Citrus Sinensis ID: 007480

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600--
MGMSFRCLVFSVLLCLSASGLLAIENFHQAFPIVEPDPGHTKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAKVRLPLPEQSLQDAHERSKKEAMDVFDVQHFGRQHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCEDKMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVGPSKANYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRKYGSRGLLPLYNNHKGGTNRPRTD
ccccccHHHHHHHHHHHcccccccccccccccEEEEccccccEEEcHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHcccccccccccccccccccEEEEEcccEEccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccc
ccccHHHHHHHHHHHHHHcccccHHHccccccEEEEEccccEEEEcHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHcccccccccccccccccccEEEEEEEccccccccccEEEEEEEcccccccccccccccHHHHHHHHHHcHEEEcccccccHHHHHHHHHHHHHHHHHHHcccccHEccccccEEEEEEHcccccccHHHHHHHHHHHccccccccHHHHcccHHHHHHHHccccEEEEEccccHHHHHHcccccHcccHHHHHHHHHHHHHHHHcccccEccccEEccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccHccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccc
MGMSFRCLVFSVLLCLSASGLLAIENFHqafpivepdpghtklrlSREGLETIRRITNPIAAIAvigpyrsgkSFLLNQLLslscdegfgvghmrdtktkgiwvwgnpvemeidgsrtsvfyldtegfesigksnvydDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYgrvkgqdvafePAKLVWLIQRDFLQGKSVQEMVHDALQrvpndkgdknidMVNQIRNSLAimgdnstafslpqphllrtklcdmkdeeldpIYVKRREQLKKLVASVtrpkivqgkflngNEFVAFMEQILEALnkgeipstgslVEVFNKGILERCLKLYNERMakvrlplpeqslqDAHERSKKeamdvfdvqhfgrqHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCEDkmdqlqvlrlpsmakfnagflqcnqsfahecvgpskaNYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTwetlvyspvldldrwavpLGCMIAVFVLYWRccgkrkygsrgllplynnhkggtnrprtd
MGMSFRCLVFSVLLCLSASGLLAIENFHQAfpivepdpgHTKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALqrvpndkgdkniDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLvasvtrpkivqgkflnGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAkvrlplpeqSLQDAHERSKKEAMDVFDVQHFGRQHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCEDKMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVGPSKANYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRkygsrgllplynnhkggtnrprtd
MGMSFRCLVFSVLLCLSASGLLAIENFHQAFPIVEPDPGHTKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAKVRLPLPEQSLQDAHERSKKEAMDVFDVQHFGRQHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCEDKMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVGPSKANYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRKYGSRGLLPLYNNHKGGTNRPRTD
****FRCLVFSVLLCLSASGLLAIENFHQAFPIVEPDPGHTKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDAL***********IDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAKVR**********************FDVQHF**********QLDEEIQEAYKNVIMANEYQSSKICESLYTRCEDKMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVGPSKANYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRKYGSRGLLPLYN************
***SFRCLVFSVLLC*****************IVEPDPGHTKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALQRVP*******IDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAKVRLPLPEQSLQDAHERSKKEAMDVFDVQHFGRQHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCED*************AKFNAGFLQCNQSFAHECVGPSKANYEQRMMKML*********EYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRKYGSRGL*****************
MGMSFRCLVFSVLLCLSASGLLAIENFHQAFPIVEPDPGHTKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAKVRLPLPEQS*********KEAMDVFDVQHFGRQHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCEDKMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVGPSKANYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRKYGSRGLLPLYNNHK*********
*GMSFRCLVFSVLLCLSASGLLAIENFHQAFPIVEPDPGHTKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAKVRLPLPEQSLQDAHERSKKEAMDVFDVQHFGRQHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCEDKMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVGPSKANYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRKYGSRGLL****************
iiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGMSFRCLVFSVLLCLSASGLLAIENFHQAFPIVEPDPGHTKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAKVRLPLPEQSLQDAHERSKKEAMDVFDVQHFGxxxxxxxxxxxxxxxxxxxxxVIMANEYQSSKICESLYTRCEDKMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVGPSKANYEQRMMKMLGKSRSLFIKEYNHRLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIVSTWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRKYGSRGLLPLYNNHKGGTNRPRTD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query602 2.2.26 [Sep-21-2011]
Q96PP8586 Guanylate-binding protein yes no 0.634 0.651 0.272 8e-28
Q96PP9640 Guanylate-binding protein no no 0.634 0.596 0.254 2e-27
Q8N8V2638 Guanylate-binding protein no no 0.619 0.584 0.262 3e-27
Q9H0R5595 Guanylate-binding protein no no 0.644 0.652 0.269 2e-26
Q9Z0E6589 Interferon-induced guanyl no no 0.596 0.609 0.261 1e-25
Q5R9T9633 Guanylate-binding protein no no 0.616 0.586 0.246 3e-25
P32456591 Interferon-induced guanyl no no 0.546 0.556 0.279 3e-25
Q01514589 Interferon-induced guanyl no no 0.631 0.645 0.245 8e-25
Q61107620 Guanylate-binding protein no no 0.631 0.612 0.245 1e-24
Q63663589 Interferon-induced guanyl no no 0.588 0.601 0.26 1e-24
>sp|Q96PP8|GBP5_HUMAN Guanylate-binding protein 5 OS=Homo sapiens GN=GBP5 PE=1 SV=1 Back     alignment and function desciption
 Score =  125 bits (315), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 114/419 (27%), Positives = 203/419 (48%), Gaps = 37/419 (8%)

Query: 22  LAIENFHQAFPIVEPDPGHTKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLL 81
           +A+E  H + P+   +  + +L++++E LE +  IT P+  +A++G YR+GKS+L+N+L 
Sbjct: 1   MALE-IHMSDPMCLIENFNEQLKVNQEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLA 59

Query: 82  SLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDD-R 140
               ++GF V     + TKGIW+W  P     +    ++  LDTEG   + K++  +D +
Sbjct: 60  GK--NKGFSVASTVQSHTKGIWIWCVP---HPNWPNHTLVLLDTEGLGDVEKADNKNDIQ 114

Query: 141 IFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQ-DVAFEPA------- 192
           IFALA ++SS  +YN    I +  I  L    EL +    R     D   +PA       
Sbjct: 115 IFALALLLSSTFVYNTVNKIDQGAIDLLHNVTELTDLLKARNSPDLDRVEDPADSASFFP 174

Query: 193 KLVWLIQRDFLQGKSV-------QEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNS 245
            LVW + RDF  G  +        E + ++L+  P    D+ +   N  R  +       
Sbjct: 175 DLVWTL-RDFCLGLEIDGQLVTPDEYLENSLR--PKQGSDQRVQNFNLPRLCIQKFFPKK 231

Query: 246 TA--FSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFL-NGNEF 302
               F LP       +L  + D+EL+P +V++  +    + S +  K + G  + NG+  
Sbjct: 232 KCFIFDLPAHQKKLAQLETLPDDELEPEFVQQVTEFCSYIFSHSMTKTLPGGIMVNGSRL 291

Query: 303 VAFMEQILEALNKGEIP----STGSLVEVFNKGILERCLKLYNERMA-KVRLPLPE-QSL 356
              +   + A++ G++P    +  +L +  N   +++ +  Y+++M  KV+LP+   Q L
Sbjct: 292 KNLVLTYVNAISSGDLPCIENAVLALAQRENSAAVQKAIAHYDQQMGQKVQLPMETLQEL 351

