Citrus Sinensis ID: 007371
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 606 | ||||||
| 224111296 | 1315 | cc-nbs-lrr resistance protein [Populus t | 0.655 | 0.301 | 0.404 | 7e-65 | |
| 255542484 | 2460 | phosphoprotein phosphatase, putative [Ri | 0.691 | 0.170 | 0.392 | 3e-64 | |
| 255563252 | 1603 | Disease resistance protein RPS5, putativ | 0.762 | 0.288 | 0.376 | 7e-64 | |
| 359488101 | 1677 | PREDICTED: disease resistance protein At | 0.648 | 0.234 | 0.414 | 9e-62 | |
| 147865073 | 1694 | hypothetical protein VITISV_021876 [Viti | 0.648 | 0.231 | 0.414 | 6e-61 | |
| 147844589 | 1849 | hypothetical protein VITISV_039838 [Viti | 0.679 | 0.222 | 0.371 | 1e-60 | |
| 302143590 | 948 | unnamed protein product [Vitis vinifera] | 0.648 | 0.414 | 0.407 | 2e-60 | |
| 224125154 | 949 | cc-nbs-lrr resistance protein [Populus t | 0.655 | 0.418 | 0.380 | 3e-60 | |
| 359488108 | 1436 | PREDICTED: disease resistance protein At | 0.648 | 0.273 | 0.405 | 5e-60 | |
| 255574526 | 1232 | Disease resistance protein RFL1, putativ | 0.785 | 0.386 | 0.375 | 7e-60 |
| >gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 254 bits (650), Expect = 7e-65, Method: Compositional matrix adjust.
Identities = 178/440 (40%), Positives = 256/440 (58%), Gaps = 43/440 (9%)
Query: 104 AISLTYGGIQVLPERLQCPCL-ELLHTEGDGSMQVSDHFFKGTEGLKVLNFTRIHFSSLP 162
AISL + I LP L+CP L L D S+Q+ D FF+ + LK+L+ T ++ S LP
Sbjct: 499 AISLPFRKIPDLPAILECPNLNSFLLLNKDPSLQIPDSFFREMKELKILDLTEVNLSPLP 558
Query: 163 SSLGCLINLQTLCLDYCRLKDIAIVGQLKKLEILILARSTIKQLPLEIGQLTRLQLLDLS 222
SSL L NLQTLCLD+C L+DI+I+G+L KL++L L S I +LP EIG++TRLQLLDLS
Sbjct: 559 SSLQFLENLQTLCLDHCVLEDISIIGELNKLKVLSLMSSNIVRLPREIGKVTRLQLLDLS 618
Query: 223 NCWLLEVIAPNVISKLSQLEELYMGNSFSGWEKVEGGS----NASLVELERLTKLATLEI 278
NC LEVI+PN +S L++LE+LYMGNSF WE EG S NA L EL+ L+ L+TL +
Sbjct: 619 NCERLEVISPNALSSLTRLEDLYMGNSFVKWE-TEGSSSQRNNACLSELKHLSNLSTLHM 677
Query: 279 EVADAEILPPNFVSV--ELQRYRIRIGDESEDEFDPLLVKSEAPRLMMLKGLEKVSILQE 336
++ DA+ +P + S L+R+RI IGD + VK R + LK +++Q
Sbjct: 678 QITDADNMPKDLFSSFQNLERFRIFIGDGWD-----WSVKDATSRTLKLK---LNTVIQL 729
Query: 337 NDGTKMLLQRTEGLWLETLEGVQSVVHELDDGEGFPRLKHLHVKSCSEILHIVGSVRREE 396
+G LL+ TE L L+ L GV+S++++L DGEGFP+L+HLHV++C + +I+ S+R
Sbjct: 730 EEGVNTLLKITEELHLQELNGVKSILNDL-DGEGFPQLRHLHVQNCPGVQYIINSIR--- 785
Query: 397 GELRRWEGNLNSTIQKCYEEMIGFRDIIHLQLSHFPRLKEIWHGQALPVSFFNNLFDLVV 456
F ++ L L + L++I HGQ + S NL L V
Sbjct: 786 -----------------MGPRTAFLNLDSLFLENLDNLEKICHGQLMAES-LGNLRILKV 827
Query: 457 DDCTNMSSAIPANLLRCLNNLVYLEVRNCDSLEEVLHLE-ELINADKEHIGPLFPKLFKL 515
+ C + + ++ R L L + + +C +EEV+ E E AD E I F +L +L
Sbjct: 828 ESCHRLKNLFSVSMARRLVRLEEITIIDCKIMEEVVAEESENDAADGEPIIE-FTQLRRL 886
Query: 516 RLTDLPKLKRFCNFTRNIIE 535
L LP+ F +F N+ E
Sbjct: 887 TLQCLPQ---FTSFHSNVEE 903
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359488101|ref|XP_002263761.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147844589|emb|CAN80585.1| hypothetical protein VITISV_039838 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302143590|emb|CBI22343.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224125154|ref|XP_002319513.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857889|gb|EEE95436.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 606 | ||||||
| TAIR|locus:2136447 | 985 | AT4G27190 [Arabidopsis thalian | 0.452 | 0.278 | 0.278 | 1.4e-17 | |
| TAIR|locus:2131689 | 919 | AT4G27220 [Arabidopsis thalian | 0.638 | 0.421 | 0.240 | 1.7e-12 | |
| DICTYBASE|DDB_G0282725 | 1775 | vilD "villin-like protein D" [ | 0.437 | 0.149 | 0.268 | 2.4e-11 | |
| TAIR|locus:2005517 | 909 | RPS2 "RESISTANT TO P. SYRINGAE | 0.529 | 0.353 | 0.244 | 2.6e-08 | |
| TAIR|locus:2205824 | 1384 | AT1G27170 [Arabidopsis thalian | 0.206 | 0.090 | 0.338 | 1.9e-09 | |
| TAIR|locus:2008510 | 967 | AT1G61190 "AT1G61190" [Arabido | 0.272 | 0.170 | 0.286 | 2.2e-09 | |
| TAIR|locus:2205804 | 1556 | AT1G27180 [Arabidopsis thalian | 0.237 | 0.092 | 0.340 | 3.6e-09 | |
| ZFIN|ZDB-GENE-040718-372 | 238 | lrrc57 "leucine rich repeat co | 0.330 | 0.840 | 0.255 | 1.6e-07 | |
| TAIR|locus:2117149 | 1201 | AT4G19050 [Arabidopsis thalian | 0.323 | 0.163 | 0.248 | 1.6e-07 | |
| TAIR|locus:2132741 | 892 | AT4G10780 [Arabidopsis thalian | 0.227 | 0.154 | 0.273 | 2.5e-07 |
| TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 198 (74.8 bits), Expect = 1.4e-17, Sum P(3) = 1.4e-17
Identities = 84/302 (27%), Positives = 150/302 (49%)
Query: 96 ETIRKDPIA-----ISLTYGGIQVLPERLQCPCLE--LLHTEGDGSM-QVSDHFFKGTEG 147
+ IR+D +A +SL ++ LP+ ++ C++ +L +G+ + +V F +
Sbjct: 492 QDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPT 551
Query: 148 LKVLNFTRIHFSSLPS-SLGCLINLQTLCLDYC-RLKDIAIVGQLKKLEILILARSTIKQ 205
L++LN + S PS SL L +L +L L C +L + + L KLE+L L + I +
Sbjct: 552 LRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILE 611
Query: 206 LPLEIGQLTRLQLLDLSNCWLLEVIAPNVISKLSQLEELYMGNSFSGWEKVEGGSN---A 262
P + +L R + LDLS LE I V+S+LS LE L M +S W V+G + A
Sbjct: 612 FPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWS-VQGETQKGQA 670
Query: 263 SLVELERLTKLATLEIEVADAEIL--PPNFVSVELQRYRIRIGDESEDEFDPLLVKSEAP 320
++ E+ L +L L I + + L N L+++++ +G L + +
Sbjct: 671 TVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYI-----LRTRHDKR 725
Query: 321 RLMMLKGLEKVSILQENDGTKMLLQRTEGLWLETLEGVQSVVHEL-DDGEGFPRLKHLHV 379
RL + +++ Q + G LL T L L +G+++++ +L D +GF LK L +
Sbjct: 726 RLT----ISHLNVSQVSIG--WLLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTI 779
Query: 380 KS 381
++
Sbjct: 780 EN 781
|
|
| TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0282725 vilD "villin-like protein D" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040718-372 lrrc57 "leucine rich repeat containing 57" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117149 AT4G19050 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 606 | |||
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 4e-07 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 5e-04 |
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
Score = 52.3 bits (125), Expect = 4e-07
Identities = 37/105 (35%), Positives = 54/105 (51%), Gaps = 3/105 (2%)
Query: 145 TEGLKVLNFTRIHFSSLPSSLGCLINLQTLCLDYCRLKDI-AIVGQLKKLEILILARSTI 203
LK L+ + SLPS L L NL+ L L + L D+ ++ L L L L+ + I
Sbjct: 139 KSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKI 198
Query: 204 KQLPLEIGQLTRLQLLDLSNCWLLEVIAPNVISKLSQLEELYMGN 248
LP EI L+ L+ LDLSN ++E+ + +S L L L + N
Sbjct: 199 SDLPPEIELLSALEELDLSNNSIIEL--LSSLSNLKNLSGLELSN 241
|
Length = 394 |
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 606 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.97 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.97 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.97 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.92 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.9 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.88 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.88 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.86 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.86 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.85 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.79 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.77 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.64 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.63 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.61 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.57 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.56 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.55 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.46 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.44 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.29 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.23 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.21 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.2 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.04 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.98 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.96 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.93 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.89 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.84 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.82 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.8 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.76 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.68 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.54 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.48 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.38 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.37 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.36 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.32 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.32 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.3 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.3 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.25 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.25 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 98.22 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.16 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.12 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.1 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.98 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.97 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.94 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.85 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.85 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.79 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.75 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.6 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.58 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.34 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.33 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.12 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.97 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.9 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.83 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.59 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.56 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.53 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 96.35 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 96.27 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.25 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.83 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 95.55 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.16 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 95.15 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 94.14 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 93.19 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 88.94 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 88.94 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 88.7 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 86.64 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 85.09 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 82.27 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 82.27 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.3e-34 Score=329.70 Aligned_cols=471 Identities=19% Similarity=0.241 Sum_probs=329.2
Q ss_pred hhhhHHhHhhhhhcccccccccCCCcccccccCCCCCceEEEEecchhhhhccCCccccccCCCCChHhHHHHhhhhhcC
Q 007371 4 VGLAAFSSIVAEELELDVVGIPSGDVAEKDRKDDQRRCTIILTSRKQDLLRIDMSCQKNFPIDALPRKEALQLFEKRMFN 83 (606)
Q Consensus 4 ~~~~~~~ddvw~~~~~~~~~~~~~~~~~~~~~~~~~gs~IivTTR~~~v~~~~~~~~~~~~l~~L~~~~~~~Lf~~~~~~ 83 (606)
..+..+.||||+..+|+.+.....+ .+.||+||||||+.+| +..++....|+++.+++++||+||+++||.
T Consensus 296 krvLLVLDdv~~~~~l~~L~~~~~~--------~~~GsrIIiTTrd~~v-l~~~~~~~~~~v~~l~~~ea~~LF~~~Af~ 366 (1153)
T PLN03210 296 RKVLIFIDDLDDQDVLDALAGQTQW--------FGSGSRIIVITKDKHF-LRAHGIDHIYEVCLPSNELALEMFCRSAFK 366 (1153)
T ss_pred CeEEEEEeCCCCHHHHHHHHhhCcc--------CCCCcEEEEEeCcHHH-HHhcCCCeEEEecCCCHHHHHHHHHHHhcC
Confidence 3455678999999999999887788 8899999999999999 566777789999999999999999999985
Q ss_pred C--CChhhH-----------------------------------------------------------------------
Q 007371 84 I--PNVADL----------------------------------------------------------------------- 90 (606)
Q Consensus 84 ~--~~~~~l----------------------------------------------------------------------- 90 (606)
. |... +
T Consensus 367 ~~~~~~~-~~~l~~~iv~~c~GLPLAl~vlgs~L~~k~~~~W~~~l~~L~~~~~~~I~~~L~~SYd~L~~~~~k~~Fl~i 445 (1153)
T PLN03210 367 KNSPPDG-FMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHI 445 (1153)
T ss_pred CCCCcHH-HHHHHHHHHHHhCCCcHHHHHHHHHHcCCCHHHHHHHHHHHHhCccHHHHHHHHHhhhccCccchhhhhhee
Confidence 3 2111 0
Q ss_pred -----------------------------------------HHHHhhhcc------------------------------
Q 007371 91 -----------------------------------------EKKMEETIR------------------------------ 99 (606)
Q Consensus 91 -----------------------------------------~~~~~di~~------------------------------ 99 (606)
...|||+++
T Consensus 446 a~ff~~~~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~~~~~~MHdLl~~~~r~i~~~~~~~~~~r~~l~~~~di~~vl 525 (1153)
T PLN03210 446 ACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQSNEPGEREFLVDAKDICDVL 525 (1153)
T ss_pred hhhcCCCCHHHHHHHHHhcCCCchhChHHHHhcCCEEEcCCeEEhhhHHHHHHHHHHHhhcCCCCcceeEeCHHHHHHHH
Confidence 113333333
Q ss_pred ------CCCeEEEecCCCCcc--cCCc--ccccccceeeccccc-------ccccchhHhcCCCCCcEEEeeCCcCccCC
Q 007371 100 ------KDPIAISLTYGGIQV--LPER--LQCPCLELLHTEGDG-------SMQVSDHFFKGTEGLKVLNFTRIHFSSLP 162 (606)
Q Consensus 100 ------~~l~~L~l~~~~~~~--l~~~--~~l~~L~~L~~~~~~-------~~~~~~~~~~~l~~L~~L~l~~~~l~~lp 162 (606)
..++.+.+....+.. +... ..+++|+.|.++.+. ...+|.++..-..+||.|++.++.+..+|
T Consensus 526 ~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP 605 (1153)
T PLN03210 526 EDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMP 605 (1153)
T ss_pred HhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccccccceeecCcchhhcCcccEEEEecCCCCCCCC
Confidence 112222222222211 1111 156778877765432 12355554322356888998888888888
Q ss_pred ccccCCCCCcEEEeeCCCCCC-CcccCCCCCCCEeeecCC-cCCcccccccCCCCCCEEecCCCcccccccHHHhhCCCC
Q 007371 163 SSLGCLINLQTLCLDYCRLKD-IAIVGQLKKLEILILARS-TIKQLPLEIGQLTRLQLLDLSNCWLLEVIAPNVISKLSQ 240 (606)
Q Consensus 163 ~~~~~l~~L~~L~l~~~~~~~-~~~i~~l~~L~~L~l~~~-~l~~lp~~i~~L~~L~~L~l~~~~~~~~~p~~~i~~l~~ 240 (606)
..+ ...+|+.|++.++.+.. +..+..+++|++|+++++ .+..+| .++.+++|++|++.+|.....+|.. ++++++
T Consensus 606 ~~f-~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip-~ls~l~~Le~L~L~~c~~L~~lp~s-i~~L~~ 682 (1153)
T PLN03210 606 SNF-RPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIP-DLSMATNLETLKLSDCSSLVELPSS-IQYLNK 682 (1153)
T ss_pred CcC-CccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCC-ccccCCcccEEEecCCCCccccchh-hhccCC
Confidence 877 56888889998888877 677788888999998887 466776 4778888999999888888888887 888888
Q ss_pred CCEEEccCCCCCCccccCCCccchHhhccCCCCCEEEEeeCCC-CCCCccccccCCcEEEEEeCCCCCCCCCCcccCCCC
Q 007371 241 LEELYMGNSFSGWEKVEGGSNASLVELERLTKLATLEIEVADA-EILPPNFVSVELQRYRIRIGDESEDEFDPLLVKSEA 319 (606)
Q Consensus 241 L~~L~l~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~-~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~ 319 (606)
|+.|++++|......+ ..+ ++++|+.|++++|.. ..+|.. ..+|+.|++.... ...++..+ .+++
T Consensus 683 L~~L~L~~c~~L~~Lp--------~~i-~l~sL~~L~Lsgc~~L~~~p~~--~~nL~~L~L~~n~--i~~lP~~~-~l~~ 748 (1153)
T PLN03210 683 LEDLDMSRCENLEILP--------TGI-NLKSLYRLNLSGCSRLKSFPDI--STNISWLDLDETA--IEEFPSNL-RLEN 748 (1153)
T ss_pred CCEEeCCCCCCcCccC--------CcC-CCCCCCEEeCCCCCCccccccc--cCCcCeeecCCCc--cccccccc-cccc
Confidence 9999888875444333 222 677888888887653 444432 3577888774332 22333322 4667
Q ss_pred CcEEEecCcccccc----cccchhHHHhhccccceecccccCcccccccccCCCCCCCCcEEEeecCCCceEeccccccc
Q 007371 320 PRLMMLKGLEKVSI----LQENDGTKMLLQRTEGLWLETLEGVQSVVHELDDGEGFPRLKHLHVKSCSEILHIVGSVRRE 395 (606)
Q Consensus 320 L~~L~L~~~~~~~~----~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~ 395 (606)
|+.|.+.++..... .+.+......+++|+.|++++|.....+|..+. ++++|+.|+|++|+.++.+..
T Consensus 749 L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~---~L~~L~~L~Ls~C~~L~~LP~----- 820 (1153)
T PLN03210 749 LDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQ---NLHKLEHLEIENCINLETLPT----- 820 (1153)
T ss_pred cccccccccchhhccccccccchhhhhccccchheeCCCCCCccccChhhh---CCCCCCEEECCCCCCcCeeCC-----
Confidence 77777766432110 111111222357899999999998888998776 899999999999998887621
Q ss_pred cccccccccccchhhhhhhhhhhccccccceeccccccccccccCCCCCccccCCccEEEeccCCCcccccchhHHhhcC
Q 007371 396 EGELRRWEGNLNSTIQKCYEEMIGFRDIIHLQLSHFPRLKEIWHGQALPVSFFNNLFDLVVDDCTNMSSAIPANLLRCLN 475 (606)
Q Consensus 396 ~~~~~~~~~~L~~~i~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~l~~L~~L~i~~C~~L~~l~~~~~~~~l~ 475 (606)
...+++|+. |.+++|..+..++.. .++|+.|++.+ +.++.+ |. .+..++
T Consensus 821 ----~~~L~sL~~-----------------L~Ls~c~~L~~~p~~-------~~nL~~L~Ls~-n~i~~i-P~-si~~l~ 869 (1153)
T PLN03210 821 ----GINLESLES-----------------LDLSGCSRLRTFPDI-------STNISDLNLSR-TGIEEV-PW-WIEKFS 869 (1153)
T ss_pred ----CCCccccCE-----------------EECCCCCcccccccc-------ccccCEeECCC-CCCccC-hH-HHhcCC
Confidence 124667777 999999988876532 36899999988 578877 54 367899
Q ss_pred CCcEEEEecCCCcceeeccccccccccCCCCCCCCccceEeeccccccccccccc----------cccccCCCcceEeec
Q 007371 476 NLVYLEVRNCDSLEEVLHLEELINADKEHIGPLFPKLFKLRLTDLPKLKRFCNFT----------RNIIELPKLRYLTIE 545 (606)
Q Consensus 476 ~L~~L~i~~c~~l~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~L~~l~~~~----------~~~~~~~~L~~L~i~ 545 (606)
+|+.|++.+|++++.++. ....+++|+.+++++|++|+.++... .....+|+...+.+.
T Consensus 870 ~L~~L~L~~C~~L~~l~~-----------~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~ 938 (1153)
T PLN03210 870 NLSFLDMNGCNNLQRVSL-----------NISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFI 938 (1153)
T ss_pred CCCEEECCCCCCcCccCc-----------ccccccCCCeeecCCCcccccccCCCCchhhhhhcccccccCCchhccccc
Confidence 999999999999988764 23468899999999999998765410 001234555667788
Q ss_pred cCCCCc
Q 007371 546 NCPDME 551 (606)
Q Consensus 546 ~Cp~L~ 551 (606)
+|.+|.
T Consensus 939 nC~~L~ 944 (1153)
T PLN03210 939 NCFNLD 944 (1153)
T ss_pred cccCCC
Confidence 888875
|
syringae 6; Provisional |
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 606 | |||
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 7e-18 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-17 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 4e-17 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 8e-14 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-13 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-17 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 5e-16 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 8e-16 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-15 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 8e-09 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-16 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-13 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-12 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-11 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-11 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-10 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-10 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-10 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-07 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 3e-12 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-09 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-08 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-12 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 6e-11 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-09 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-09 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-09 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 6e-09 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 7e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-12 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-11 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-10 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-07 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-12 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-11 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-11 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-10 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-10 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 9e-10 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-08 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-07 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-12 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-10 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-10 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-08 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-11 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-08 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 7e-08 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-11 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-10 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-08 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-08 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-11 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-11 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-09 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-08 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 9e-08 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-07 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 7e-06 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 8e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-11 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-11 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-10 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-10 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-09 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 8e-08 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-04 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-11 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-08 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-07 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-11 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 4e-09 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 1e-07 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-11 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 6e-09 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-08 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-11 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 7e-11 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-10 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-09 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 8e-09 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-08 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-08 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-08 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 7e-08 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-10 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-10 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-10 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 6e-09 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-08 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-10 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-09 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-08 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-07 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 5e-07 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-10 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 9e-10 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 3e-10 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 2e-08 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-10 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 8e-07 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-05 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 3e-10 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 3e-10 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 3e-10 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-08 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 6e-10 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 8e-09 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-08 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 4e-08 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 6e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 4e-06 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-09 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 5e-09 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 3e-08 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-08 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-09 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-08 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 3e-09 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 3e-07 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 4e-04 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 3e-09 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 3e-09 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-08 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-06 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 5e-06 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 6e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 5e-04 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 4e-09 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-06 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-09 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 5e-09 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 5e-06 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 6e-09 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 6e-09 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 1e-07 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 7e-09 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 6e-08 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 2e-06 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 2e-04 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 9e-09 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-08 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 1e-05 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 4e-08 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 1e-07 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-07 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-06 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 6e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-07 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-06 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 5e-06 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 7e-06 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 7e-06 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 3e-07 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 5e-07 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-06 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 7e-06 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-05 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-07 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-04 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 5e-07 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 7e-07 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-06 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 5e-04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 2e-06 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 3e-04 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-06 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-05 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-06 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 5e-06 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 7e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 7e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 1e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 9e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 7e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 2e-05 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 2e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-04 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 1e-04 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 4e-04 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 2e-04 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 2e-04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 5e-04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 7e-04 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 606 | |||
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 100.0 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.98 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.98 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.98 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.97 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.97 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.97 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.97 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.97 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.97 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.97 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.97 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.96 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.96 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.96 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.96 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.96 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.96 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.96 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.95 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.95 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.95 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.95 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.94 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.94 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.94 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.94 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.94 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.94 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.94 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.93 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.93 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.93 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.93 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.93 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.92 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.92 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.92 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.92 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.91 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.89 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.89 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.89 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.89 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.87 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.86 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.86 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.86 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.86 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.86 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.86 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.86 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.85 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.85 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.84 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.84 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.84 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.84 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.83 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.82 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.82 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.81 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.8 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.8 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.8 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.8 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.79 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.79 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.79 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.79 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.78 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.78 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.78 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.77 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.76 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.76 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.75 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.75 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.75 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.75 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.74 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.74 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.73 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.73 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.72 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.7 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.69 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.69 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.67 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.67 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.66 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.65 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.65 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.64 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.64 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.63 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.63 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.62 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.62 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.62 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.6 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.6 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.6 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.59 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.59 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.59 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.58 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.58 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.58 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.57 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.57 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.56 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.56 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.55 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.51 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.5 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.5 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.48 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.46 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.42 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.41 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.4 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.4 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.39 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.39 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.38 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.35 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.35 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.34 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.34 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.33 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.27 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.23 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.21 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.14 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.12 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.11 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.11 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.07 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.06 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.87 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.79 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.76 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.73 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.73 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.66 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.54 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.5 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.42 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.34 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.32 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 98.09 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.02 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.96 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.93 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.87 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.85 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.77 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.66 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.2 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 96.75 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 96.7 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 95.11 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 94.31 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 93.99 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 93.95 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 92.93 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 92.85 |
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-30 Score=284.90 Aligned_cols=452 Identities=12% Similarity=0.059 Sum_probs=265.3
Q ss_pred CCCeEEEecCCCCcccCC-cc-cccccceeecccccccccchhHhcCCCCCcEEEeeCCcCcc-CCccccCCCCCcEEEe
Q 007371 100 KDPIAISLTYGGIQVLPE-RL-QCPCLELLHTEGDGSMQVSDHFFKGTEGLKVLNFTRIHFSS-LPSSLGCLINLQTLCL 176 (606)
Q Consensus 100 ~~l~~L~l~~~~~~~l~~-~~-~l~~L~~L~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~l~~-lp~~~~~l~~L~~L~l 176 (606)
..+++|++++|.+..++. .. .+++|++|++++|.+..+....|.++++|++|++++|.+.. .|..++++++|++|++
T Consensus 33 ~~l~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L 112 (606)
T 3t6q_A 33 NSTECLEFSFNVLPTIQNTTFSRLINLTFLDLTRCQIYWIHEDTFQSQHRLDTLVLTANPLIFMAETALSGPKALKHLFF 112 (606)
T ss_dssp TTCCEEECTTCCCSEECTTTSTTCTTCSEEECTTCCCCEECTTTTTTCTTCCEEECTTCCCSEECTTTTSSCTTCCEEEC
T ss_pred CcCcEEEccCCccCcCChhHhccCccceEEECCCCccceeChhhccCccccCeeeCCCCcccccChhhhcccccccEeec
Confidence 468999999999977744 34 89999999999998888876667899999999999999988 5778999999999999
Q ss_pred eCCCCCC--CcccCCCCCCCEeeecCCcCCccc-ccccCCCCCCEEecCCCcccccccHHHhhCCCCCC--EEEccCCCC
Q 007371 177 DYCRLKD--IAIVGQLKKLEILILARSTIKQLP-LEIGQLTRLQLLDLSNCWLLEVIAPNVISKLSQLE--ELYMGNSFS 251 (606)
Q Consensus 177 ~~~~~~~--~~~i~~l~~L~~L~l~~~~l~~lp-~~i~~L~~L~~L~l~~~~~~~~~p~~~i~~l~~L~--~L~l~~~~~ 251 (606)
++|.++. +..++++++|++|++++|.++.++ +.+..+++|++|++++|...+..|.. ++.+++|+ +|++++|.+
T Consensus 113 ~~n~i~~l~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~-~~~l~~L~~l~L~l~~n~l 191 (606)
T 3t6q_A 113 IQTGISSIDFIPLHNQKTLESLYLGSNHISSIKLPKGFPTEKLKVLDFQNNAIHYLSKED-MSSLQQATNLSLNLNGNDI 191 (606)
T ss_dssp TTSCCSCGGGSCCTTCTTCCEEECCSSCCCCCCCCTTCCCTTCCEEECCSSCCCEECHHH-HHTTTTCCSEEEECTTCCC
T ss_pred cccCcccCCcchhccCCcccEEECCCCcccccCcccccCCcccCEEEcccCcccccChhh-hhhhcccceeEEecCCCcc
Confidence 9999888 578899999999999999988763 34445999999999997655444544 89999999 889998887
Q ss_pred CCccccCCCc--------------------------------------------cchHhhccCCCCCEEEEeeCCCCCCC
Q 007371 252 GWEKVEGGSN--------------------------------------------ASLVELERLTKLATLEIEVADAEILP 287 (606)
Q Consensus 252 ~~~~~~~~~~--------------------------------------------~~~~~l~~l~~L~~L~l~~~~~~~~~ 287 (606)
....+..-.. ..+..+..+ +|+.|++.+|.+..++
T Consensus 192 ~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~l~~l~~~~~~~~~~~~i~~~~~~~l~~~-~L~~L~l~~n~l~~~~ 270 (606)
T 3t6q_A 192 AGIEPGAFDSAVFQSLNFGGTQNLLVIFKGLKNSTIQSLWLGTFEDMDDEDISPAVFEGLCEM-SVESINLQKHYFFNIS 270 (606)
T ss_dssp CEECTTTTTTCEEEEEECTTCSCHHHHHHHTTTCEEEEEECCCCTTSCCCCCCGGGGGGGGGS-EEEEEECTTCCCSSCC
T ss_pred CccChhHhhhccccccccCCchhHHHHhhhccccchhheechhhccccccccChhHhchhhcC-ceeEEEeecCccCccC
Confidence 6554321100 000111111 4555555555555554
Q ss_pred ccc-c-ccCCcEEEEEeCCCCCCCCCCcccCCCCCcEEEecCcccccccccchhHHHhhccccceecccccCcccccccc
Q 007371 288 PNF-V-SVELQRYRIRIGDESEDEFDPLLVKSEAPRLMMLKGLEKVSILQENDGTKMLLQRTEGLWLETLEGVQSVVHEL 365 (606)
Q Consensus 288 ~~~-~-~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~L~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l 365 (606)
... . .++|+.|++..+. ...++..+..+++|+.|++++|.+.+..+ ..+. .+++|++|++++|.....++...
T Consensus 271 ~~~~~~l~~L~~L~l~~n~--l~~lp~~l~~l~~L~~L~l~~n~l~~~~~--~~~~-~l~~L~~L~l~~n~~~~~~~~~~ 345 (606)
T 3t6q_A 271 SNTFHCFSGLQELDLTATH--LSELPSGLVGLSTLKKLVLSANKFENLCQ--ISAS-NFPSLTHLSIKGNTKRLELGTGC 345 (606)
T ss_dssp TTTTTTCTTCSEEECTTSC--CSCCCSSCCSCTTCCEEECTTCCCSBGGG--GCGG-GCTTCSEEECCSCSSCCBCCSST
T ss_pred HHHhccccCCCEEeccCCc--cCCCChhhcccccCCEEECccCCcCcCch--hhhh-ccCcCCEEECCCCCcccccchhh
Confidence 432 2 2566666653221 12344455566666666666655433221 1122 23566666666655443443321
Q ss_pred cCCCCCCCCcEEEeecCCCceEeccccccccccccccccccch-hhhhh------hhhhhccccccceeccccccccccc
Q 007371 366 DDGEGFPRLKHLHVKSCSEILHIVGSVRREEGELRRWEGNLNS-TIQKC------YEEMIGFRDIIHLQLSHFPRLKEIW 438 (606)
Q Consensus 366 ~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~L~~-~i~~~------~~~~~~~~~L~~L~l~~~~~l~~~~ 438 (606)
++.+++|++|++++|.-- .+... +.....+++|+. .+..+ +..+..+++|+.|++.++.-....+
T Consensus 346 --~~~l~~L~~L~l~~n~l~-~~~~~-----~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~ 417 (606)
T 3t6q_A 346 --LENLENLRELDLSHDDIE-TSDCC-----NLQLRNLSHLQSLNLSYNEPLSLKTEAFKECPQLELLDLAFTRLKVKDA 417 (606)
T ss_dssp --TTTCTTCCEEECCSSCCC-EEEES-----TTTTTTCTTCCEEECCSCSCEEECTTTTTTCTTCSEEECTTCCEECCTT
T ss_pred --hhccCcCCEEECCCCccc-cccCc-----chhcccCCCCCEEECCCCcCCcCCHHHhcCCccCCeEECCCCcCCCccc
Confidence 225566666666655422 11100 000233444444 22222 1223344555557766654222111
Q ss_pred cCCCCCccccCCccEEEeccCCCcccccchhHHhhcCCCcEEEEecCCCcceeeccccccccccCCCCCCCCccceEeec
Q 007371 439 HGQALPVSFFNNLFDLVVDDCTNMSSAIPANLLRCLNNLVYLEVRNCDSLEEVLHLEELINADKEHIGPLFPKLFKLRLT 518 (606)
Q Consensus 439 ~~~~~~~~~l~~L~~L~i~~C~~L~~l~~~~~~~~l~~L~~L~i~~c~~l~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~ 518 (606)
. ..+..+++|++|++++| .+....+ ..+..+++|++|++++|.--...... ...+..+++|+.|+++
T Consensus 418 ~---~~~~~l~~L~~L~l~~n-~l~~~~~-~~~~~l~~L~~L~L~~n~l~~~~~~~--------~~~~~~l~~L~~L~Ls 484 (606)
T 3t6q_A 418 Q---SPFQNLHLLKVLNLSHS-LLDISSE-QLFDGLPALQHLNLQGNHFPKGNIQK--------TNSLQTLGRLEILVLS 484 (606)
T ss_dssp C---CTTTTCTTCCEEECTTC-CCBTTCT-TTTTTCTTCCEEECTTCBCGGGEECS--------SCGGGGCTTCCEEECT
T ss_pred c---hhhhCcccCCEEECCCC-ccCCcCH-HHHhCCCCCCEEECCCCCCCcccccc--------chhhccCCCccEEECC
Confidence 1 11355667777777764 4554433 23456677777777766522111100 1223456677777777
Q ss_pred cccccccccccccccccCCCcceEeeccCCCCccccc-C---CccccccccC--------hhhhhhhccccceeeccc
Q 007371 519 DLPKLKRFCNFTRNIIELPKLRYLTIENCPDMETFIS-N---STSVLHMTAD--------NKEAQKLKSEKNLLVADQ 584 (606)
Q Consensus 519 ~c~~L~~l~~~~~~~~~~~~L~~L~i~~Cp~L~~l~~-~---~~~~~~l~~~--------~~~~~~l~~l~~l~i~~~ 584 (606)
+| +++.++. .....+++|+.|++++|. +..++. . ...+ .+++. ...+..+++|+.+.++++
T Consensus 485 ~n-~l~~~~~--~~~~~l~~L~~L~Ls~N~-l~~~~~~~l~~l~~L-~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~N 557 (606)
T 3t6q_A 485 FC-DLSSIDQ--HAFTSLKMMNHVDLSHNR-LTSSSIEALSHLKGI-YLNLASNHISIILPSLLPILSQQRTINLRQN 557 (606)
T ss_dssp TS-CCCEECT--TTTTTCTTCCEEECCSSC-CCGGGGGGGTTCCSC-EEECCSSCCCCCCGGGHHHHHTSSEEECTTC
T ss_pred CC-ccCccCh--hhhccccCCCEEECCCCc-cCcCChhHhCccccc-EEECcCCcccccCHhhcccCCCCCEEeCCCC
Confidence 66 4444432 244556677777776663 333321 1 1111 22221 123566778888877665
|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 606 | ||||
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-09 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 5e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-05 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 2e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 4e-05 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 6e-05 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 3e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.003 |
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Internalin LRR domain domain: Internalin A species: Listeria monocytogenes [TaxId: 1639]
Score = 57.3 bits (137), Expect = 2e-09
Identities = 36/197 (18%), Positives = 71/197 (36%), Gaps = 16/197 (8%)
Query: 52 LLRIDMSCQKNFPIDALPRKEALQLFEKRMFNIPNVADLEKKMEETIRKDPIAISLTYGG 111
L+ + P+ L + L L ++ +I +A L + + L
Sbjct: 202 LIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTD---------LDLANNQ 252
Query: 112 IQVLPERLQCPCLELLHTEGDGSMQVSDHFFKGTEGLKVLNFTRIHFSSLPSSLGCLINL 171
I L L L + +S LN ++ S S L NL
Sbjct: 253 ISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPIS---NLKNL 309
Query: 172 QTLCLDYCRLKDIAIVGQLKKLEILILARSTIKQLPLEIGQLTRLQLLDLSNCWLLEVIA 231
L L + + DI+ V L KL+ L A + + + + LT + L + + ++
Sbjct: 310 TYLTLYFNNISDISPVSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTP 368
Query: 232 PNVISKLSQLEELYMGN 248
++ L+++ +L + +
Sbjct: 369 ---LANLTRITQLGLND 382
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 606 | |||
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.84 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.84 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.78 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.77 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.77 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.74 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.73 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.72 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.71 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.68 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.67 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.65 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.64 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.62 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.62 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.61 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.6 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.6 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.53 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.52 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.45 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.44 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.42 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.41 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.41 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.36 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.3 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.27 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.14 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.14 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.08 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.96 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.88 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.8 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.73 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.58 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 98.56 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.73 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.68 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.06 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.56 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.5 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.14 |
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Internalin LRR domain domain: Internalin A species: Listeria monocytogenes [TaxId: 1639]
Probab=99.84 E-value=2e-19 Score=181.91 Aligned_cols=341 Identities=19% Similarity=0.230 Sum_probs=181.5
Q ss_pred CCCCCcEEEeeCCcCccCCccccCCCCCcEEEeeCCCCCCCcccCCCCCCCEeeecCCcCCcccccccCCCCCCEEecCC
Q 007371 144 GTEGLKVLNFTRIHFSSLPSSLGCLINLQTLCLDYCRLKDIAIVGQLKKLEILILARSTIKQLPLEIGQLTRLQLLDLSN 223 (606)
Q Consensus 144 ~l~~L~~L~l~~~~l~~lp~~~~~l~~L~~L~l~~~~~~~~~~i~~l~~L~~L~l~~~~l~~lp~~i~~L~~L~~L~l~~ 223 (606)
.+.+|++|+++++.++++ +.++.+++|++|++++|++++++.++++++|++|++++|.+..+++ ++++++|+.|++.+
T Consensus 42 ~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~~-l~~l~~L~~L~~~~ 119 (384)
T d2omza2 42 DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITP-LANLTNLTGLTLFN 119 (384)
T ss_dssp HHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCS
T ss_pred HhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCccccCCcccccccccccccccccc-cccccccccccccc
Confidence 355666677776666665 3466666777777777766664446666777777777776666543 66667777776666
Q ss_pred CcccccccHHHhhCCCCCCEEEccCCCCCCccccCCCccchHhhccCCCCCEEEEeeCCCCCCCccccccCCcEEEEEeC
Q 007371 224 CWLLEVIAPNVISKLSQLEELYMGNSFSGWEKVEGGSNASLVELERLTKLATLEIEVADAEILPPNFVSVELQRYRIRIG 303 (606)
Q Consensus 224 ~~~~~~~p~~~i~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~ 303 (606)
+... .++. ......+.......+.+..... .......+...... ................. ..
T Consensus 120 ~~~~-~~~~--~~~~~~~~~~~~~~~~l~~~~~----------~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~---~~ 182 (384)
T d2omza2 120 NQIT-DIDP--LKNLTNLNRLELSSNTISDISA----------LSGLTSLQQLSFGN-QVTDLKPLANLTTLERL---DI 182 (384)
T ss_dssp SCCC-CCGG--GTTCTTCSEEEEEEEEECCCGG----------GTTCTTCSEEEEEE-SCCCCGGGTTCTTCCEE---EC
T ss_pred cccc-cccc--cccccccccccccccccccccc----------cccccccccccccc-ccchhhhhccccccccc---cc
Confidence 4432 2222 3444455555544443322211 11111111111111 11000000000111111 11
Q ss_pred CCCCCCCCCcccCCCCCcEEEecCcccccccccchhHHHhhccccceecccccCcccccccccCCCCCCCCcEEEeecCC
Q 007371 304 DESEDEFDPLLVKSEAPRLMMLKGLEKVSILQENDGTKMLLQRTEGLWLETLEGVQSVVHELDDGEGFPRLKHLHVKSCS 383 (606)
Q Consensus 304 ~~~~~~~~~~l~~~~~L~~L~L~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~~~~l~~L~~L~l~~c~ 383 (606)
.............+++++.+.+++|.+.+..+. ...++|++|++.+|. ++.++. + ..+++|+.|++++|.
T Consensus 183 ~~~~~~~~~~~~~l~~~~~l~l~~n~i~~~~~~-----~~~~~L~~L~l~~n~-l~~~~~-l---~~l~~L~~L~l~~n~ 252 (384)
T d2omza2 183 SSNKVSDISVLAKLTNLESLIATNNQISDITPL-----GILTNLDELSLNGNQ-LKDIGT-L---ASLTNLTDLDLANNQ 252 (384)
T ss_dssp CSSCCCCCGGGGGCTTCSEEECCSSCCCCCGGG-----GGCTTCCEEECCSSC-CCCCGG-G---GGCTTCSEEECCSSC
T ss_pred cccccccccccccccccceeeccCCccCCCCcc-----cccCCCCEEECCCCC-CCCcch-h---hcccccchhccccCc
Confidence 111112233445666777777777655332211 123677777777763 333332 2 367777888777774
Q ss_pred CceEeccccccccccccccccccchhhhhhhhhhhccccccceeccccccccccccCCCCCccccCCccEEEeccCCCcc
Q 007371 384 EILHIVGSVRREEGELRRWEGNLNSTIQKCYEEMIGFRDIIHLQLSHFPRLKEIWHGQALPVSFFNNLFDLVVDDCTNMS 463 (606)
Q Consensus 384 ~l~~~~~~~~~~~~~~~~~~~~L~~~i~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~l~~L~~L~i~~C~~L~ 463 (606)
++.+. + ...+++|+. |.+.++. +..+ .+...++.++.+.+.++ .++
T Consensus 253 -l~~~~-------~--~~~~~~L~~-----------------L~l~~~~-l~~~-----~~~~~~~~l~~l~~~~n-~l~ 298 (384)
T d2omza2 253 -ISNLA-------P--LSGLTKLTE-----------------LKLGANQ-ISNI-----SPLAGLTALTNLELNEN-QLE 298 (384)
T ss_dssp -CCCCG-------G--GTTCTTCSE-----------------EECCSSC-CCCC-----GGGTTCTTCSEEECCSS-CCS
T ss_pred -cCCCC-------c--ccccccCCE-----------------eeccCcc-cCCC-----Ccccccccccccccccc-ccc
Confidence 33221 1 344556666 7776543 2222 22345667777777764 455
Q ss_pred cccchhHHhhcCCCcEEEEecCCCcceeeccccccccccCCCCCCCCccceEeeccccccccccccccccccCCCcceEe
Q 007371 464 SAIPANLLRCLNNLVYLEVRNCDSLEEVLHLEELINADKEHIGPLFPKLFKLRLTDLPKLKRFCNFTRNIIELPKLRYLT 543 (606)
Q Consensus 464 ~l~~~~~~~~l~~L~~L~i~~c~~l~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~L~~l~~~~~~~~~~~~L~~L~ 543 (606)
.+. ....++++++|+++++ ++++++. +..+|+|++|++++| +++.++. +..+++|++|+
T Consensus 299 ~~~---~~~~~~~l~~L~ls~n-~l~~l~~------------l~~l~~L~~L~L~~n-~l~~l~~----l~~l~~L~~L~ 357 (384)
T d2omza2 299 DIS---PISNLKNLTYLTLYFN-NISDISP------------VSSLTKLQRLFFANN-KVSDVSS----LANLTNINWLS 357 (384)
T ss_dssp CCG---GGGGCTTCSEEECCSS-CCSCCGG------------GGGCTTCCEEECCSS-CCCCCGG----GGGCTTCCEEE
T ss_pred ccc---ccchhcccCeEECCCC-CCCCCcc------------cccCCCCCEEECCCC-CCCCChh----HcCCCCCCEEE
Confidence 542 2466778888888775 3555432 235778888888877 6666643 55678888888
Q ss_pred eccCCCCcccccCCccccccccChhhhhhhccccceeecc
Q 007371 544 IENCPDMETFISNSTSVLHMTADNKEAQKLKSEKNLLVAD 583 (606)
Q Consensus 544 i~~Cp~L~~l~~~~~~~~~l~~~~~~~~~l~~l~~l~i~~ 583 (606)
+++| +++.++ .+..+++|+.|.+++
T Consensus 358 l~~N-~l~~l~--------------~l~~l~~L~~L~L~~ 382 (384)
T d2omza2 358 AGHN-QISDLT--------------PLANLTRITQLGLND 382 (384)
T ss_dssp CCSS-CCCBCG--------------GGTTCTTCSEEECCC
T ss_pred CCCC-cCCCCh--------------hhccCCCCCEeeCCC
Confidence 8776 566654 234566777776654
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|