Citrus Sinensis ID: 007341

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------
MFSVLSGNGDPKLVMKGITHGACDYLLKPVRIEELKNIWQHVVRRKKIDAKDQNNSDNQDKPHNGSGQAEGMGNSDQNGKLNKKRKDQNEDEDDEDDEDDHNHEDPTTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISCVANQQANMVAALGSSDPSYLRMSSVNGLGNYHTVGGPGQFQNSTFRSFPASGMLGRLNAPAGLGMHGLPSSGMIPMRHAQNSDNTTNDQGKFHPALLPGSHSGNILQGMPTSLELDQLQLNKNITSISELPNTKDNTTFHVSSGFPDARIGFGRSTNPLLDVNNNPLFLEGHPQEAHSNKMFGNQSLMSLNSGSSSRLPDHGRCNDNWSSAVQSSGIQPNSFSLGGDYKQPTLHPGHLRDNLSTMALPIGNSPCDVSSLHPLSNRFQDPKADLQFQAVQDAPCRSNVMFSPLNSAVSINGDVGPLGQCLDTNKTFFHRSNEFDSLGQSNFVDHFSMKINEVQRSSMQASSNLKEGYLMGQQKTQGSYISTSVDSLEDLFMSSMVKEVRSYNLAFSSCQNAFINSFYTTLTIIVKNLLNLFNCLLLWFRTKRRKFSI
cEEEEEccccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
cEEEEEccccccEEEHHccccHHHHcEccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcHHHHHHHHHHHHHHcccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcHHHccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
mfsvlsgngdpklvMKGIThgacdyllkpvrIEELKNIWQHVVRRKkidakdqnnsdnqdkphngsgqaegmgnsdqngklnkkrkdqnededdeddeddhnhedpttqkkprvVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISCVANQQANMVAAlgssdpsylrmssvnglgnyhtvggpgqfqnstfrsfpasgmlgrlnapaglgmhglpssgmipmrhaqnsdnttndqgkfhpallpgshsgnilqgmptslELDQLQLNKNItsiselpntkdnttfhvssgfpdarigfgrstnplldvnnnplfleghpqeahsnkmfgnqslmslnsgsssrlpdhgrcndnwssavqssgiqpnsfslggdykqptlhpghlrdnlstmalpignspcdvsslhplsnrfqdpkadlqfqavqdapcrsnvmfsplnsavsingdvgplgqcldtnktffhrsnefdslgqsnfvdhFSMKINEVQRSSMQassnlkegylmgqqktqgsyistsVDSLEDLFMSSMVKEVRSYNLAFSSCQNAFINSFYTTLTIIVKNLLNLFNCLLLWFRTKRRKFSI
mfsvlsgngdpklVMKGITHGACDYLLKPVRIEELKNIWQHVVRrkkidakdqnnsdnqdkphngsgqaegmgnsdqngklnkkrkdqnededdeddeddhnhedpttqkkprvvwSVELHRKFVAAvnqlgidkavpKKILDLMNVEKLTRENVASHLQKYRLYLKRISCVANQQANMVAALGSSDPSYLRMSSVNGLGNYHTVGGPGQFQNSTFRSFPASGMLGRLNAPAGLGMHGLPSSGMIPMRHAQNSDNTTNDQGKFHPALLPGSHSGNILQGMPTSLELDQLQLNKNITSiselpntkdNTTFHVSSGFPDARIGFGRSTNPLLDVNNNPLFLEGHPQEAHSNKMFGNQSLMSLNSGSSSRLPDHGRCNDNWSSAVQSSGIQPNSFSLGGDYKQPTLHPGHLRDNLSTMALPIGNSPCDVSSLHPLSNRFQDPKADLQFQAVQDAPCRSNVMFSPLNSAVSINGDVGPLGQCLDTNKTFFHRSNEFDSLGQSNFVDHFSMKINEVQRSSMQASSNLKEGYLMGQQKTQGSYISTSVDSLEDLFMSSMVKEVRSYNLAFSSCQNAFINSFYTTLTIIVKNLLNLFNCLllwfrtkrrkfsi
MFSVLSGNGDPKLVMKGITHGACDYLLKPVRIEELKNIWQHVVRRKKIDAKDQNNSDNQDKPHNGSGQAEGMGNSDQNGKLNKKRKDQnededdeddeddhnhedPTTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISCVANQQANMVAALGSSDPSYLRMSSVNGLGNYHTVGGPGQFQNSTFRSFPASGMLGRLNAPAGLGMHGLPSSGMIPMRHAQNSDNTTNDQGKFHPALLPGSHSGNILQGMPTSLELDQLQLNKNITSISELPNTKDNTTFHVSSGFPDARIGFGRSTNPLLDVNNNPLFLEGHPQEAHSNKMFGNQslmslnsgsssrlPDHGRCNDNWSSAVQSSGIQPNSFSLGGDYKQPTLHPGHLRDNLSTMALPIGNSPCDVSSLHPLSNRFQDPKADLQFQAVQDAPCRSNVMFSPLNSAVSINGDVGPLGQCLDTNKTFFHRSNEFDSLGQSNFVDHFSMKINEVQRSSMQASSNLKEGYLMGQQKTQGSYISTSVDSLEDLFMSSMVKEVRSYNLAFSSCQNAFINSFYTTLTIIVKnllnlfnclllWFRTKRRKFSI
************LVMKGITHGACDYLLKPVRIEELKNIWQHVVRR*******************************************************************RVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISCVANQQANMVAALG*****YLRMSSVNGLGNYHTVGG************************************************************************************************************FPDARIGFGR*TNPLLDVN***************************************************************************************************************FQAVQDAPCRSNVMFSPLNSAVSINGDVGPLGQCLDTNKTFFHRSNEFDSLGQSNFVDHFS********************************ISTSVDSLEDLFMSSMVKEVRSYNLAFSSCQNAFINSFYTTLTIIVKNLLNLFNCLLLWFRT*******
MFSVLS*NGDPKLVMKGITHGACDYLLKPVRIEELKNIWQHVVRRKK*******************************************************************VWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYR******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************SVDSLEDLFMSSM*************CQNAFINSFYTTLTIIVKNLLNLFNCLLLWFRTKRRKF**
MFSVLSGNGDPKLVMKGITHGACDYLLKPVRIEELKNIWQHVVRRKKIDAK***********************************************************KPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISCVANQQANMVAALGSSDPSYLRMSSVNGLGNYHTVGGPGQFQNSTFRSFPASGMLGRLNAPAGLGMHGLPSSGMIPMRHAQNSDNTTNDQGKFHPALLPGSHSGNILQGMPTSLELDQLQLNKNITSISELPNTKDNTTFHVSSGFPDARIGFGRSTNPLLDVNNNPLFLEGHPQEAHSNKMFGNQSLMSLN*********HGRCNDNWSSAVQSSGIQPNSFSLGGDYKQPTLHPGHLRDNLSTMALPIGNSPCDVSSLHPLSNRFQDPKADLQFQAVQDAPCRSNVMFSPLNSAVSINGDVGPLGQCLDTNKTFFHRSNEFDSLGQSNFVDHFSMKINEVQRSSMQASSNLKEGYLMGQQKTQGSYISTSVDSLEDLFMSSMVKEVRSYNLAFSSCQNAFINSFYTTLTIIVKNLLNLFNCLLLWFRTKRRKFSI
MFSVLSGNGDPKLVMKGITHGACDYLLKPVRIEELKNIWQHVVRRKKI*************************************************************KKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISCV************************NGLGNYHTVGGPGQFQNSTFRSFPASGMLGRLNAPAGLGMHGLPSSGMIPMRHAQNSDNTTNDQGKFHPALLPGSHSGNILQGMPTSLELDQLQL********ELPNTKDNTTFHVSSGFPDARIGFGRSTNPL*DVNNNP*FLEGHPQEAHSNKMFGNQSLMSLNSGSSSRLPDHGRCNDNWSSAV******P*****************************IGNSPCDVSS***********KADLQFQAVQDAPCRSNVMFSPLNSAVSINGDVGPLGQCLDTNKTFFHRSNEFDS**QSNFVDH*****************************TQGSYISTSVDSLEDLFMSSMVKEVRSYNLAFSSCQNAFINSFYTTLTIIVKNLLNLFNCLLLWFRTKRR****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSVLSGNGDPKLVMKGITHGACDYLLKPVRIEELKNIWQHVVRRKKIDAKDQNNSDNQDKPHNGSGQAEGMGNSDQNGKLNKKRKDQNEDEDDEDDEDDHNHEDPTTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISCVANQQANMVAALGSSDPSYLRMSSVNGLGNYHTVGGPGQFQNSTFRSFPASGMLGRLNAPAGLGMHGLPSSGMIPMRHAQNSDNTTNDQGKFHPALLPGSHSGNILQGMPTSLELDQLQLNKNITSISELPNTKDNTTFHVSSGFPDARIGFGRSTNPLLDVNNNPLFLEGHPQEAHSNKMFGNQSLMSLNSGSSSRLPDHGRCNDNWSSAVQSSGIQPNSFSLGGDYKQPTLHPGHLRDNLSTMALPIGNSPCDVSSLHPLSNRFQDPKADLQFQAVQDAPCRSNVMFSPLNSAVSINGDVGPLGQCLDTNKTFFHRSNEFDSLGQSNFVDHFSMKINEVQRSSMQASSNLKEGYLMGQQKTQGSYISTSVDSLEDLFMSSMVKEVRSYNLAFSSCQNAFINSFYTTLTIIVKNLLNLFNCLLLWFRTKRRKFSI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query607 2.2.26 [Sep-21-2011]
P62598596 Two-component response re yes no 0.764 0.778 0.429 3e-81
O49397552 Two-component response re no no 0.675 0.742 0.363 1e-59
Q9FGT7635 Two-component response re no no 0.586 0.560 0.375 5e-53
Q9ZWJ9664 Two-component response re no no 0.448 0.409 0.414 2e-51
Q940D0690 Two-component response re no no 0.448 0.394 0.410 1e-48
Q8L9Y3382 Two-component response re no no 0.388 0.617 0.433 3e-39
Q9FXD6521 Two-component response re no no 0.257 0.299 0.502 6e-35
Q7Y0W3341 Two-component response re N/A no 0.271 0.483 0.458 9e-32
Q7Y0W5341 Two-component response re no no 0.271 0.483 0.458 1e-31
Q9FJ16292 Putative two-component re no no 0.250 0.520 0.389 7e-23
>sp|P62598|ARR12_ARATH Two-component response regulator ARR12 OS=Arabidopsis thaliana GN=ARR12 PE=2 SV=2 Back     alignment and function desciption
 Score =  303 bits (775), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 245/570 (42%), Positives = 317/570 (55%), Gaps = 106/570 (18%)