Query: 357 QDAHERSKKEAMDVFDVQHFGRQHAKKSVMQLDEEIQEAYKNVIMA-NEYQSSKICESL 414
            D H  S++EA++VF    F  +   +S  +  E + +A +N I   N   SS  C +L
Sbjct: 352 LDLHRTSEREAIEVFMKNSF--KDVDQSFQKELETLLDAKQNDICKRNLEASSDYCSAL 408

Homo sapiens (taxid: 9606)
>sp|Q96PP9|GBP4_HUMAN Guanylate-binding protein 4 OS=Homo sapiens GN=GBP4 PE=1 SV=2 Back     alignment and function description
>sp|Q8N8V2|GBP7_HUMAN Guanylate-binding protein 7 OS=Homo sapiens GN=GBP7 PE=2 SV=2 Back     alignment and function description
>sp|Q9H0R5|GBP3_HUMAN Guanylate-binding protein 3 OS=Homo sapiens GN=GBP3 PE=2 SV=3 Back     alignment and function description
>sp|Q9Z0E6|GBP2_MOUSE Interferon-induced guanylate-binding protein 2 OS=Mus musculus GN=Gbp2 PE=1 SV=1 Back     alignment and function description
>sp|Q5R9T9|GBP6_PONAB Guanylate-binding protein 6 OS=Pongo abelii GN=GBP6 PE=2 SV=1 Back     alignment and function description
>sp|P32456|GBP2_HUMAN Interferon-induced guanylate-binding protein 2 OS=Homo sapiens GN=GBP2 PE=1 SV=3 Back     alignment and function description
>sp|Q01514|GBP1_MOUSE Interferon-induced guanylate-binding protein 1 OS=Mus musculus GN=Gbp1 PE=1 SV=1 Back     alignment and function description
>sp|Q61107|GBP4_MOUSE Guanylate-binding protein 4 OS=Mus musculus GN=Gbp4 PE=1 SV=1 Back     alignment and function description
>sp|Q63663|GBP2_RAT Interferon-induced guanylate-binding protein 2 OS=Rattus norvegicus GN=Gbp2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query602
225437197674 PREDICTED: guanylate-binding protein 4-l 1.0 0.893 0.825 0.0
297735482602 unnamed protein product [Vitis vinifera] 1.0 1.0 0.825 0.0
255559907631 interferon-induced guanylate-binding pro 0.971 0.927 0.804 0.0
356502780601 PREDICTED: guanylate-binding protein 4-l 0.960 0.961 0.832 0.0
356536546601 PREDICTED: guanylate-binding protein 4-l 0.958 0.960 0.830 0.0
449458450626 PREDICTED: guanylate-binding protein 4-l 0.998 0.960 0.795 0.0
449503820619 PREDICTED: guanylate-binding protein 4-l 0.980 0.953 0.803 0.0
334184802602 guanylate-binding-like protein [Arabidop 1.0 1.0 0.785 0.0
224082718663 predicted protein [Populus trichocarpa] 1.0 0.907 0.739 0.0
357440529596 Guanylate-binding protein [Medicago trun 0.956 0.966 0.785 0.0
>gi|225437197|ref|XP_002275124.1| PREDICTED: guanylate-binding protein 4-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1057 bits (2734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/602 (82%), Positives = 550/602 (91%)

Query: 1   MGMSFRCLVFSVLLCLSASGLLAIENFHQAFPIVEPDPGHTKLRLSREGLETIRRITNPI 60
           M +S+  L F + LCL ASG  +IENF QAFPIVEPDPGHTKLRL+REGLE I RIT PI
Sbjct: 73  MEISYWVLAFWIFLCLFASGSSSIENFRQAFPIVEPDPGHTKLRLAREGLEAIERITTPI 132

Query: 61  AAIAVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSV 120
           AA+AVIGPYRSGKSFLLNQLLSLSC EGFGVGHMRDTKTKGIWVWG P+EM+IDG ++SV
Sbjct: 133 AAVAVIGPYRSGKSFLLNQLLSLSCYEGFGVGHMRDTKTKGIWVWGTPIEMDIDGVKSSV 192

Query: 121 FYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYG 180
            YLDTEGFESIGKSNVYDDRIFALAT++SSVLIYNLPETIREADISRLSFAVELAEEFYG
Sbjct: 193 LYLDTEGFESIGKSNVYDDRIFALATILSSVLIYNLPETIREADISRLSFAVELAEEFYG 252

Query: 181 RVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAI 240
           RVKGQDVAFEPAKL+WLIQRDFLQGKSVQEMV++AL+ VPN  GDKNI+ VNQIR+SLAI
Sbjct: 253 RVKGQDVAFEPAKLLWLIQRDFLQGKSVQEMVNEALRHVPNYDGDKNIEQVNQIRDSLAI 312

Query: 241 MGDNSTAFSLPQPHLLRTKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGN 300
           MGDNSTAFSLPQPHL RT+LCDMKD ELDP YV++R+QLK++VAS+ RPKIVQGK LNG 
Sbjct: 313 MGDNSTAFSLPQPHLQRTRLCDMKDGELDPAYVQKRDQLKEVVASIIRPKIVQGKPLNGK 372

Query: 301 EFVAFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYNERMAKVRLPLPEQSLQDAH 360
           EFV+FMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLY+ERM KV LPL E+ L +AH
Sbjct: 373 EFVSFMEQILEALNKGEIPSTGSLVEVFNKGILERCLKLYSERMGKVALPLSEKYLLEAH 432

Query: 361 ERSKKEAMDVFDVQHFGRQHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCED 420
           E S+ EAM+VFD QHFGR HAKKSV  LDEEIQ+ YKN I+ANEYQSSK+CE+LYTRCED
Sbjct: 433 EGSRGEAMNVFDEQHFGRYHAKKSVTTLDEEIQKIYKNFILANEYQSSKLCEALYTRCED 492

Query: 421 KMDQLQVLRLPSMAKFNAGFLQCNQSFAHECVGPSKANYEQRMMKMLGKSRSLFIKEYNH 480
           KMDQLQVLRLPSMAKFNAGFL CNQSF  ECVGPSK NYEQRM KM+ KSRSLFIKEYNH
Sbjct: 493 KMDQLQVLRLPSMAKFNAGFLHCNQSFGKECVGPSKTNYEQRMTKMMQKSRSLFIKEYNH 552

Query: 481 RLFNWLVAFSLVMVVVGRFILKFIMIEMGAWVLFIFLETYTRMFWSAESLYYNPVWHFIV 540
           RLFNWLVAFSL MVVVGRF++KFI++E+GAW+LFIFLETYTRMFWSAESLYYNPVWHFIV
Sbjct: 553 RLFNWLVAFSLFMVVVGRFVIKFILLEIGAWILFIFLETYTRMFWSAESLYYNPVWHFIV 612

Query: 541 STWETLVYSPVLDLDRWAVPLGCMIAVFVLYWRCCGKRKYGSRGLLPLYNNHKGGTNRPR 600
           +TWETLVYSP+LDLDRWA+P+  ++A+ VLYWRC G+RK+GSRGLLPLYNNHKGG+NR R
Sbjct: 613 ATWETLVYSPILDLDRWAIPICVLVAILVLYWRCYGRRKHGSRGLLPLYNNHKGGSNRRR 672

Query: 601 TD 602
           +D
Sbjct: 673 SD 674

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297735482|emb|CBI17922.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255559907|ref|XP_002520972.1| interferon-induced guanylate-binding protein, putative [Ricinus communis] gi|223539809|gb|EEF41389.1| interferon-induced guanylate-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356502780|ref|XP_003520194.1| PREDICTED: guanylate-binding protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|356536546|ref|XP_003536798.1| PREDICTED: guanylate-binding protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|449458450|ref|XP_004146960.1| PREDICTED: guanylate-binding protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449503820|ref|XP_004162193.1| PREDICTED: guanylate-binding protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|334184802|ref|NP_181418.3| guanylate-binding-like protein [Arabidopsis thaliana] gi|330254499|gb|AEC09593.1| guanylate-binding-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224082718|ref|XP_002306811.1| predicted protein [Populus trichocarpa] gi|222856260|gb|EEE93807.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357440529|ref|XP_003590542.1| Guanylate-binding protein [Medicago truncatula] gi|355479590|gb|AES60793.1| Guanylate-binding protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query602
TAIR|locus:2161358 1082 AT5G46070 [Arabidopsis thalian 0.617 0.343 0.276 7.6e-32
RGD|1311040586 Gbp5 "guanylate binding protei 0.622 0.639 0.275 9.7e-29
UNIPROTKB|F1N9J3623 GBP7 "Uncharacterized protein" 0.616 0.595 0.284 1.3e-28
ZFIN|ZDB-GENE-070912-176 965 gbp3 "guanylate binding protei 0.656 0.409 0.272 5.2e-28
UNIPROTKB|K7GK68570 GBP6 "Uncharacterized protein" 0.611 0.645 0.264 9.1e-28
ZFIN|ZDB-GENE-070705-98645 si:ch211-209n20.1 "si:ch211-20 0.601 0.561 0.268 4.4e-26
UNIPROTKB|I3LE01591 LOC100737841 "Uncharacterized 0.508 0.517 0.292 9.9e-26
UNIPROTKB|E7ETN8483 GBP5 "Guanylate-binding protei 0.636 0.792 0.253 1.5e-25
UNIPROTKB|F1S4D7590 GBP1 "Uncharacterized protein" 0.601 0.613 0.265 2e-25
UNIPROTKB|F6PPP4579 Bt.37579 "Uncharacterized prot 0.629 0.654 0.262 2.5e-25
TAIR|locus:2161358 AT5G46070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 379 (138.5 bits), Expect = 7.6e-32, P = 7.6e-32
 Identities = 112/405 (27%), Positives = 198/405 (48%)

Query:    42 KLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKG 101
             K R+  E + T++ +  PI  ++V G  R GKSF+LNQLL  S   GF V       TKG
Sbjct:    52 KFRMDPEAVATLQLVKEPIGVVSVCGRARQGKSFILNQLLGRS--NGFQVASTHKPCTKG 109

Query:   102 IWVWGNPVEME-IDGSRTSVFYLDTEGFESIGKSNVYDDRIFALATVMSSVLIYNLPETI 160
             +W+W +P++   +DG+  ++  LD+EG ++  ++  Y  +IF+LA ++SS+ +YN    I
Sbjct:   110 LWLWSSPIKRTALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFVYNQMGGI 169

Query:   161 READISRLSFAVELAEEFYGRVKGQDVA------FEPAKLVWLIQRDFL-----QGKSV- 208
              EA + RLS   ++ +    +  G   +      F P   VWL+ RDF        + + 
Sbjct:   170 DEASLDRLSLVTQMTKHIRVKASGGTSSRSELGQFSPI-FVWLL-RDFYLDLVEDNRKIS 227

Query:   209 -QEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTKLCDMKD-- 265
              ++ +  AL+ V    GD  I   N+IR+S+  +  +   F+L +P L   K     D  
Sbjct:   228 PRDYLEIALRPVQGSGGD--IGAKNEIRDSIRALFPDRECFTLVRP-LNNEKDLQRLDQI 284

Query:   266 --EELDPIYVKRREQLKKLVASVTRPKIVQGKFLNGNEFVAFMEQILEALNKGEIP---- 319
               E+L P +    +   K V   TRPK + G  + G   V   +  L+ALN G +P    
Sbjct:   285 SLEKLRPEFGAGLDAFTKFVFEKTRPKQLGGTVMTGPILVGITQSYLDALNNGAVPTITS 344

Query:   320 STGSLVEVFNKGILERCLKLYNERMAKVRLPLPEQSLQDAHERSKKEAMDVFDVQHFGRQ 379
             S  S+ E   +   +  ++ Y     + + P  E +L++ HE + ++A+ +F+    G  
Sbjct:   345 SWQSVEETECRRAYDSGVEAYMAAFDQSKAP-EEGALREEHEEAVRKALAIFNSNAVGNG 403

Query:   380 HAKKSVMQL-DEEIQEAYKNVIMANEYQSSKI-CESLYTRCEDKM 422
              A+K    L  +++++ +++    N +  + + C S   R E ++
Sbjct:   404 SARKKFEDLLHKDLKKKFEDY-KKNAFMEADLRCTSTIQRMEKQL 447
GO:0003924 "GTPase activity" evidence=IEA;ISS
GO:0005525 "GTP binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006955 "immune response" evidence=ISS
GO:0009507 "chloroplast" evidence=IDA
GO:0005730 "nucleolus" evidence=IDA
GO:0000226 "microtubule cytoskeleton organization" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
RGD|1311040 Gbp5 "guanylate binding protein 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9J3 GBP7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-176 gbp3 "guanylate binding protein 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|K7GK68 GBP6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070705-98 si:ch211-209n20.1 "si:ch211-209n20.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LE01 LOC100737841 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E7ETN8 GBP5 "Guanylate-binding protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S4D7 GBP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F6PPP4 Bt.37579 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.5LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00023826001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (596 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
cd01851224 cd01851, GBP, Guanylate-binding protein (GBP) fami 3e-52
pfam02263264 pfam02263, GBP, Guanylate-binding protein, N-termi 1e-34
pfam02841297 pfam02841, GBP_C, Guanylate-binding protein, C-ter 2e-06
pfam05879 743 pfam05879, RHD3, Root hair defective 3 GTP-binding 3e-04
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 5e-04
>gnl|CDD|206650 cd01851, GBP, Guanylate-binding protein (GBP) family (N-terminal domain) Back     alignment and domain information 
 Score =  178 bits (453), Expect = 3e-52
 Identities = 75/234 (32%), Positives = 116/234 (49%), Gaps = 13/234 (5%)

Query: 54  RRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEI 113
             +  P+  ++V G   SGKSFLLN L   S  +GF V       TKGIW+W +P +   
Sbjct: 1   LDVGFPVVVVSVFGSQSSGKSFLLNHLFGTS--DGFDVMDTSQQTTKGIWMWSDPFKDT- 57

Query: 114 DGSRTSVFYLDTEGFESIGKS-NVYDDRIFALATVMSSVLIYNLPETIREADISRLSFAV 172
           DG + +V  LDTEG +   +     D R+FALAT++SSVLIYN+ +TI   D+ +L   +
Sbjct: 58  DGKKHAVLLLDTEGTDGRERGEFENDARLFALATLLSSVLIYNMWQTILGDDLDKLMGLL 117

Query: 173 ELAEEFYGRVKGQDVAFEPAKLVWLIQRDFLQGKSVQEMVHDALQRVPNDKGDKNIDMVN 232
           + A E  G     + +     L++++ RDF                   +K +  I+ +N
Sbjct: 118 KTALETLGLAGLHNFSKPKPLLLFVV-RDFTGPTP-------LEGLDVTEKSETLIEELN 169

Query: 233 QIRNSLAIMGDNSTAFSLPQPHLLRTKLC-DMKDEELDPIYVKRREQLKKLVAS 285
           +I +S+       T F LP P LL   L  D + ++L P + K  + L++   S
Sbjct: 170 KIWSSIRKPFTPITCFVLPHPGLLHKLLQNDGRLKDLPPEFRKALKALRQRFFS 223

Guanylate-binding protein (GBP), N-terminal domain. Guanylate-binding proteins (GBPs) define a group of proteins that are synthesized after activation of the cell by interferons. The biochemical properties of GBPs are clearly different from those of Ras-like and heterotrimeric GTP-binding proteins. They bind guanine nucleotides with low affinity (micromolar range), are stable in their absence and have a high turnover GTPase. In addition to binding GDP/GTP, they have the unique ability to bind GMP with equal affinity and hydrolyze GTP not only to GDP, but also to GMP. Furthermore, two unique regions around the base and the phosphate-binding areas, the guanine and the phosphate caps, respectively, give the nucleotide-binding site a unique appearance not found in the canonical GTP-binding proteins. The phosphate cap, which constitutes the region analogous to switch I, completely shields the phosphate-binding site from solvent such that a potential GTPase-activating protein (GAP) cannot approach. Length = 224
>gnl|CDD|111185 pfam02263, GBP, Guanylate-binding protein, N-terminal domain Back     alignment and domain information
>gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|218791 pfam05879, RHD3, Root hair defective 3 GTP-binding protein (RHD3) Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 602
PF02263260 GBP: Guanylate-binding protein, N-terminal domain; 100.0
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 99.97
KOG2037552 consensus Guanylate-binding protein [General funct 99.96
PF02841297 GBP_C: Guanylate-binding protein, C-terminal domai 99.9
PF05879 742 RHD3: Root hair defective 3 GTP-binding protein (R 99.87
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.86
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.83
KOG2203 772 consensus GTP-binding protein [General function pr 99.82
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.8
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.79
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.78
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.78
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.78
KOG2037552 consensus Guanylate-binding protein [General funct 99.76
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.75
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 99.74
COG1127263 Ttg2A ABC-type transport system involved in resist 99.74
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.72
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.72
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.71
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.7
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.69
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.69
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.69
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.68
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 99.68
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.68
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 99.68
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.67
PRK13537306 nodulation ABC transporter NodI; Provisional 99.67
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.67
COG0411250 LivG ABC-type branched-chain amino acid transport 99.67
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.66
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 99.65
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.65
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 99.64
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.64
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.63
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.63
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.63
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.63
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.62
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.62
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.62
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.62
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.62
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.61
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.61
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.6
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.6
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.6
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.6
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.6
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.6
COG4181228 Predicted ABC-type transport system involved in ly 99.6
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.6
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.59
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.59
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 99.59
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.59
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.59
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.59
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.58
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.58
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.58
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.58
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.58
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.58
COG0410237 LivF ABC-type branched-chain amino acid transport 99.57
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.57
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.57
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.57
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.57
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.57
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.57
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.57
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.57
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.57
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.57
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.57
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.57
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.56
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.56
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.56
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.56
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.56
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.55
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.55
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.55
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.55
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.55
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.55
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.55
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.55
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.55
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.55
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.55
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.55
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.54
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.54
PRK10908222 cell division protein FtsE; Provisional 99.54
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.54
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.54
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.54
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.54
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.54
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.54
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.54
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.53
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.53
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.53
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.53
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.53
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.53
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.53
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.53
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.53
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.53
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.52
COG1123539 ATPase components of various ABC-type transport sy 99.52
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.52
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.52
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.52
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.52
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.52
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.52
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.52
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.52
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.52
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.52
COG4136213 ABC-type uncharacterized transport system, ATPase 99.52
PRK09984262 phosphonate/organophosphate ester transporter subu 99.51
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.51
COG4619223 ABC-type uncharacterized transport system, ATPase 99.51
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.51
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.51
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.51
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.51
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.51
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.51
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.51
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.51
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.51
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.51
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.51
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.5
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.5
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.5
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.5
COG4152300 ABC-type uncharacterized transport system, ATPase 99.5
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.49
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.49
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.49
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.49
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.49
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.49
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.49
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.49
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.49
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.49
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.49
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.49
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.49
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.49
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.48
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.48
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.48
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.48
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.48
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.48
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.48
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.48
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.48
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.48
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.48
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.48
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.47
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.47
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.47
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.47
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.47
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.47
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.47
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.47
COG4559259 ABC-type hemin transport system, ATPase component 99.47
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.47
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.47
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.47
cd03234226 ABCG_White The White subfamily represents ABC tran 99.46
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.46
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.46
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.46
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.46
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.46
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.46
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.46
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.45
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.45
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.45
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.45
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.45
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.45
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.45
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.45
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.45
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.45
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.45
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.45
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.45
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.45
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.44
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.44
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.44
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.44
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.44
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.44
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.44
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.44
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.43
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.43
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.43
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.43
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.43
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.43
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.43
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.43
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.43
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.43
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.42
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.42
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.42
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.42
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.42
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.42
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.42
COG1123539 ATPase components of various ABC-type transport sy 99.42
COG4988559 CydD ABC-type transport system involved in cytochr 99.41
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.41
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.41
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.41
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.41
COG0488530 Uup ATPase components of ABC transporters with dup 99.4
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.4
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.4
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.4
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.4
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.4
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.4
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.4
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.4
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.4
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.39
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.39
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.39
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.39
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.39
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.39
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.39
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.38
PRK10938490 putative molybdenum transport ATP-binding protein 99.38
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.38
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.38
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.38
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.37
PLN03211659 ABC transporter G-25; Provisional 99.37
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.36
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.36
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.36
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.36
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.36
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.35
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.35
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.35
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.35
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.35
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.34
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.34
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.34
PRK10938490 putative molybdenum transport ATP-binding protein 99.34
COG4172534 ABC-type uncharacterized transport system, duplica 99.33
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.33
COG4987573 CydC ABC-type transport system involved in cytochr 99.33
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.33
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.33
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.32
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.32
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.31
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.31
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.31
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.31
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.31
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.31
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.31
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.3
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.3
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.29
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.29
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.29
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.29
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.28
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.28
PLN032321495 ABC transporter C family member; Provisional 99.28
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.28
PRK13545549 tagH teichoic acids export protein ATP-binding sub 99.27
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.27
PLN031301622 ABC transporter C family member; Provisional 99.27
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.27
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 99.26
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.26
PRK11147635 ABC transporter ATPase component; Reviewed 99.26
cd03246173 ABCC_Protease_Secretion This family represents the 99.26
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.26
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.26
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.26
PRK11147 635 ABC transporter ATPase component; Reviewed 99.25
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.25
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.24
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.24
KOG0061613 consensus Transporter, ABC superfamily (Breast can 99.24
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.23
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.23
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.23
PTZ002431560 ABC transporter; Provisional 99.23
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.23
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.22
PRK13409590 putative ATPase RIL; Provisional 99.22
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.22
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.22
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.21
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.2
KOG00651391 consensus Pleiotropic drug resistance proteins (PD 99.19
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.19
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.19
PLN03140 1470 ABC transporter G family member; Provisional 99.18
PLN031401470 ABC transporter G family member; Provisional 99.18
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.18
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.18
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.18
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.18
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.17
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.16
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.15
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.14
PLN03073718 ABC transporter F family; Provisional 99.14
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.14
COG4133209 CcmA ABC-type transport system involved in cytochr 99.14
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.13
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.13
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.13
COG4586325 ABC-type uncharacterized transport system, ATPase 99.12
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.1
PRK13409590 putative ATPase RIL; Provisional 99.09
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.07
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.05
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 99.03
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.02
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.01
PLN03232 1495 ABC transporter C family member; Provisional 99.01
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.0
COG0488530 Uup ATPase components of ABC transporters with dup 99.0
COG4172534 ABC-type uncharacterized transport system, duplica 98.98
PLN03130 1622 ABC transporter C family member; Provisional 98.97
PTZ00243 1560 ABC transporter; Provisional 98.96
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 98.96
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 98.95
PLN03073718 ABC transporter F family; Provisional 98.93
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 98.93
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.92
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 98.91
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 98.87
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 98.83
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 98.71
KOG00541381 consensus Multidrug resistance-associated protein/ 98.69
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 98.68
KOG0927614 consensus Predicted transporter (ABC superfamily) 98.67
KOG0054 1381 consensus Multidrug resistance-associated protein/ 98.52
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 98.49
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 98.46
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 98.46
COG4615546 PvdE ABC-type siderophore export system, fused ATP 98.45
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 98.41
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 98.38
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 98.38
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 98.29
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 98.28
KOG0927614 consensus Predicted transporter (ABC superfamily) 98.25
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 98.23
KOG0062582 consensus ATPase component of ABC transporters wit 98.14
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 98.11
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 98.1
COG4178604 ABC-type uncharacterized transport system, permeas 98.06
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.94
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 97.88
COG1129500 MglA ABC-type sugar transport system, ATPase compo 97.87
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 97.86
KOG0062582 consensus ATPase component of ABC transporters wit 97.8
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 97.73
TIGR03238504 dnd_assoc_3 dnd system-associated protein 3. cereu 97.68
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 97.58
PRK00635 1809 excinuclease ABC subunit A; Provisional 97.5
KOG4181491 consensus Uncharacterized conserved protein [Funct 97.48
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 97.42
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 97.39
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.37
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 97.36
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 97.36
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 97.33
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 97.31
COG3845501 ABC-type uncharacterized transport systems, ATPase 97.27
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.23
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 97.18
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 97.16
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.14
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 97.12
PRK00300205 gmk guanylate kinase; Provisional 97.12
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 97.02
COG4170330 SapD ABC-type antimicrobial peptide transport syst 96.97
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.96
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 96.88
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 96.88
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 96.83
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 96.83
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 96.78
TIGR00436270 era GTP-binding protein Era. Era is an essential G 96.75
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 96.74
PRK00089292 era GTPase Era; Reviewed 96.71
PF1355562 AAA_29: P-loop containing region of AAA domain 96.68
PRK12288347 GTPase RsgA; Reviewed 96.67
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 96.66
PRK12289352 GTPase RsgA; Reviewed 96.66
COG1159298 Era GTPase [General function prediction only] 96.65
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 96.58
cd01878204 HflX HflX subfamily. A distinct conserved domain w 96.56
TIGR00235207 udk uridine kinase. Model contains a number of lon 96.55
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 96.53
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 96.51
PRK14737186 gmk guanylate kinase; Provisional 96.49
PRK00098298 GTPase RsgA; Reviewed 96.49
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 96.48
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 96.46
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 96.45
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 96.44
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 96.44
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 96.42
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 96.42
PRK14738206 gmk guanylate kinase; Provisional 96.41
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 96.38
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 96.37
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 96.34
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.33
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 96.32
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 96.32
PRK09270229 nucleoside triphosphate hydrolase domain-containin 96.29
PRK01889356 GTPase RsgA; Reviewed 96.29
PRK06002450 fliI flagellum-specific ATP synthase; Validated 96.29
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 96.21
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.19
PRK09825176 idnK D-gluconate kinase; Provisional 96.18
KOG2355291 consensus Predicted ABC-type transport, ATPase com 96.17
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 96.11
COG1162301 Predicted GTPases [General function prediction onl 96.1
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 96.1
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 96.08
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 96.07
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 96.07
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 96.05
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 96.05
cd00154159 Rab Rab family. Rab GTPases form the largest famil 96.03
PRK05480209 uridine/cytidine kinase; Provisional 96.02
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 96.02
COG5019373 CDC3 Septin family protein [Cell division and chro 95.95
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 95.94
PRK00454196 engB GTP-binding protein YsxC; Reviewed 95.94
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 95.93
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 95.93
TIGR00231161 small_GTP small GTP-binding protein domain. This m 95.92
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 95.89
PLN02318656 phosphoribulokinase/uridine kinase 95.89
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 95.89
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 95.88
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 95.87
cd04171164 SelB SelB subfamily. SelB is an elongation factor 95.87
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 95.85
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 95.84
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 95.83
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 95.79
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 95.79
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 95.75
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 95.75
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 95.72
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 95.71
cd01896233 DRG The developmentally regulated GTP-binding prot 95.71
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 95.69
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 95.68
PRK15494339 era GTPase Era; Provisional 95.66
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 95.66
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 95.66
PLN02796347 D-glycerate 3-kinase 95.64
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 95.63
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 95.62
>PF02263 GBP: Guanylate-binding protein, N-terminal domain; InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information 
Probab=100.00  E-value=6.6e-44  Score=365.36  Aligned_cols=242  Identities=39%  Similarity=0.653  Sum_probs=202.8

Q ss_pred             ceEEeccccccccccccccEEEEEEECCCCCCHHHHHHHHHcCCCCCCCcccccccCCCcceEEcCcccCccccCcceEE
Q 007480           41 TKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSV  120 (602)
Q Consensus        41 ~~l~~~~eal~iL~~Is~~V~vVsIvG~~gsGKStLLn~L~g~~~~~gF~vg~t~~~~TkGIwi~~~~~~~~~~~~~~~v  120 (602)
                      ++|.++++|++.|+.++.||.||+|+|++|+|||||||.|+|.  .+||+||++.++||+|||||++|.+   .++++++
T Consensus         2 ~~~~~~~~al~~l~~~~~~v~vvsi~G~~rtGKSfLln~l~~~--~~gF~~~~~~~~~T~Giw~w~~~~~---~~~~~~v   76 (260)
T PF02263_consen    2 NKLELNEEALEILQQIDQPVAVVSIVGPYRTGKSFLLNQLLGP--QSGFSWGPTVEPCTKGIWMWSEPLP---DGEKVAV   76 (260)
T ss_dssp             TEEEE-HHHHHHHCTTTSBEEEEEEEEETTSSHHHHHHHHCCB--SSSSESSSCSSST-SCEEEECCE-T---TSTCEEE
T ss_pred             CeEEECHHHHHHHhcCCCCEEEEEeecCCccchHHHHHHHhcc--cccccccCCCCCCCcceeeeecccc---cccceeE
Confidence            5799999999999999999999999999999999999999985  6899999999999999999999943   3678999


Q ss_pred             EeeccccccccCCCCc-hhHHHHHHHhhhhhhhhcccchhhhHHHHHHHHHHHhhhhhhhcccC-----CcccccCcccc
Q 007480          121 FYLDTEGFESIGKSNV-YDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVK-----GQDVAFEPAKL  194 (602)
Q Consensus       121 vl~DteG~~~~~~~tv-~d~~ifaLa~LLSS~~IyN~~~~i~e~~l~~L~~~~~L~~~i~~~~~-----~e~~~f~P~~f  194 (602)
                      +++||||+++.+..+. +|..+|++++||||++|||+++.+++++++.|..++++++.+..+..     .+...++|. |
T Consensus        77 ~llDteG~~~~~~~~~~~d~~if~Ls~LLSS~~IyN~~~~i~~~~l~~L~~~~~l~~~i~~~~~~~~~~~~~~~~fp~-l  155 (260)
T PF02263_consen   77 VLLDTEGLGDVEQSDEKYDAKIFALSMLLSSVLIYNSMGNIDEDDLDQLELFTELAKHIRVKYGDSADSEDLGKPFPS-L  155 (260)
T ss_dssp             EEEEEECBTTTTCCCCHHCHHHHHHHHHH-SEEEEEECSSSSHHHHHCCHHHHHHHHHHHHTHHHHHHHHCTTTTCEE-E
T ss_pred             EEecchhccccccCcccccHHHHHHHHHHhCceeeCCCCccchhHHHHHHHHHHHHHHHHHhcccccchhhhcccchH-H
Confidence            9999999988655554 68999999999999999999999999999999999999998865421     223456774 9


Q ss_pred             hhhhhhccCC-----c--ccHHHHHHHHHHhCCCCCCCCCchhhhhHHHHHHhhcCCCcEEEccCccchhcc---cCCCC
Q 007480          195 VWLIQRDFLQ-----G--KSVQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLLRTK---LCDMK  264 (602)
Q Consensus       195 lw~vvRDf~~-----g--~t~~eyLe~aL~~~~~~~~~~~i~~ln~~r~~i~~~f~~~~cf~L~~P~~~~~~---L~d~p  264 (602)
                      .|++ |||+.     |  .++++||+++|+...+.  ++.+.+.|.+|++|+.+|++++||+||+|+.+++.   +.+++
T Consensus       156 ~wlv-RDf~~~~~~~~~~~t~~eyLe~~L~~~~~~--~~~~~~~N~iR~~I~~~F~~~~cf~Lp~P~~~~~~l~~l~~l~  232 (260)
T PF02263_consen  156 VWLV-RDFSLELEDDGGKITPQEYLEQALKPESGQ--DEEIQERNKIRECIRSCFPSRDCFTLPHPGSDVDKLQNLDGLS  232 (260)
T ss_dssp             EEEE-ECE-SCTCCTTECHHHHHHHHHHCCSSTSS--SCCCCCHHHHHHHHHHHECCEEEEEEE-SSCCCCC-TCGCCCB
T ss_pred             HHHH-hhccchhhhccCCCCHHHHHHHHHhcccch--hHHHHHhhHHHHHHHHHCCCCeEEEecCCCchhhhccCcccCC
Confidence            9987 99982     2  37999999999865543  46778899999999999999999999999998765   44557


Q ss_pred             CCCCCHHHHHHHHHHHHHHhhhcCCCc
Q 007480          265 DEELDPIYVKRREQLKKLVASVTRPKI  291 (602)
Q Consensus       265 ~~~Ld~~F~e~~~~L~~~I~~~~~pK~  291 (602)
                      .++|+|+|++++++|+++|++..++|+
T Consensus       233 ~~~L~~eF~~~l~~l~~~i~~~~~~k~  259 (260)
T PF02263_consen  233 LDDLDPEFVEQLDELVKYIFSSAKVKT  259 (260)
T ss_dssp             GGGS-HHHHHHHHHHHHHHHCCT---B
T ss_pred             hhhCCHHHHHHHHHHHHHHhccCCccc
Confidence            899999999999999999998777775

GTPases induced by IFN-gamma are key to the protective immunity against microbial and viral pathogens. These GTPases are classified into three groups: the small 47-kd GTPases, the Mx proteins, and the large 65- to 67-kd GTPases. Guanylate-binding proteins (GBP) fall into the last class. In humans, there are seven GBPs (hGBP1-7) []. Structurally, hGBP1 consists of two domains: a compact globular N-terminal domain harbouring the GTPase function, and an alpha-helical finger-like C-terminal domain (IPR003191 from INTERPRO). Human GBP1 is secreted from cells without the need of a leader peptide, and has been shown to exhibit antiviral activity against Vesicular stomatitis virus and Encephalomyocarditis virus, as well as being able to regulate the inhibition of proliferation and invasion of endothelial cells in response to IFN-gamma [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3QOF_A 3Q5E_C 3QNU_A 3Q5D_A 1DG3_A 2D4H_A 2B8W_B 2B92_A 2BC9_A 1F5N_A.
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>KOG2037 consensus Guanylate-binding protein [General function prediction only] Back     alignment and domain information
>PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information
>PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2203 consensus GTP-binding protein [General function prediction only] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2037 consensus Guanylate-binding protein [General function prediction only] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>KOG4181 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
1dg3_A592 Structure Of Human Guanylate Binding Protein-1 In N 3e-25
2b8w_A328 Crystal-Structure Of The N-Terminal Large Gtpase Do 1e-19
4idq_A447 Human Atlastin-1 1-446, N440t, Gdpalf4- Length = 44 6e-18
3q5e_A447 Crystal Structure Of Human Atlastin-1 (Residues 1-4 7e-18
3qnu_A459 Crystal Structure Of The Cytosolic Domain Of Human 9e-18
4idn_A457 Human Atlastin-1 1-446, C-his6, Gppnhp Length = 457 9e-18
4idp_A447 Human Atlastin-1 1-446, N440t, Gppnhp Length = 447 7e-16
3q5d_A447 Crystal Structure Of Human Atlastin-1 (Residues 1-4 8e-16
>pdb|1DG3|A Chain A, Structure Of Human Guanylate Binding Protein-1 In Nucleotide Free Form Length = 592 Back     alignment and structure 
Iteration: 1

 Score =  113 bits (283), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 114/452 (25%), Positives = 201/452 (44%), Gaps = 68/452 (15%)
Query: 27  FHQAFPIVEPDPGHTKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCD 86
            H   P+   +  + +L  + E L+ +  IT P+  +A++G YR+GKS+L+N+L      
Sbjct: 5   IHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKK-- 62
Query: 87  EGFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKSNVYDDR-IFALA 145
           +GF +G    + TKGIW+W  P           +  LDTEG   + K +  +D  IFALA
Sbjct: 63  KGFSLGSTVQSHTKGIWMWCVP---HPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALA 119
Query: 146 TVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQD-----------VAFEPAKL 194
            ++SS  +YN   TI +  + +L +  EL      +    +           V+F P   
Sbjct: 120 VLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFP-DF 178
Query: 195 VWLIQRDFLQGKSVQEMVHDALQRVPND---------KGDKNIDMV-NQIRNSLAIMGDN 244
           VW + RDF       ++  D     P++         KG    D   N  R  +      
Sbjct: 179 VWTL-RDF-----SLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPK 232
Query: 245 STAFSLPQPHLLR--TKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQGKF-LNGNE 301
              F   +P   R   +L  ++DEELDP +V++       + S ++ K + G   +NG  
Sbjct: 233 KKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPR 292
Query: 302 FVAFMEQILEALNKGEIP----STGSLVEVFNKGILERCLKLYNERMAKVRLPLPEQSLQ 357
             + +   + A++ G++P    +  +L ++ N   +++ +  Y ++M + ++ LP +SLQ
Sbjct: 293 LESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQ-KVQLPTESLQ 351
Query: 358 ---DAHERSKKEAMDVF------DVQHFGRQHAKKSVMQLDEEIQEAYKNVIMANEYQSS 408
              D H  S++EA++VF      DV H  ++       +L  ++++   +    N+  SS
Sbjct: 352 ELLDLHRDSEREAIEVFIRSSFKDVDHLFQK-------ELAAQLEKKRDDFCKQNQEASS 404
Query: 409 KICESLYTRCEDKMDQLQVLRLPSMAKFNAGF 440
             C  L          LQV+  P   +  AG 
Sbjct: 405 DRCSGL----------LQVIFSPLEEEVKAGI 426
>pdb|2B8W|A Chain A, Crystal-Structure Of The N-Terminal Large Gtpase Domain Of Human Guanylate Binding Protein 1 (Hgbp1) In Complex With GmpALF4 Length = 328 Back     alignment and structure
>pdb|4IDQ|A Chain A, Human Atlastin-1 1-446, N440t, Gdpalf4- Length = 447 Back     alignment and structure
>pdb|3Q5E|A Chain A, Crystal Structure Of Human Atlastin-1 (Residues 1-447) Bound To Gdp, Crystal Form 2 Length = 447 Back     alignment and structure
>pdb|3QNU|A Chain A, Crystal Structure Of The Cytosolic Domain Of Human Atlastin-1 In Complex With Gdp, Hexagonal Form Length = 459 Back     alignment and structure
>pdb|4IDN|A Chain A, Human Atlastin-1 1-446, C-his6, Gppnhp Length = 457 Back     alignment and structure
>pdb|4IDP|A Chain A, Human Atlastin-1 1-446, N440t, Gppnhp Length = 447 Back     alignment and structure
>pdb|3Q5D|A Chain A, Crystal Structure Of Human Atlastin-1 (Residues 1-447) Bound To Gdp, Crystal Form 1 Length = 447 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 3e-76
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 2e-67
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
 Score =  252 bits (645), Expect = 3e-76
 Identities = 110/468 (23%), Positives = 194/468 (41%), Gaps = 37/468 (7%)

Query: 28  HQAFPIVEPDPGHTKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDE 87
           H   P+   +  + +L  + E L+ +  IT P+  +A++G YR+GKS+L+N+L      +
Sbjct: 6   HMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKL--AGKKK 63

Query: 88  GFGVGHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKS-NVYDDRIFALAT 146
           GF +G    + TKGIW+W  P           +  LDTEG   + K  N  D  IFALA 
Sbjct: 64  GFSLGSTVQSHTKGIWMWCVPHP---KKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAV 120

Query: 147 VMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFEPA----------KLVW 196
           ++SS  +YN   TI +  + +L +  EL      +    +   E              VW
Sbjct: 121 LLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVW 180

Query: 197 LIQRDF---LQGKSVQEMVHDALQRVPNDKG--DKNIDMVNQIRNSLAIMGDNSTAFSLP 251
            + RDF   L+         + L      K    +  +  N  R  +         F   
Sbjct: 181 TL-RDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFD 239

Query: 252 QPHLLR--TKLCDMKDEELDPIYVKRREQLKKLVASVTRPK-IVQGKFLNGNEFVAFMEQ 308
           +P   R   +L  ++DEELDP +V++       + S ++ K +  G  +NG    + +  
Sbjct: 240 RPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLT 299

Query: 309 ILEALNKGEIPSTGSLV----EVFNKGILERCLKLYNERM-AKVRLP-LPEQSLQDAHER 362
            + A++ G++P   + V    ++ N   +++ +  Y ++M  KV+LP    Q L D H  
Sbjct: 300 YVNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTESLQELLDLHRD 359

Query: 363 SKKEAMDVFDVQHFGRQHAKKSVMQLDEEIQEAYKNVIMANEYQSSKICESLYTRCEDKM 422
           S++EA++VF    F          +L  ++++   +    N+  SS  C  L       +
Sbjct: 360 SEREAIEVFIRSSFKDVDHLFQ-KELAAQLEKKRDDFCKQNQEASSDRCSGLLQVIFSPL 418

Query: 423 DQLQVLRLPSMAKFNAGFLQ-----CNQSFAHECVGPSKANYEQRMMK 465
           ++     + S       F+Q       + +     G       Q  +K
Sbjct: 419 EEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLK 466
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Length = 447 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 602
d1f5na2277 c.37.1.8 (A:7-283) Interferon-induced guanylate-bi 1e-53
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 8e-18
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  182 bits (462), Expect = 1e-53
 Identities = 70/278 (25%), Positives = 116/278 (41%), Gaps = 22/278 (7%)

Query: 32  PIVEPDPGHTKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDEGFGV 91
           P+   +  + +L  + E L+ +  IT P+  +A++G YR+GKS+L+N+L      +GF +
Sbjct: 4   PMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKL--AGKKKGFSL 61

Query: 92  GHMRDTKTKGIWVWGNPVEMEIDGSRTSVFYLDTEGFESIGKS-NVYDDRIFALATVMSS 150
           G    + TKGIW+W  P           +  LDTEG   + K  N  D  IFALA ++SS
Sbjct: 62  GSTVQSHTKGIWMWCVPHP---KKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSS 118

Query: 151 VLIYNLPETIREADISRLSFAVELAEEFYGRVKGQDVAFE---------PAKLVWLIQRD 201
             +YN   TI +  + +L +  EL      +    +   E                  RD
Sbjct: 119 TFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTLRD 178

Query: 202 F---LQGKSVQEMVHDALQRV--PNDKGDKNIDMVNQIRNSLAIMGDNSTAFSLPQPHLL 256
           F   L+         + L           +  +  N  R  +         F   +P   
Sbjct: 179 FSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHR 238

Query: 257 R--TKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIV 292
           R   +L  ++DEELDP +V++       + S ++ K +
Sbjct: 239 RKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTL 276
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query602
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 100.0
d1f5na1300 Interferon-induced guanylate-binding protein 1 (GB 99.87
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.84
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.83
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.83
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.83
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.83
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.81
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.81
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.79
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.78
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.78
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.78
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.73
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.68
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.68
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.68
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.64
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.64
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.59
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.55
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.51
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 97.68
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 97.33
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.25
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.17
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.85
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.61
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.58
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.54
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.51
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 96.36
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 96.35
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 96.34
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 96.32
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 96.25
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 96.11
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.06
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.99
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.94
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.56
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.48
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.45
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.28
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.27
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 95.24
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.2
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.18
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.17
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 95.13
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.11
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.1
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.06
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.04
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 94.95
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.94
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.9
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.71
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.68
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.67
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.63
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 94.51
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 94.48
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 94.46
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 94.37
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 94.3
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 94.29
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 94.23
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 94.19
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 94.15
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.11
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.1
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.04
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.95
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 93.93
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.86
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 93.86
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.84
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.84
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 93.82
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.8
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.78
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 93.69
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.64
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.61
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 93.6
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.56
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 93.52
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 93.52
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 93.51
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 93.42
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.4
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 93.34
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.33
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 93.3
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 93.26
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.25
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.22
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.18
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 93.18
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.16
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.11
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 93.1
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 93.1
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 93.1
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 93.08
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 92.97
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 92.96
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.94
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 92.89
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.85
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.81
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 92.79
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.76
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.59
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.58
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 92.51
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.47
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 92.45
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 92.39
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.37
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.2
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 92.18
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.1
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.97
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 91.86
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.85
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 91.75
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 91.69
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 91.5
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 91.44
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.43
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.42
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 91.38
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.36
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 91.03
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.91
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 90.9
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 90.75
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 90.72
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 90.44
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 90.42
d2qy9a2211 GTPase domain of the signal recognition particle r 90.31
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 90.21
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 90.15
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 90.14
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 89.99
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 89.91
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 89.88
d1ls1a2207 GTPase domain of the signal sequence recognition p 89.84
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 89.65
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 89.59
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 89.51
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 89.48
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 89.42
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 89.38
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 89.34
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.32
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.3
d1okkd2207 GTPase domain of the signal recognition particle r 89.22
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 88.99
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 88.89
d1j8yf2211 GTPase domain of the signal sequence recognition p 88.84
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 88.68
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 88.42
d1vmaa2213 GTPase domain of the signal recognition particle r 88.38
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 88.34
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 88.16
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 88.13
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 88.02
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 87.94
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 87.89
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 87.71
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 87.58
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 87.56
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 87.55
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 87.46
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 87.28
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 87.22
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 87.0
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 86.78
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 86.72
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 86.6
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 86.34
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 86.29
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 85.85
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 85.75
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 85.67
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 85.61
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.6
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 85.53
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 85.44
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 85.17
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 85.01
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 84.97
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 84.7
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 84.14
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 83.87
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 83.86
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 83.75
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 83.44
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 83.12
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 83.02
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 83.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 82.75
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 82.56
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 82.44
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 82.33
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 82.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 81.76
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 81.62
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 81.5
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 81.12
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 80.86
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 80.73
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=0  Score=345.45  Aligned_cols=255  Identities=29%  Similarity=0.504  Sum_probs=219.7

Q ss_pred             CCCEEEECCCCCEEEECCCCCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             52478308995248845432212223232289999987999998899999972778889854445557886669809446
Q 007480           30 AFPIVEPDPGHTKLRLSREGLETIRRITNPIAAIAVIGPYRSGKSFLLNQLLSLSCDEGFGVGHMRDTKTKGIWVWGNPV  109 (602)
Q Consensus        30 ~~plv~~~~~~~~l~v~~eal~iL~~I~~~V~VVsIiG~~gsGKStLLN~L~g~~~~~GF~vg~t~~~~TkGIwi~~~p~  109 (602)
                      |.|++.+++.++++.++++|+++|+.++.||.||||+|++|+|||||||.|+|.  ..||++|+++.+||+|||||+.|+
T Consensus         2 ~~p~~li~~~~~~l~~~~e~l~~l~~~~~~v~vvsi~G~~~sGKS~llN~l~~~--~~~f~~~~~~~~~T~Giw~~~~~~   79 (277)
T d1f5na2           2 TGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGK--KKGFSLGSTVQSHTKGIWMWCVPH   79 (277)
T ss_dssp             CSCEEEEEEETTEEEECHHHHHHHHTCCSBEEEEEEEEBTTSSHHHHHHHHTTC--SSCSCCCCSSSCCCCSEEEEEEEC
T ss_pred             CCCEEEEECCCCEEEECHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHCCC--CCCCCCCCCCCCCCCCEEEEEEEC
T ss_conf             988589976999499899999999707998799998899999799999998099--878764787777777658998541


Q ss_pred             CCCCCCCCEEEEEECCCCCCCCCCCC-CHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCC---
Q ss_conf             75445762279851465544458887-12479999986311334315611123778989999972456631346786---
Q 007480          110 EMEIDGSRTSVFYLDTEGFESIGKSN-VYDDRIFALATVMSSVLIYNLPETIREADISRLSFAVELAEEFYGRVKGQ---  185 (602)
Q Consensus       110 ~~~~~~~~~~ivllDteG~~~~~~~t-~~d~~ifaLa~LLSS~lIyN~~~~i~e~~i~~L~~v~~L~~~i~~~~~~~---  185 (602)
                      ..   +.+..++++||||+.+.+..+ .+|..+|+++++|||++|||+++.+++++++.|..++++++.++.+....   
T Consensus        80 ~~---~~~~~~~~lDteG~~~~~~~~~~~~~~i~~l~~llSs~~i~N~~~~~~~~~l~~L~~~~~~~~~~~~~~~~~~~~  156 (277)
T d1f5na2          80 PK---KPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENE  156 (277)
T ss_dssp             SS---STTCEEEEEEECCBCCGGGCCCTTHHHHHHHHHHHCSEEEEEEESCSSHHHHHTTHHHHTHHHHCBSCCC-----
T ss_pred             CC---CCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             57---887469998245434544465045799999999972879993215576899999899999999999863232111


Q ss_pred             --------CCCCCCCCCHHHHHHCCCC-----C--CCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEC
Q ss_conf             --------5556742102343203688-----0--009999999997199998999811133699999731588747871
Q 007480          186 --------DVAFEPAKLVWLIQRDFLQ-----G--KSVQEMVHDALQRVPNDKGDKNIDMVNQIRNSLAIMGDNSTAFSL  250 (602)
Q Consensus       186 --------~~~f~P~~flw~vvRDf~~-----g--~t~~eyLe~aL~~~~~~~~~~~~~~ln~~r~~i~~~f~~~~cf~L  250 (602)
                              ...++| .++|++ |||+.     +  .++++||+++|+...+.  +...+..|.+|++|.++|+++.||+|
T Consensus       157 ~~~~~~~~~~~~~p-~l~~vv-RD~~~~~~~~~~~~t~~eyLe~~l~~~~~~--~~~~~~~N~~R~~i~~~F~dv~cf~L  232 (277)
T d1f5na2         157 NEVEDSADFVSFFP-DFVWTL-RDFSLDLEADGQPLTPDEYLTYSLKLKKGT--SQKDETFNLPRLCIRKFFPKKKCFVF  232 (277)
T ss_dssp             --CCGGGGHHHHCC-EEEEEE-ETCCCCCCCSSSCCCHHHHHHHHTCCCCCC--SHHHHHHHHHHHHHHHHCSCEEEEEC
T ss_pred             CCCCCCHHHCCCCC-CEEEEE-ECCCCCCCCCCCCCCHHHHHHHHHHCCCCC--HHHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             34344111126688-359984-213221224677466889999997405684--06667663699999986688737867


Q ss_pred             CCCCCHH--CCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             6951001--004899988889889999999999996320887314
Q 007480          251 PQPHLLR--TKLCDMKDEELDPIYVKRREQLKKLVASVTRPKIVQ  293 (602)
Q Consensus       251 ~~P~~~~--~~L~d~~~~~Ldp~F~e~~~~L~~~I~~~~~pK~l~  293 (602)
                      |+|+..+  ..+.+.+.++|+|+|++++++|+++|++.++||+++
T Consensus       233 p~P~~~~~l~~l~~~~~~~L~~~F~~~v~~L~k~I~~~~~~K~ln  277 (277)
T d1f5na2         233 DRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLS  277 (277)
T ss_dssp             CCCSCGGGGGGGGGSCGGGSCHHHHHHHHHHHHHHHHHCCCCEET
T ss_pred             CCCCCHHHHCHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             887603440233138820048989999999999996328886369
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure