d1dz3a_ | 123 | c.23.1.1 (A:) Sporulation response regulator Spo0A | 2e-06 | |
| d1a04a2 | 138 | c.23.1.1 (A:5-142) Nitrate/nitrite response regula | 2e-06 | |
| d1xhfa1 | 121 | c.23.1.1 (A:2-122) Aerobic respiration control pro | 3e-06 | |
| d1yioa2 | 128 | c.23.1.1 (A:3-130) Response regulatory protein Sty | 3e-06 | |
| d1dbwa_ | 123 | c.23.1.1 (A:) Transcriptional regulatory protein F | 3e-06 | |
| d1mvoa_ | 121 | c.23.1.1 (A:) PhoP receiver domain {Bacillus subti | 3e-06 | |
| d1p2fa2 | 120 | c.23.1.1 (A:1-120) Response regulator DrrB {Thermo | 3e-06 | |
| d2pl1a1 | 119 | c.23.1.1 (A:1-119) PhoP receiver domain {Escherich | 5e-06 | |
| d1k66a_ | 149 | c.23.1.1 (A:) Response regulator for cyanobacteria | 5e-06 | |
| d1zh2a1 | 119 | c.23.1.1 (A:2-120) Transcriptional regulatory prot | 7e-06 | |
| d1k68a_ | 140 | c.23.1.1 (A:) Response regulator for cyanobacteria | 8e-06 | |
| d1kgsa2 | 122 | c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog | 1e-05 | |
| d2r25b1 | 128 | c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba | 1e-05 | |
| d1mb3a_ | 123 | c.23.1.1 (A:) Cell division response regulator Div | 1e-05 | |
| d1qkka_ | 140 | c.23.1.1 (A:) Transcriptional regulatory protein D | 1e-05 | |
| d1w25a1 | 139 | c.23.1.1 (A:2-140) Response regulator PleD, receiv | 2e-05 | |
| d1krwa_ | 123 | c.23.1.1 (A:) NTRC receiver domain {Salmonella typ | 2e-05 | |
| d1i3ca_ | 144 | c.23.1.1 (A:) Response regulator for cyanobacteria | 3e-05 | |
| d1w25a2 | 153 | c.23.1.1 (A:141-293) Response regulator PleD, rece | 4e-05 | |
| d1u0sy_ | 118 | c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T | 4e-05 | |
| d1peya_ | 119 | c.23.1.1 (A:) Sporulation response regulator Spo0F | 4e-04 | |
| d1s8na_ | 190 | c.23.1.1 (A:) Probable two-component system transc | 0.003 |
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: GARP response regulators domain: Arr10-B species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 111 bits (279), Expect = 1e-30
Identities = 47/64 (73%), Positives = 59/64 (92%)
Query: 107 TTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYL 166
T QKKPRV+W+ ELH KF+AAV+ LG+++AVPKKILDLMNV+KLTRENVASHLQK+R+ L
Sbjct: 1 TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVAL 60
Query: 167 KRIS 170
K++S
Sbjct: 61 KKVS 64
|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 | Back information, alignment and structure |
|---|
| >d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} Length = 128 | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 607 | |||
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 99.9 | |
| d1zh2a1 | 119 | Transcriptional regulatory protein KdpE, N-termina | 98.38 | |
| d2pl1a1 | 119 | PhoP receiver domain {Escherichia coli [TaxId: 562 | 98.36 | |
| d1zgza1 | 120 | TorCAD operon transcriptional regulator TorD, N-te | 98.35 | |
| d1p2fa2 | 120 | Response regulator DrrB {Thermotoga maritima [TaxI | 98.35 | |
| d1xhfa1 | 121 | Aerobic respiration control protein ArcA, N-termin | 98.34 | |
| d2a9pa1 | 117 | DNA-binding response regulator MicA, N-terminal do | 98.34 | |
| d1qkka_ | 140 | Transcriptional regulatory protein DctD, receiver | 98.33 | |
| d1w25a1 | 139 | Response regulator PleD, receiver domain {Caulobac | 98.32 | |
| d1w25a2 | 153 | Response regulator PleD, receiver domain {Caulobac | 98.28 | |
| d1ny5a1 | 137 | Transcriptional activator sigm54 (NtrC1), N-termin | 98.28 | |
| d1kgsa2 | 122 | PhoB receiver domain {Thermotoga maritima [TaxId: | 98.28 | |
| d1zesa1 | 121 | PhoB receiver domain {Escherichia coli [TaxId: 562 | 98.27 | |
| d1ys7a2 | 121 | Transcriptional regulatory protein PrrA, N-termina | 98.21 | |
| d1krwa_ | 123 | NTRC receiver domain {Salmonella typhimurium [TaxI | 98.19 | |
| d1mvoa_ | 121 | PhoP receiver domain {Bacillus subtilis [TaxId: 14 | 98.16 | |
| d1dbwa_ | 123 | Transcriptional regulatory protein FixJ, receiver | 98.15 | |
| d1jbea_ | 128 | CheY protein {Escherichia coli [TaxId: 562]} | 98.14 | |
| d1i3ca_ | 144 | Response regulator for cyanobacterial phytochrome | 98.08 | |
| d1peya_ | 119 | Sporulation response regulator Spo0F {Bacillus sub | 98.06 | |
| d1qo0d_ | 189 | Positive regulator of the amidase operon AmiR {Pse | 98.05 | |
| d1k68a_ | 140 | Response regulator for cyanobacterial phytochrome | 98.04 | |
| d2ayxa1 | 133 | Sensor kinase protein RcsC, C-terminal domain {Esc | 98.04 | |
| d1k66a_ | 149 | Response regulator for cyanobacterial phytochrome | 98.03 | |
| d1yioa2 | 128 | Response regulatory protein StyR, N-terminal domai | 98.03 | |
| d1u0sy_ | 118 | CheY protein {Thermotoga maritima [TaxId: 2336]} | 98.01 | |
| d2r25b1 | 128 | Response regulator Sin1 {Baker's yeast (Saccharomy | 97.99 | |
| d1p6qa_ | 129 | CheY protein {Sinorhizobium meliloti, CheY2 [TaxId | 97.98 | |
| d1s8na_ | 190 | Probable two-component system transcriptional regu | 97.98 | |
| d1dz3a_ | 123 | Sporulation response regulator Spo0A {Bacillus ste | 97.98 | |
| d1mb3a_ | 123 | Cell division response regulator DivK {Caulobacter | 97.94 | |
| d1a04a2 | 138 | Nitrate/nitrite response regulator (NarL), receive | 97.85 | |
| d1dcfa_ | 134 | Receiver domain of the ethylene receptor {Thale cr | 97.83 | |
| d2b4aa1 | 118 | Hypothetical protein BH3024 {Bacillus halodurans [ | 96.36 | |
| d1a2oa1 | 140 | Methylesterase CheB, N-terminal domain {Salmonella | 94.12 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 93.38 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 92.47 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 89.69 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 89.51 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 86.3 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 83.33 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 80.27 |
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: GARP response regulators domain: Arr10-B species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.90 E-value=1.1e-24 Score=176.28 Aligned_cols=64 Identities=73% Similarity=1.150 Sum_probs=61.1
Q ss_pred CCCCCCceeccHHHHHHHHHHHHHhCCCCCchHHHHhhcCCCCCCHHHHHHhhhhhhhhhhchh
Q 007341 107 TTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRIS 170 (607)
Q Consensus 107 s~~kKpRlvWT~ELH~kFv~AV~qLG~~kA~Pk~IlelM~v~gLT~enVaSHLQKyR~~Lkr~s 170 (607)
+..+|||++||+|||++||+||++||.++|+||.|+++|++++||++||+|||||||++++|++
T Consensus 1 s~~kk~R~~WT~elH~~Fv~Av~~lG~~~atpk~I~~~m~v~~lT~~qV~SHlQKYrl~l~k~s 64 (64)
T d1irza_ 1 TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKKVS 64 (64)
T ss_dssp CCCCCSSCSSCHHHHHHHHHHHHHHCTTTCCHHHHHHHHCCTTCCHHHHHHHHHHHHHHHHSCC
T ss_pred CCCCCCCCCCCHHHHHHHHHHHHHhCccccchHHHHHHcCCCCCCHHHHHHHHHHHHHHHHhcC
Confidence 3578999999999999999999999999999999999999999999999999999999999864
|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|