Query: 4   VLSGNGDPKLVMKGITHGACDYLLKPVRIEELKNIWQHVVRRKKIDAKDQNNSDNQDKPH 63
           +LS + DPK VMKG+THGACDYLLKPVRIEELKNIWQHVVR  + D K++ +++N DK  
Sbjct: 94  MLSAHSDPKYVMKGVTHGACDYLLKPVRIEELKNIWQHVVR-SRFD-KNRGSNNNGDK-R 150

Query: 64  NGSGQAEGMGNSDQN-GKLNKKRKDQNEDEDDEDDEDDHNHEDPTTQKKPRVVWSVELHR 122
           +GSG  EG+GNSDQN GK N+KRKDQ  +++DED +D+   +D   QKK RVVW+VELH+
Sbjct: 151 DGSGN-EGVGNSDQNNGKGNRKRKDQYNEDEDEDRDDN---DDSCAQKKQRVVWTVELHK 206

Query: 123 KFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISCVANQQANMVAA 182
           KFVAAVNQLG +KA+PKKILDLMNVEKLTRENVASHLQK+RLYLKRIS VANQQA M   
Sbjct: 207 KFVAAVNQLGYEKAMPKKILDLMNVEKLTRENVASHLQKFRLYLKRISGVANQQAIM--- 263

Query: 183 LGSSDPSYLRMSSVNGLGNYHTVGGPGQFQNS--TFRSFPASGMLGRLNAPAGLGMHGL- 239
             +S+  +++M+ ++G  +     G GQ+       RSFP +G+LGRLN P+G+G+  L 
Sbjct: 264 -ANSELHFMQMNGLDGFHHRPIPVGSGQYHGGAPAMRSFPPNGILGRLNTPSGIGVRSLS 322

Query: 240 -PSSGMIPMRHAQNSDNTTNDQGKF-HPALLPGSHS--GNILQGMPTSLELDQLQLNKNI 295
            P +GM      QN      D GKF H + LP +HS  GNILQG+P  LE DQLQ N N 
Sbjct: 323 SPPAGMF----LQNQ----TDIGKFHHVSSLPLNHSDGGNILQGLPMPLEFDQLQTNNNK 374

Query: 296 TSISELPNTKDNTTFH-VSSGFPDARIGFGRSTNPLLDV-NNNPLFLEGHPQEAHSNKMF 353
           +      N   N +    S  FP     F    N L+   NNN + LEGHPQ        
Sbjct: 375 SR-----NMNSNKSIAGTSMAFPS----FSTQQNSLISAPNNNVVVLEGHPQ-------- 417

Query: 354 GNQSLMSLNSGSSSRLPDH--GRCNDNWSSAVQSSGIQPNSFSLGGDYKQPTLHPGHLRD 411
                      +    P H   +  ++WS+AV SS   P               P H  +
Sbjct: 418 ----------ATPPGFPGHQINKRLEHWSNAVSSSTHPP--------------PPAHNSN 453

Query: 412 NLSTMALPIGNSPCDVSSLHPLSNRFQDPKADLQFQAVQDAP-CRS-NVMFSPLNSAVSI 469
           ++        N   DVS   PL +   DP       +    P C S N + SP       
Sbjct: 454 SI--------NHQFDVS---PLPHSRPDPLEWNNVSSSYSIPFCDSANTLSSP------- 495

Query: 470 NGDVGPLGQCLD-TNKTFFHRSNEFDSLGQSNFVDHFSMKINEVQRSSMQASSNLKEGYL 528
                     LD TN   F R+ +FDS   +  V             ++ +SSN KEG++
Sbjct: 496 ---------ALDTTNPRAFCRNTDFDS---NTNVQPGVFYGPSTDAMALLSSSNPKEGFV 543

Query: 529 MGQQKTQ-GSYISTSVDSLEDLFMSSMVKE 557
           +GQQK Q G ++     SL+D+  S+M +E
Sbjct: 544 VGQQKLQSGGFMVADAGSLDDIVNSTMKQE 573
Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins.
Arabidopsis thaliana (taxid: 3702)
>sp|O49397|ARR10_ARATH Two-component response regulator ARR10 OS=Arabidopsis thaliana GN=ARR10 PE=1 SV=1 Back     alignment and function description
>sp|Q9FGT7|ARR18_ARATH Two-component response regulator ARR18 OS=Arabidopsis thaliana GN=ARR18 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZWJ9|ARR2_ARATH Two-component response regulator ARR2 OS=Arabidopsis thaliana GN=ARR2 PE=1 SV=1 Back     alignment and function description
>sp|Q940D0|ARR1_ARATH Two-component response regulator ARR1 OS=Arabidopsis thaliana GN=ARR1 PE=1 SV=2 Back     alignment and function description
>sp|Q8L9Y3|ARR14_ARATH Two-component response regulator ARR14 OS=Arabidopsis thaliana GN=ARR14 PE=1 SV=2 Back     alignment and function description
>sp|Q9FXD6|ARR11_ARATH Two-component response regulator ARR11 OS=Arabidopsis thaliana GN=ARR11 PE=1 SV=1 Back     alignment and function description
>sp|Q7Y0W3|EHD1_ORYSI Two-component response regulator EHD1 OS=Oryza sativa subsp. indica PE=2 SV=1 Back     alignment and function description
>sp|Q7Y0W5|EHD1_ORYSJ Two-component response regulator EHD1 OS=Oryza sativa subsp. japonica GN=EHD1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJ16|APRR4_ARATH Putative two-component response regulator-like APRR4 OS=Arabidopsis thaliana GN=APRR4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query607
255548782663 two-component system sensor histidine ki 0.896 0.820 0.593 1e-172
225430376693 PREDICTED: two-component response regula 0.907 0.795 0.563 1e-162
147863919693 hypothetical protein VITISV_010435 [Viti 0.907 0.795 0.564 1e-162
298103726668 putative B-type response regulator 22 [P 0.886 0.805 0.579 1e-159
224141943661 type-b response regulator [Populus trich 0.876 0.804 0.573 1e-153
296082079667 unnamed protein product [Vitis vinifera] 0.864 0.787 0.532 1e-148
449455539688 PREDICTED: two-component response regula 0.897 0.792 0.499 1e-141
449485185688 PREDICTED: LOW QUALITY PROTEIN: two-comp 0.897 0.792 0.499 1e-141
147787458706 hypothetical protein VITISV_005486 [Viti 0.911 0.783 0.5 1e-140
359484783 712 PREDICTED: two-component response regula 0.907 0.773 0.5 1e-139
>gi|255548782|ref|XP_002515447.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] gi|223545391|gb|EEF46896.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  611 bits (1575), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 344/580 (59%), Positives = 407/580 (70%), Gaps = 36/580 (6%)

Query: 4   VLSGNGDPKLVMKGITHGACDYLLKPVRIEELKNIWQHVVRRKKIDAKDQNNSDNQDKPH 63
           +LS   DPKLVMKGITHGACDYLLKPVRIEELKNIWQHV+RRKK+D KDQNN DNQDK  
Sbjct: 95  MLSAYSDPKLVMKGITHGACDYLLKPVRIEELKNIWQHVIRRKKVDNKDQNNFDNQDKLP 154

Query: 64  NGSGQAEGMGNSDQNGKLNKKRKDQNEDEDDEDDEDDHNHEDPTTQKKPRVVWSVELHRK 123
            GSG+A     +DQ  KLNKKRKDQNEDED++ DE  H +EDPTTQKKPRVVWSVELHRK
Sbjct: 155 RGSGEA----TADQ--KLNKKRKDQNEDEDEDRDEHGHENEDPTTQKKPRVVWSVELHRK 208

Query: 124 FVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISCVANQQANMVAAL 183
           FVAAVNQLG+DKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRIS VANQQANMVAAL
Sbjct: 209 FVAAVNQLGVDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISTVANQQANMVAAL 268

Query: 184 GSSDPSYLRMSSVNGLGNYHTVGGPGQFQNSTFRSFPASGMLGRLNAPAGLGMHGLPSSG 243
           GSSD SYL+M S  GLG +  + G GQF N+TFR  P SGMLGRLN+PAGLGM GLPS G
Sbjct: 269 GSSDASYLQMGS--GLG-FQGIAGAGQFHNATFRPLPPSGMLGRLNSPAGLGMRGLPSPG 325

Query: 244 MIPMRHAQNSDNTTNDQGKFHPALLPGSHSGNILQGMPTSLELDQLQLNKNITSISELP- 302
           +I +   Q + +++N+Q  F  A+ PG ++GN+LQGMPTSLELDQ+Q NK +T I ELP 
Sbjct: 326 VIQLGQLQGTGHSSNNQSHFQMAVHPG-NAGNVLQGMPTSLELDQIQSNKGVTYIRELPT 384

Query: 303 NTKDNTTFHVSSGFPDARIGFGRSTNPLLDVNNNPLFLEGHPQEAHSNKMFGNQS---LM 359
           +  D T F VS GF D +I  G S +  L  +N PL LEG+ Q A   K FG  S   + 
Sbjct: 385 DINDATAFSVSGGFSDTKIMVGSSNSSFLGASNKPLMLEGNTQGAQDGKEFGKHSSLTVA 444

Query: 360 SLNSGSSSRLPDHGRCNDNWSSAVQSSGIQPNSFSLGGDYKQPTLHPGHLRDNLSTMALP 419
           SL+SG SS LPD GRCNDNWSSAVQS+G+Q  SF+L   ++Q TLHP + RD++STM L 
Sbjct: 445 SLDSGFSSHLPDPGRCNDNWSSAVQSNGVQSTSFALNDCFRQTTLHPNNSRDSMSTMGLQ 504

Query: 420 IGNSPCDVSSLHPLSNRFQDPKADLQFQAV---------------------QDAPCRSNV 458
            GN+  D+SS+  L    Q+ KADLQ Q                       QD+   SN 
Sbjct: 505 NGNNAPDISSISTLPIHLQESKADLQCQITSIRSNAGQIINNAPQGWDDQRQDSMYHSNA 564

Query: 459 MFSPLNSAVSINGDVGPLGQCLDTNKTFFHRSNEFDSLGQSNFVDHFSMKINEVQRSSMQ 518
           + S +N+A  I G    +G  LD   T FHR+  F+S  Q+NF+D   MK N+V+  SM+
Sbjct: 565 VHSSVNTANPIPGTGTLMGHSLDPKNTIFHRTTSFNSTRQTNFIDMPLMKHNDVENLSME 624

Query: 519 ASSNLKEGYLMGQQKTQGSYISTSVDSLEDLFMSSMVKEV 558
                 EGY+M QQK Q SY+S +  SLEDL  + MVK+V
Sbjct: 625 ILMRSNEGYVMAQQKLQSSYVSDNFGSLEDL-ANVMVKQV 663

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225430376|ref|XP_002282928.1| PREDICTED: two-component response regulator ARR12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147863919|emb|CAN81109.1| hypothetical protein VITISV_010435 [Vitis vinifera] Back     alignment and taxonomy information
>gi|298103726|emb|CBM42564.1| putative B-type response regulator 22 [Populus x canadensis] Back     alignment and taxonomy information
>gi|224141943|ref|XP_002324320.1| type-b response regulator [Populus trichocarpa] gi|222865754|gb|EEF02885.1| type-b response regulator [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296082079|emb|CBI21084.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449455539|ref|XP_004145510.1| PREDICTED: two-component response regulator ARR12-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449485185|ref|XP_004157093.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator ARR12-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147787458|emb|CAN60088.1| hypothetical protein VITISV_005486 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359484783|ref|XP_002270833.2| PREDICTED: two-component response regulator ARR12-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query607
TAIR|locus:2040194596 RR12 "response regulator 12" [ 0.517 0.526 0.531 1.9e-85
TAIR|locus:2116587552 RR10 "response regulator 10" [ 0.436 0.480 0.393 2.1e-58
TAIR|locus:2130095664 RR2 "response regulator 2" [Ar 0.457 0.418 0.393 1.2e-47
TAIR|locus:2093668690 RR1 "response regulator 1" [Ar 0.469 0.413 0.391 1.8e-46
TAIR|locus:2065398382 RR14 "response regulator 14" [ 0.420 0.667 0.4 4.8e-39
TAIR|locus:2008585521 ARR11 "response regulator 11" 0.266 0.310 0.497 2.4e-35
UNIPROTKB|Q7Y0W3341 Q7Y0W3 "Two-component response 0.095 0.170 0.672 2.9e-27
UNIPROTKB|Q7Y0W5341 EHD1 "Two-component response r 0.095 0.170 0.672 2.9e-27
TAIR|locus:2155954292 APRR4 "pseudo-response regulat 0.250 0.520 0.345 2.5e-19
TAIR|locus:2148348298 BOA "AT5G59570" [Arabidopsis t 0.113 0.231 0.637 3.1e-18
TAIR|locus:2040194 RR12 "response regulator 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 779 (279.3 bits), Expect = 1.9e-85, Sum P(2) = 1.9e-85
 Identities = 187/352 (53%), Positives = 227/352 (64%)

Query:     4 VLSGNGDPKLVMKGITHGACDYLLKPVRIEELKNIWQHVVRRKKIDAKDQNNSDNQDKPH 63
             +LS + DPK VMKG+THGACDYLLKPVRIEELKNIWQHVVR  + D K++ +++N DK  
Sbjct:    94 MLSAHSDPKYVMKGVTHGACDYLLKPVRIEELKNIWQHVVR-SRFD-KNRGSNNNGDK-R 150

Query:    64 NGSGQAEGMGNSDQN-GKLNKKRKDQXXXXXXXXXXXXXXXXXPTTQKKPRVVWSVELHR 122
             +GSG  EG+GNSDQN GK N+KRKDQ                    QKK RVVW+VELH+
Sbjct:   151 DGSGN-EGVGNSDQNNGKGNRKRKDQYNEDEDEDRDDNDDS---CAQKKQRVVWTVELHK 206

Query:   123 KFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISCVANQQANMVAA 182
             KFVAAVNQLG +KA+PKKILDLMNVEKLTRENVASHLQK+RLYLKRIS VANQQA M   
Sbjct:   207 KFVAAVNQLGYEKAMPKKILDLMNVEKLTRENVASHLQKFRLYLKRISGVANQQAIMA-- 264

Query:   183 LGSSDPSYLRMSSVNGLGNYHTVGGPGQFQNST--FRSFPASGMLGRLNAPAGLGMHGL- 239
               +S+  +++M+ ++G  +     G GQ+       RSFP +G+LGRLN P+G+G+  L 
Sbjct:   265 --NSELHFMQMNGLDGFHHRPIPVGSGQYHGGAPAMRSFPPNGILGRLNTPSGIGVRSLS 322

Query:   240 -PSSGMIPMRHAQNSDNTTNDQGKFHP-ALLPGSHS--GNILQGMPTSLELDQLQLNKNI 295
              P +GM      QN      D GKFH  + LP +HS  GNILQG+P  LE DQLQ N N 
Sbjct:   323 SPPAGMF----LQNQ----TDIGKFHHVSSLPLNHSDGGNILQGLPMPLEFDQLQTNNNK 374

Query:   296 TSISELPNTKDNTTFH-VSSGFPDARIGFGRSTNPLLDV-NNNPLFLEGHPQ 345
             +      N   N +    S  FP     F    N L+   NNN + LEGHPQ
Sbjct:   375 SR-----NMNSNKSIAGTSMAFPS----FSTQQNSLISAPNNNVVVLEGHPQ 417
GO:0000156 "phosphorelay response regulator activity" evidence=IEA;ISS
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009736 "cytokinin mediated signaling pathway" evidence=IGI;TAS
GO:0009735 "response to cytokinin stimulus" evidence=IGI
GO:0010380 "regulation of chlorophyll biosynthetic process" evidence=IGI
GO:0031537 "regulation of anthocyanin metabolic process" evidence=IGI
GO:0048367 "shoot system development" evidence=IGI
GO:0080022 "primary root development" evidence=IGI
TAIR|locus:2116587 RR10 "response regulator 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130095 RR2 "response regulator 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093668 RR1 "response regulator 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065398 RR14 "response regulator 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008585 ARR11 "response regulator 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Y0W3 Q7Y0W3 "Two-component response regulator EHD1" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Y0W5 EHD1 "Two-component response regulator EHD1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2155954 APRR4 "pseudo-response regulator 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148348 BOA "AT5G59570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query607
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 2e-22
PLN03162526 PLN03162, PLN03162, golden-2 like transcription fa 3e-16
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 5e-06
cd00156113 cd00156, REC, Signal receiver domain; originally t 1e-04
COG4753475 COG4753, COG4753, Response regulator containing Ch 2e-04
pfam00072111 pfam00072, Response_reg, Response regulator receiv 0.001
COG0784130 COG0784, CheY, FOG: CheY-like receiver [Signal tra 0.003
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
 Score = 90.2 bits (224), Expect = 2e-22
 Identities = 35/55 (63%), Positives = 44/55 (80%), Gaps = 1/55 (1%)

Query: 111 KPRVVWSVELHRKFVAAVNQLGI-DKAVPKKILDLMNVEKLTRENVASHLQKYRL 164
           KPRVVW+ +LH +F+ AV +LG  D A PK+IL+LM V+ LTR+ VASHLQKYRL
Sbjct: 1   KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRL 55

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57
>gnl|CDD|178707 PLN03162, PLN03162, golden-2 like transcription factor; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>gnl|CDD|227095 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information
>gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 607
PLN03162526 golden-2 like transcription factor; Provisional 99.86
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.73
COG0745229 OmpR Response regulators consisting of a CheY-like 98.28
COG4565224 CitB Response regulator of citrate/malate metaboli 97.68
COG4566202 TtrR Response regulator [Signal transduction mecha 97.67
COG2204464 AtoC Response regulator containing CheY-like recei 97.62
PRK10046225 dpiA two-component response regulator DpiA; Provis 97.5
PF00072112 Response_reg: Response regulator receiver domain; 97.43
PRK10529225 DNA-binding transcriptional activator KdpE; Provis 97.04
PRK11173237 two-component response regulator; Provisional 96.98
PRK10766221 DNA-binding transcriptional regulator TorR; Provis 96.97
TIGR03787227 marine_sort_RR proteobacterial dedicated sortase s 96.96
PRK10816223 DNA-binding transcriptional regulator PhoP; Provis 96.94
PRK09836227 DNA-binding transcriptional activator CusR; Provis 96.93
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 96.85
PRK10643222 DNA-binding transcriptional regulator BasR; Provis 96.84
PRK10161229 transcriptional regulator PhoB; Provisional 96.81
PRK09468239 ompR osmolarity response regulator; Provisional 96.77
PRK10336219 DNA-binding transcriptional regulator QseB; Provis 96.76
PLN03029222 type-a response regulator protein; Provisional 96.69
TIGR01387218 cztR_silR_copR heavy metal response regulator. Mem 96.66
PRK10955232 DNA-binding transcriptional regulator CpxR; Provis 96.65
CHL00148240 orf27 Ycf27; Reviewed 96.64
PRK11517223 transcriptional regulatory protein YedW; Provision 96.63
PRK10701240 DNA-binding transcriptional regulator RstA; Provis 96.61
TIGR02154226 PhoB phosphate regulon transcriptional regulatory 96.61
PRK11083228 DNA-binding response regulator CreB; Provisional 96.56
PRK13856241 two-component response regulator VirG; Provisional 96.56
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 96.53
COG4753475 Response regulator containing CheY-like receiver d 96.46
PRK09581457 pleD response regulator PleD; Reviewed 96.43
PRK10430239 DNA-binding transcriptional activator DcuR; Provis 96.41
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 96.41
PRK10693303 response regulator of RpoS; Provisional 96.4
COG4567182 Response regulator consisting of a CheY-like recei 96.38
PRK10840216 transcriptional regulator RcsB; Provisional 96.35
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 96.32
PRK10610129 chemotaxis regulatory protein CheY; Provisional 96.25
PRK09935210 transcriptional regulator FimZ; Provisional 96.22
PRK15479221 transcriptional regulatory protein TctD; Provision 96.15
COG3437360 Response regulator containing a CheY-like receiver 96.15
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 96.05
TIGR02875262 spore_0_A sporulation transcription factor Spo0A. 96.01
COG3706435 PleD Response regulator containing a CheY-like rec 95.87
COG3707194 AmiR Response regulator with putative antiterminat 95.85
PRK10710240 DNA-binding transcriptional regulator BaeR; Provis 95.79
PRK09483217 response regulator; Provisional 95.74
PRK09581457 pleD response regulator PleD; Reviewed 95.69
COG2197211 CitB Response regulator containing a CheY-like rec 95.5
PRK15369211 two component system sensor kinase SsrB; Provision 95.27
PRK10403215 transcriptional regulator NarP; Provisional 95.14
COG0784130 CheY FOG: CheY-like receiver [Signal transduction 95.08
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 95.05
PRK13435145 response regulator; Provisional 95.01
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 94.85
PRK10651216 transcriptional regulator NarL; Provisional 94.83
PRK15115444 response regulator GlrR; Provisional 94.81
PRK11107919 hybrid sensory histidine kinase BarA; Provisional 94.73
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 94.65
PRK15347921 two component system sensor kinase SsrA; Provision 94.47
PRK11697238 putative two-component response-regulatory protein 94.44
PRK10365441 transcriptional regulatory protein ZraR; Provision 94.36
PRK14084246 two-component response regulator; Provisional 94.35
PRK09390202 fixJ response regulator FixJ; Provisional 94.14
cd00156113 REC Signal receiver domain; originally thought to 94.12
PRK11466914 hybrid sensory histidine kinase TorS; Provisional 93.8
TIGR02956968 TMAO_torS TMAO reductase sytem sensor TorS. This p 93.67
PRK099591197 hybrid sensory histidine kinase in two-component r 92.92
PRK12555337 chemotaxis-specific methylesterase; Provisional 90.52
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 90.14
PRK11091779 aerobic respiration control sensor protein ArcB; P 89.84
smart0042668 TEA TEA domain. 89.8
PRK13558665 bacterio-opsin activator; Provisional 88.51
PRK00742354 chemotaxis-specific methylesterase; Provisional 87.62
COG3947361 Response regulator containing CheY-like receiver a 86.11
TIGR03815322 CpaE_hom_Actino helicase/secretion neighborhood Cp 85.13
PF01285431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 83.08
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information 
Probab=99.86  E-value=5.5e-22  Score=206.75  Aligned_cols=66  Identities=53%  Similarity=0.866  Sum_probs=62.4

Q ss_pred             CCCCCCCceeccHHHHHHHHHHHHHhCCCCCchHHHHhhcCCCCCCHHHHHHhhhhhhhhhhchhh
Q 007341          106 PTTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRISC  171 (607)
Q Consensus       106 ~s~~kKpRlvWT~ELH~kFv~AV~qLG~~kA~Pk~IlelM~v~gLT~enVaSHLQKyR~~Lkr~s~  171 (607)
                      ....||+|++||+|||++||+||++||++||+||+||++|+|+|||++||||||||||+++|++..
T Consensus       230 ~~g~KKpRLrWTpELH~rFVeAV~qLG~dKATPK~ILelMnV~GLTRenVKSHLQKYRl~rk~l~~  295 (526)
T PLN03162        230 APGKKKAKVDWTPELHRRFVHAVEQLGVEKAFPSRILELMGVQCLTRHNIASHLQKYRSHRRHLAA  295 (526)
T ss_pred             CCCCCCCcccCCHHHHHHHHHHHHHhCcCccchHHHHHHcCCCCcCHHHHHHHHHHHHHhcccccc
Confidence            345789999999999999999999999999999999999999999999999999999999998754

>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PLN03029 type-a response regulator protein; Provisional Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK14084 two-component response regulator; Provisional Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query607
1irz_A64 Solution Structure Of Arr10-B Belonging To The Garp 6e-23
>pdb|1IRZ|A Chain A, Solution Structure Of Arr10-B Belonging To The Garp Family Of Plant Myb-Related Dna Binding Motifs Of The Arabidopsis Response Regulators Length = 64 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (263), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 59/64 (92%)
Query: 107 TTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYL 166
           T QKKPRV+W+ ELH KF+AAV+ LG+++AVPKKILDLMNV+KLTRENVASHLQK+R+ L
Sbjct: 1   TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVAL 60
Query: 167 KRIS 170
           K++S
Sbjct: 61  KKVS 64

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query607
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 6e-30
3hdg_A137 Uncharacterized protein; two-component sensor acti 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 2e-05
3cg0_A140 Response regulator receiver modulated diguanylate 2e-04
4dad_A146 Putative pilus assembly-related protein; response 3e-04
3rqi_A184 Response regulator protein; structural genomics, s 3e-04
1yio_A208 Response regulatory protein; transcription regulat 4e-04
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 8e-04
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 8e-04
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
 Score =  111 bits (278), Expect = 6e-30
 Identities = 47/64 (73%), Positives = 59/64 (92%)

Query: 107 TTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYL 166
           T QKKPRV+W+ ELH KF+AAV+ LG+++AVPKKILDLMNV+KLTRENVASHLQK+R+ L
Sbjct: 1   TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVAL 60

Query: 167 KRIS 170
           K++S
Sbjct: 61  KKVS 64
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query607
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.93
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 98.24
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 97.9
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 97.89
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 97.89
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 97.86
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 97.85
3jte_A143 Response regulator receiver protein; structural ge 97.78
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 97.77
3cfy_A137 Putative LUXO repressor protein; structural genomi 97.77
3kto_A136 Response regulator receiver protein; PSI-II,struct 97.77
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 97.77
1zgz_A122 Torcad operon transcriptional regulatory protein; 97.77
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 97.76
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 97.75
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 97.75
3crn_A132 Response regulator receiver domain protein, CHEY-; 97.74
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 97.74
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 97.74
3lua_A140 Response regulator receiver protein; two-component 97.73
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 97.72
4dad_A146 Putative pilus assembly-related protein; response 97.71
2zay_A147 Response regulator receiver protein; structural ge 97.71
1xhf_A123 DYE resistance, aerobic respiration control protei 97.7
3snk_A135 Response regulator CHEY-like protein; P-loop conta 97.7
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 97.67
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 97.67
3gt7_A154 Sensor protein; structural genomics, signal receiv 97.66
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 97.66
3cg0_A140 Response regulator receiver modulated diguanylate 97.65
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 97.64
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 97.64
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 97.63
3hdg_A137 Uncharacterized protein; two-component sensor acti 97.63
3cnb_A143 DNA-binding response regulator, MERR family; signa 97.63
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 97.6
1dz3_A130 Stage 0 sporulation protein A; response regulator, 97.6
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 97.59
3heb_A152 Response regulator receiver domain protein (CHEY); 97.59
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 97.59
3n53_A140 Response regulator receiver modulated diguanylate; 97.58
3rqi_A184 Response regulator protein; structural genomics, s 97.56
3eul_A152 Possible nitrate/nitrite response transcriptional 97.56
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 97.56
3r0j_A250 Possible two component system response transcript 97.56
1srr_A124 SPO0F, sporulation response regulatory protein; as 97.55
3hdv_A136 Response regulator; PSI-II, structural genomics, P 97.54
2pln_A137 HP1043, response regulator; signaling protein; 1.8 97.53
3nhm_A133 Response regulator; protein structure initiative I 97.53
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 97.52
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 97.52
2qxy_A142 Response regulator; regulation of transcription, N 97.52
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 97.51
3h5i_A140 Response regulator/sensory box protein/ggdef domai 97.5
3f6c_A134 Positive transcription regulator EVGA; structural 97.48
1mb3_A124 Cell division response regulator DIVK; signal tran 97.48
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 97.47
2rjn_A154 Response regulator receiver:metal-dependent phosph 97.47
2qr3_A140 Two-component system response regulator; structura 97.47
1mvo_A136 PHOP response regulator; phosphate regulon, transc 97.47
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 97.42
3grc_A140 Sensor protein, kinase; protein structure initiati 97.39
3q9s_A249 DNA-binding response regulator; DNA binding protei 97.37
3cz5_A153 Two-component response regulator, LUXR family; str 97.37
1s8n_A205 Putative antiterminator; RV1626, structural genomi 97.35
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 97.34
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 97.34
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 97.27
1yio_A208 Response regulatory protein; transcription regulat 97.27
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 97.25
3cg4_A142 Response regulator receiver domain protein (CHEY-; 97.24
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 97.23
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 97.22
1w25_A459 Stalked-cell differentiation controlling protein; 97.21
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 97.2
2hqr_A223 Putative transcriptional regulator; phosporylation 97.17
2qsj_A154 DNA-binding response regulator, LUXR family; struc 97.15
2qv0_A143 Protein MRKE; structural genomics, transcription, 97.15
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 97.12
2gkg_A127 Response regulator homolog; social motility, recei 97.1
3c3m_A138 Response regulator receiver protein; structural ge 97.09
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 97.09
3i42_A127 Response regulator receiver domain protein (CHEY- 97.07
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 97.03
3lte_A132 Response regulator; structural genomics, PSI, prot 97.0
3bre_A358 Probable two-component response regulator; protein 96.99
1ys7_A233 Transcriptional regulatory protein PRRA; response 96.98
3eqz_A135 Response regulator; structural genomics, unknown f 96.97
2oqr_A230 Sensory transduction protein REGX3; response regul 96.91
3eq2_A394 Probable two-component response regulator; adaptor 96.87
2gwr_A238 DNA-binding response regulator MTRA; two-component 96.86
3c3w_A225 Two component transcriptional regulatory protein; 96.72
3a10_A116 Response regulator; phosphoacceptor, signaling pro 96.72
2lpm_A123 Two-component response regulator; transcription re 96.3
2rdm_A132 Response regulator receiver protein; structural ge 96.28
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 96.27
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 95.81
3c97_A140 Signal transduction histidine kinase; structural g 95.81
3luf_A259 Two-component system response regulator/ggdef doma 95.8
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 95.66
3sy8_A400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 95.38
2vyc_A755 Biodegradative arginine decarboxylase; pyridoxal p 95.28
1a2o_A349 CHEB methylesterase; bacterial chemotaxis, adaptat 95.0
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 94.6
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 94.08
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 93.79
1w25_A459 Stalked-cell differentiation controlling protein; 93.62
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 92.52
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 92.51
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 91.08
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 90.81
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 90.22
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 89.86
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 87.61
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 86.8
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 86.22
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 86.06
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 85.66
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
Probab=99.93  E-value=6.8e-27  Score=191.18  Aligned_cols=64  Identities=73%  Similarity=1.150  Sum_probs=61.4

Q ss_pred             CCCCCCceeccHHHHHHHHHHHHHhCCCCCchHHHHhhcCCCCCCHHHHHHhhhhhhhhhhchh
Q 007341          107 TTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRIS  170 (607)
Q Consensus       107 s~~kKpRlvWT~ELH~kFv~AV~qLG~~kA~Pk~IlelM~v~gLT~enVaSHLQKyR~~Lkr~s  170 (607)
                      ++.+|||++||+|||++||+||++||.++|+||.|+++|+|+|||++||+|||||||++++|++
T Consensus         1 ~~~~k~r~~WT~elH~~Fv~Av~~LG~~~AtPk~Il~~M~v~gLT~~~VkSHLQKYR~~l~r~~   64 (64)
T 1irz_A            1 TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKKVS   64 (64)
T ss_dssp             CCCCCSSCSSCHHHHHHHHHHHHHHCTTTCCHHHHHHHHCCTTCCHHHHHHHHHHHHHHHHSCC
T ss_pred             CCCCCCCCcCCHHHHHHHHHHHHHhCCCCCCcHHHHHHcCCCCCCHHHHHHHHHHHHHHHHccC
Confidence            3578999999999999999999999999999999999999999999999999999999999864
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 607
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 1e-30
d1ny5a1137 c.23.1.1 (A:1-137) Transcriptional activator sigm5 1e-07
d1dcfa_134 c.23.1.2 (A:) Receiver domain of the ethylene rece 4e-07
d1zesa1121 c.23.1.1 (A:3-123) PhoB receiver domain {Escherich 5e-07
d1ys7a2121 c.23.1.1 (A:7-127) Transcriptional regulatory prot 6e-07
d1p6qa_129 c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti 8e-07
d1zgza1120 c.23.1.1 (A:2-121) TorCAD operon transcriptional r 1e-06
d2a9pa1117 c.23.1.1 (A:2-118) DNA-binding response regulator 1e-06
d1jbea_128 c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI 1e-06
d2ayxa1133 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C 2e-06
d1dz3a_123 c.23.1.1 (A:) Sporulation response regulator Spo0A 2e-06
d1a04a2138 c.23.1.1 (A:5-142) Nitrate/nitrite response regula 2e-06
d1xhfa1121 c.23.1.1 (A:2-122) Aerobic respiration control pro 3e-06
d1yioa2128 c.23.1.1 (A:3-130) Response regulatory protein Sty 3e-06
d1dbwa_123 c.23.1.1 (A:) Transcriptional regulatory protein F 3e-06
d1mvoa_121 c.23.1.1 (A:) PhoP receiver domain {Bacillus subti 3e-06
d1p2fa2120 c.23.1.1 (A:1-120) Response regulator DrrB {Thermo 3e-06
d2pl1a1119 c.23.1.1 (A:1-119) PhoP receiver domain {Escherich 5e-06
d1k66a_149 c.23.1.1 (A:) Response regulator for cyanobacteria 5e-06
d1zh2a1119 c.23.1.1 (A:2-120) Transcriptional regulatory prot 7e-06
d1k68a_140 c.23.1.1 (A:) Response regulator for cyanobacteria 8e-06
d1kgsa2122 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog 1e-05
d2r25b1128 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba 1e-05
d1mb3a_123 c.23.1.1 (A:) Cell division response regulator Div 1e-05
d1qkka_140 c.23.1.1 (A:) Transcriptional regulatory protein D 1e-05
d1w25a1139 c.23.1.1 (A:2-140) Response regulator PleD, receiv 2e-05
d1krwa_123 c.23.1.1 (A:) NTRC receiver domain {Salmonella typ 2e-05
d1i3ca_144 c.23.1.1 (A:) Response regulator for cyanobacteria 3e-05
d1w25a2153 c.23.1.1 (A:141-293) Response regulator PleD, rece 4e-05
d1u0sy_118 c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T 4e-05
d1peya_119 c.23.1.1 (A:) Sporulation response regulator Spo0F 4e-04
d1s8na_190 c.23.1.1 (A:) Probable two-component system transc 0.003
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  111 bits (279), Expect = 1e-30
 Identities = 47/64 (73%), Positives = 59/64 (92%)

Query: 107 TTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYL 166
           T QKKPRV+W+ ELH KF+AAV+ LG+++AVPKKILDLMNV+KLTRENVASHLQK+R+ L
Sbjct: 1   TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVAL 60

Query: 167 KRIS 170
           K++S
Sbjct: 61  KKVS 64
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 Back     information, alignment and structure
>d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} Length = 128 Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query607
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.9
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 98.38
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 98.36
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 98.35
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 98.35
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 98.34
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 98.34
d1qkka_140 Transcriptional regulatory protein DctD, receiver 98.33
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 98.32
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 98.28
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 98.28
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 98.28
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 98.27
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 98.21
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 98.19
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 98.16
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 98.15
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 98.14
d1i3ca_144 Response regulator for cyanobacterial phytochrome 98.08
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 98.06
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 98.05
d1k68a_140 Response regulator for cyanobacterial phytochrome 98.04
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 98.04
d1k66a_149 Response regulator for cyanobacterial phytochrome 98.03
d1yioa2128 Response regulatory protein StyR, N-terminal domai 98.03
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 98.01
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 97.99
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 97.98
d1s8na_190 Probable two-component system transcriptional regu 97.98
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 97.98
d1mb3a_123 Cell division response regulator DivK {Caulobacter 97.94
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 97.85
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 97.83
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 96.36
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 94.12
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 93.38
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 92.47
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 89.69
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 89.51
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 86.3
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 83.33
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 80.27
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.90  E-value=1.1e-24  Score=176.28  Aligned_cols=64  Identities=73%  Similarity=1.150  Sum_probs=61.1

Q ss_pred             CCCCCCceeccHHHHHHHHHHHHHhCCCCCchHHHHhhcCCCCCCHHHHHHhhhhhhhhhhchh
Q 007341          107 TTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEKLTRENVASHLQKYRLYLKRIS  170 (607)
Q Consensus       107 s~~kKpRlvWT~ELH~kFv~AV~qLG~~kA~Pk~IlelM~v~gLT~enVaSHLQKyR~~Lkr~s  170 (607)
                      +..+|||++||+|||++||+||++||.++|+||.|+++|++++||++||+|||||||++++|++
T Consensus         1 s~~kk~R~~WT~elH~~Fv~Av~~lG~~~atpk~I~~~m~v~~lT~~qV~SHlQKYrl~l~k~s   64 (64)
T d1irza_           1 TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKKVS   64 (64)
T ss_dssp             CCCCCSSCSSCHHHHHHHHHHHHHHCTTTCCHHHHHHHHCCTTCCHHHHHHHHHHHHHHHHSCC
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHhCccccchHHHHHHcCCCCCCHHHHHHHHHHHHHHHHhcC
Confidence            3578999999999999999999999999999999999999999999999999999999999864
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure