Citrus Sinensis ID: 007516

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600

MPVLRSRVIPPTKPEIEPLKHPANKIEPATPARTWDTTRPASSGDDDGGDAGRKRKLDVSENLLGLEGGDSEGFLNLRSGKKVIKRIGETDGGNSVDGKEKENGKETMDFEEVRMLREVSKDGADVDKLDIKQNADGSCSEKRRRRFGREEKGKAKLIDEDSTVNGSEFINLDLELGTKHSEENVGSVSEPRTEQRVDKKSSVRLSESRMEQFRDIARQNASKFAYFNVEENHLSDDNERLVVADGEVGREIEDWPGPFSTAMKIVRDREKKLSGGQRIGSLDPKKKSNSSILWIPRKGQRQGPKLIIPSLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLRDCSWLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAFRFVFHRDFGV

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccHHHHHcHHHHHHcccccccccccccccccccHHccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccHHHHHHHHcccccEEEEcccccccHHHHHHHHHHcccccccEEEcccccccccccccHHHHHHHHcccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHccccccEEcccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEcccccHHHHHHHcccc

ccEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccEEEEccccEEEEEEEEEcccccccccccccccccEEEEEEEEEcccccccccccEEEEEccccccccccccEEcccccccccEEEEccccccccccccccccccEEEccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccccccHccccccHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHcccccEEEccccccccHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccEEEccccccccHHHHHHHHHHccccccEEEEcHccHccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccHcEEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccEEEcccccHccHHHHHHHHHccccccEEEccccEEEEEcHccccc

mpvlrsrvipptkpeieplkhpankiepatpartwdttrpassgdddggdagrkrkldvsenllgleggdsegflnLRSGKKVIKRIgetdggnsvdgkekengketmdFEEVRMLREVskdgadvdkldikqnadgscsekrrrrfgreekgkaklidedstvngsefinldlelgtkhseenvgsvseprteqrvdkkssvRLSESRMEQFRDIARQNASKFAYFNveenhlsddnerlvvadgevgreiedwpgpfsTAMKIVRDREkklsggqrigsldpkkksnssilwiprkgqrqgpkliipSLKELSMKILVQNADAITSLEHVPDALRHKLSFmlcdsrqmnSHFLnllfsgspteirlrdcswLTEQEFTKAFVscdtknltvlqldrcgrcmpdYILLSTLASslnslpslttlsicgacrisdVGFKALvtsapalrsinlsqcsllsstSVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLSVAGIETVTDEFVRGFVYACGhnmkeliltDCVKLTDFSLKVIAETcprlctldlsnlykltdfgigylaNGCQAIQTLKLCRNAFRFVFHRDFGV

mpvlrsrvipptkpeieplkhpankiepatpartwdttrpassgdddggdagRKRKLDvsenllgleggdsegflnlRSGKKVIkrigetdggnsvdgkekengketmdfeeVRMLREVskdgadvdkldikqnadgscsekrrrrfgreekgkaklidedstvngsEFINLDlelgtkhseenvgsvseprteqrvdkkssvrlsesrmEQFRDIARQNASKFAYFNVeenhlsddnerLVVADGEVgreiedwpgpfstaMKIVRDREkklsggqrigsldpkkksnssilwiprkgqrqgpKLIIPSLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLRDCSWLTEQEFTkafvscdtknlTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAFRFVFHRDFGV

MPVLRSRVIPPTKPEIEPLKHPANKIEPATPARTWDTTRPassgdddggdagRKRKLDVSENLLGLEGGDSEGFLNLRSGKKVIKRIGETDGGNSVDGKEKENGKETMDFEEVRMLREVSKDGADVDKLDIKQNADGSCSekrrrrfgreekgkAKLIDEDSTVNGSEFINLDLELGTKHSEENVGSVSEPRTEQRVDKKSSVRLSESRMEQFRDIARQNASKFAYFNVEENHLSDDNERLVVADGEVGREIEDWPGPFSTAMKIVRDREKKLSGGQRIGSLDPKKKSNSSILWIPRKGQRQGPKLIIPSLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLRDCSWLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYIllstlasslnslpslttlsICGACRISDVGFKALVTSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAFRFVFHRDFGV

******************************************************************************************************************************************************************************************************************************KFAYFNVEENHL****ERLVVADGEVGREIEDWPGPF********************************ILWIPR******PKLIIPSLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLRDCSWLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAFRFVFHRD***

***************************************************************************************************************************************************************************************************************************************************************PGPFSTAMKIV***************************************LIIPSLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLRDCSWLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAFRFVFHRDFGV

MPVLRSRVIPPTKPEIEPLKHPANKIEPATPA*********************KRKLDVSENLLGLEGGDSEGFLNLRSGKKVIKRIGETDGGNSVDGKEKENGKETMDFEEVRMLREVSKDGADVDKLDIKQNADGSCSEKRRRRFGREEKGKAKLIDEDSTVNGSEFINLDLELGTK******************************MEQFRDIARQNASKFAYFNVEENHLSDDNERLVVADGEVGREIEDWPGPFSTAMKIVRDREKKLSGGQRIGS********SSILWIPRKGQRQGPKLIIPSLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLRDCSWLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAFRFVFHRDFGV

*********P************A****PATP***W******S*GDDDGGDAGRKRKLDVSENLLGLEGGDSEGFLNLRSGKKVIKRIGETDGGNSVDGKEKENGKETMDFEEVRMLREVSKDGADVDKLDIKQNA********RRRFGR*EKGKAKLIDEDSTVNGSEFINLDLELGTKHS*****************************EQFRDIARQNASKFAYFN***********************IEDWPGPFSTAMKIVRDREKKLSGGQRIGSLDPKKKSNSSILWIPRKGQRQGPKLIIPSLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLRDCSWLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAFRFVFHR*F*V

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		600	2.2.26 [Sep-21-2011]
O74999		563	DNA repair protein rhp7 O	yes	no	0.411	0.438	0.265	2e-11
Q8NEE6		735	F-box/LRR-repeat protein	no	no	0.25	0.204	0.341	6e-10
Q96IG2		436	F-box/LRR-repeat protein	no	no	0.243	0.334	0.317	1e-09
Q58DG6		436	F-box/LRR-repeat protein	yes	no	0.243	0.334	0.317	1e-09
Q9QZH7		276	F-box/LRR-repeat protein	yes	no	0.243	0.528	0.311	6e-09
Q9CZV8		436	F-box/LRR-repeat protein	yes	no	0.243	0.334	0.311	6e-09
Q8N1E6		418	F-box/LRR-repeat protein	no	no	0.355	0.509	0.255	2e-07
Q9C5D2		610	F-box/LRR-repeat protein	no	no	0.243	0.239	0.305	4e-07
E1BNS0		300	F-box/LRR-repeat protein	no	no	0.31	0.62	0.248	4e-07
C8V4D4		585	SCF E3 ubiquitin ligase c	no	no	0.343	0.352	0.242	4e-07

>sp\|O74999\|RAD7_SCHPO DNA repair protein rhp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp7 PE=3 SV=1	Back alignment and function desciption

 Score = 71.6 bits (174), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 120/267 (44%), Gaps = 20/267 (7%)

Query: 308 IPSLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIR 367
           +P L++L ++++ +  + I +   +      K+S ++  +R +N   + L  SG  TE++
Sbjct: 188 VPKLQDLCIRVIAEYINDIEAFGDIGQVNMDKISQIISKNRSLNDTTVKLFLSGGQTELK 247

Query: 368 LRDCSWLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSI 427
           L DCS +T     +    C   NL  L L  CG+ M D +    L    + L  LT +S 
Sbjct: 248 LYDCSKITADSLFQIAQYC--PNLQTLHLTYCGQ-MQDQV----LHFYADHLTELTDVSF 300

Query: 428 CGACRISDVGFKALVTS-APALRSINLSQCSLLSSTSVDILADKLGSFI-----QELYIN 481
            GA  +S   +          L S+ L+  + +  + ++ + D   + I     +  Y++
Sbjct: 301 QGAFLVSSSEWINFFKKRGSKLISLELTDTARIHVSVINAIVDCCPNLISLNLSRIFYLD 360

Query: 482 DCQSLNAMLILPALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTD 541
           D      + +L   R L  L++ S  GI  + D  +   +   G  +  L L+ C KLTD
Sbjct: 361 D----ECVRLLAGCRNLVSLKIESPGGI--INDGSILDVLNQIGSGLHTLSLSGCTKLTD 414

Query: 542 FSLKV-IAETCPRLCTLDLSNLYKLTD 567
             LK  I   C RL  L+LS L  LTD
Sbjct: 415 EVLKQGIGPCCGRLKHLNLSGLELLTD 441

Involved in global genome repair (GGR) via nucleotide excision repair (NER), in conjunction with rhp16, after UV irradiation.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)

>sp\|Q8NEE6\|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3	Back alignment and function description

>sp\|Q96IG2\|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2	Back alignment and function description

>sp\|Q58DG6\|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2	Back alignment and function description

>sp\|Q9QZH7\|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1	Back alignment and function description

>sp\|Q9CZV8\|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3	Back alignment and function description

>sp\|Q8N1E6\|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1	Back alignment and function description

>sp\|Q9C5D2\|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1	Back alignment and function description

>sp\|E1BNS0\|FXL15_BOVIN F-box/LRR-repeat protein 15 OS=Bos taurus GN=FBXL15 PE=3 SV=1	Back alignment and function description

>sp\|C8V4D4\|GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=grrA PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		600
255550465		765	rad7, putative [Ricinus communis] gi\|223	0.958	0.751	0.488	1e-149
297738570		832	unnamed protein product [Vitis vinifera]	0.85	0.612	0.519	1e-139
225444746		905	PREDICTED: uncharacterized protein LOC10	0.873	0.579	0.476	1e-134
356556384		541	PREDICTED: uncharacterized F-box/LRR-rep	0.62	0.687	0.609	1e-126
297835860		773	hypothetical protein ARALYDRAFT_319345 [	0.95	0.737	0.419	1e-124
51968756		762	hypothetical protein [Arabidopsis thalia	0.958	0.754	0.429	1e-124
145359938		762	uncharacterized protein [Arabidopsis tha	0.961	0.757	0.429	1e-124
110738495		762	hypothetical protein [Arabidopsis thalia	0.961	0.757	0.429	1e-123
356565796		675	PREDICTED: DNA repair protein rhp7-like	0.601	0.534	0.569	1e-117
449500555		875	PREDICTED: uncharacterized LOC101209944	0.605	0.414	0.518	1e-105

>gi\|255550465\|ref\|XP_002516283.1\| rad7, putative [Ricinus communis] gi\|223544769\|gb\|EEF46285.1\| rad7, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  536 bits (1380), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 313/641 (48%), Positives = 417/641 (65%), Gaps = 66/641 (10%)

Query: 1   MPVLRSRVI--PPTKPEIEPLKHPANKIEPAT-----PARTW--DTTRP-----ASSGDD 46
           M +LRSR I  P TK   EP+  PA   EP+T     P+     D+TR      AS    
Sbjct: 1   MVMLRSRKILCPSTKSLPEPVT-PAQTREPSTRRLSLPSHELGSDSTRRRSLRLASKSVP 59

Query: 47  DGGDAGRKRKL-----------------DVSENLLGLEGGDSEGFLNLRSGKKVIKRIGE 89
              +  RKRK+                  V++N    +  DSE  L+LRSGK+V+KR  E
Sbjct: 60  RDQNGSRKRKISSIEKEKEETEEQNSAFQVNDN----DNVDSEMILSLRSGKRVVKRKVE 115

Query: 90  TDGGNSVDGKEKENGKETMDFEEVRMLREVSKDGADV-DKLDIKQNA-DGSCSEK----- 142
            D G ++  + K+     ++ EE   + +  K  A + +KL  KQ+  +G+CS +     
Sbjct: 116 YDSGENLVIEAKD-----LNVEEFENVSDKDKGKAKLTEKLMEKQSVVEGNCSSRLEVNK 170

Query: 143 ----------RRRRFGREEKGKAKLIDEDSTVNGSEFINLDLELGTKHSEENVGS--VSE 190
                      +RR+ REEKGKA L D+D   N      L+L+   K    ++G   V  
Sbjct: 171 FSHESSNSMRTKRRYSREEKGKANL-DDDGLSNSIGKDELELQSKVKELGHSLGENVVLL 229

Query: 191 PRTEQRVDKKSSVRLSESRMEQFRDIARQNASKFAYFNVEEN-HLSDDNERLVVADGEVG 249
           P  E++    ++   +ESRM+QFRDIA +NAS+FA F+ +E+ +L  + + + ++  E  
Sbjct: 230 PGNERQTMNINTSNKNESRMDQFRDIATRNASRFAQFDRQEDENLPSEVDNVEISSVEEN 289

Query: 250 REIEDWPGPFSTAMKIVRDREKKLSGGQRIGSLDPKKKSNSSILWIPRKGQRQGPKLIIP 309
             IEDWPGPFSTAMKI+RDR    +  Q   +L+  K  +  I W+P + ++   +  +P
Sbjct: 290 ERIEDWPGPFSTAMKIIRDRANMRNSQQGASTLE--KPQSVPITWVPTRNRQS--RTCVP 345

Query: 310 SLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLR 369
           SL+EL M+I+V+N DA+TSL+HVPDALRH+L  +LCD R+MNS FL+LL  GSPTEIR++
Sbjct: 346 SLQELCMRIIVKNVDAVTSLDHVPDALRHRLCQLLCDCRKMNSSFLDLLVRGSPTEIRVK 405

Query: 370 DCSWLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICG 429
           DCSW++E+E  K F  CDT NL+VLQLD+CGRCMPDY++ +TLA S  SLP+L TLS+CG
Sbjct: 406 DCSWMSEEELVKCFEGCDTNNLSVLQLDQCGRCMPDYVIPATLARSSRSLPALITLSLCG 465

Query: 430 ACRISDVGFKALVTSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQSLNAM 489
           ACR+SD+G   LV SA +LRSINLSQCS L+STS+  LAD LGS ++ELYI+DCQSL+AM
Sbjct: 466 ACRLSDIGLSLLVASATSLRSINLSQCSHLTSTSIGTLADSLGSVLRELYIDDCQSLDAM 525

Query: 490 LILPALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAE 549
           LILP+L+KL+HLEVLS+AGI+TV D+FVR FV ACGHN+KE  L DC KLTD SLKVIAE
Sbjct: 526 LILPSLKKLEHLEVLSLAGIQTVCDDFVREFVVACGHNIKEFGLADCTKLTDSSLKVIAE 585

Query: 550 TCPRLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAF 590
           TCP LC L+L NL KLTD  +G+LANGC+ IQTLKLCRNAF
Sbjct: 586 TCPGLCALNLVNLRKLTDSTLGFLANGCREIQTLKLCRNAF 626

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297738570\|emb\|CBI27815.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225444746\|ref\|XP_002278147.1\| PREDICTED: uncharacterized protein LOC100244043 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356556384\|ref\|XP_003546506.1\| PREDICTED: uncharacterized F-box/LRR-repeat protein C02F5.7-like [Glycine max]	Back alignment and taxonomy information

>gi\|297835860\|ref\|XP_002885812.1\| hypothetical protein ARALYDRAFT_319345 [Arabidopsis lyrata subsp. lyrata] gi\|297331652\|gb\|EFH62071.1\| hypothetical protein ARALYDRAFT_319345 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|51968756\|dbj\|BAD43070.1\| hypothetical protein [Arabidopsis thaliana] gi\|62318624\|dbj\|BAD95072.1\| hypothetical protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|145359938\|ref\|NP_178661.2\| uncharacterized protein [Arabidopsis thaliana] gi\|330250903\|gb\|AEC05997.1\| uncharacterized protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|110738495\|dbj\|BAF01173.1\| hypothetical protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|356565796\|ref\|XP_003551123.1\| PREDICTED: DNA repair protein rhp7-like [Glycine max]	Back alignment and taxonomy information

>gi\|449500555\|ref\|XP_004161129.1\| PREDICTED: uncharacterized LOC101209944 [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		600
TAIR\|locus:2051542		762	AT2G06040 "AT2G06040" [Arabido	0.646	0.509	0.520	1.8e-112
TAIR\|locus:504956457		544	AT5G21900 [Arabidopsis thalian	0.47	0.518	0.367	1.4e-41
RGD\|621722		276	Fbxl20 "F-box and leucine-rich	0.243	0.528	0.311	2.4e-10
UNIPROTKB\|Q58DG6		436	FBXL20 "F-box/LRR-repeat prote	0.243	0.334	0.317	3.1e-10
UNIPROTKB\|Q96IG2		436	FBXL20 "F-box/LRR-repeat prote	0.243	0.334	0.317	3.1e-10
POMBASE\|SPCC330.02		563	rhp7 "Rad7 homolog Rhp7" [Schi	0.451	0.481	0.243	8.4e-10
MGI\|MGI:1919444		436	Fbxl20 "F-box and leucine-rich	0.243	0.334	0.311	1.1e-09
UNIPROTKB\|F1NHD2		423	FBXL2 "Uncharacterized protein	0.353	0.501	0.226	6.1e-09
TAIR\|locus:2166978		405	AT5G23340 [Arabidopsis thalian	0.231	0.343	0.266	1.6e-08
UNIPROTKB\|E1BS58		638	E1BS58 "Uncharacterized protei	0.231	0.217	0.319	1.6e-08

TAIR\|locus:2051542 AT2G06040 "AT2G06040" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1024 (365.5 bits), Expect = 1.8e-112, Sum P(2) = 1.8e-112
 Identities = 207/398 (52%), Positives = 287/398 (72%)

Query:   194 EQRVDKKSSVRL-SESRMEQFRDIARQNASKFAYFNVEENHLSDDNERLVVADGEVGREI 252
             EQ  ++++S  + ++SR + FRDIA + A +FA+F+ +     ++ E L   +GE  +++
Sbjct:   265 EQAQNRENSNEIGNDSRTQHFRDIAERIAHRFAHFDAQV----EEEEDLSDKEGE--QQV 318

Query:   253 EDWPGPFSTAMKIVRDREKKLSGGQRIGSLDPKKKSNSSILWIPRKGQRQGPKLIIPSLK 312
             EDWPGPFSTAMKI++DRE+  +    IG +  K++S+ +I W+PR      P+   PSL+
Sbjct:   319 EDWPGPFSTAMKIIKDREEYTTPHVGIG-VSNKERSSPTI-WVPRSNFSFPPRKA-PSLQ 375

Query:   313 ELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLRDCS 372
             ELS+++LV+NADAITSL++VPD LR KL  +LCDSR+M+ HFL+LL  GSPTEI + DCS
Sbjct:   376 ELSLRVLVKNADAITSLDYVPDTLRVKLCQLLCDSRRMDLHFLDLLVQGSPTEICVPDCS 435

Query:   373 WLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYIXXXXXXXXXXXXXXXXXXXICGACR 432
             WLTE+EFT+ F +CDT NL VLQLD+CGRCMPDYI                   I GACR
Sbjct:   436 WLTEEEFTECFKNCDTSNLMVLQLDQCGRCMPDYILPFTLARSPKVLPMLSTLSISGACR 495

Query:   433 ISDVGFKALVTSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQSLNAMLIL 492
             +SDVG + LV+SAPA+ SINL+QCSLL+S+S+D+L+D LGS ++ELYIN+CQ+++   IL
Sbjct:   496 LSDVGLRQLVSSAPAITSINLNQCSLLTSSSIDMLSDSLGSVLRELYINECQNIDMKHIL 555

Query:   493 PALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCP 552
              AL+K + LEVLS+A + +V   F++ FV A G  +K+LILT+  KL+D S+KVI+E CP
Sbjct:   556 AALKKFEKLEVLSLADLPSVKGRFLKEFVTARGQTLKQLILTNSRKLSDSSIKVISENCP 615

Query:   553 RLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAF 590
              L  LDL+N+ KLTD  +GYLANGCQA++ L  CRN F
Sbjct:   616 NLSVLDLANVCKLTDSSLGYLANGCQALEKLIFCRNPF 653

GO:0003674 "molecular_function" evidence=ND

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

TAIR\|locus:504956457 AT5G21900 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

RGD\|621722 Fbxl20 "F-box and leucine-rich repeat protein 20" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q96IG2 FBXL20 "F-box/LRR-repeat protein 20" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

POMBASE\|SPCC330.02 rhp7 "Rad7 homolog Rhp7" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

MGI\|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

TAIR\|locus:2166978 AT5G23340 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BS58 E1BS58 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00016452001	SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (905 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		600
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	3e-18
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	3e-08

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

 Score = 83.5 bits (207), Expect = 3e-18
 Identities = 56/245 (22%), Positives = 88/245 (35%), Gaps = 57/245 (23%)

Query: 338 HKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLRDCSWLTEQEFTKAFVSCDTKNLTVLQLD 397
             L F+L    Q+    ++ L     + +      WL           C   +  + QL 
Sbjct: 2   DPLLFILHKLGQITQSNISQLLRILHSGLE-----WLE-------LYMCPISDPPLDQLS 49

Query: 398 RC---------GRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPAL 448
            C         G  + D   L  LA S    P+L  L +     I+D G  AL T+ P L
Sbjct: 50  NCNKLKKLILPGSKLIDDEGLIALAQSC---PNLQVLDLRACENITDSGIVALATNCPKL 106

Query: 449 RSINLSQ---CSLLSSTSVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLS 505
           ++INL +     L++  S+  L                            +    L+ + 
Sbjct: 107 QTINLGRHRNGHLITDVSLSALG---------------------------KNCTFLQTVG 139

Query: 506 VAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAET--CPRLCTLDLSNLY 563
            AG + VTD+ V      C  +++ L L +C  LTD S+  I  +   P L  L+     
Sbjct: 140 FAGCD-VTDKGVWELASGCSKSLERLSLNNCRNLTDQSIPAILASNYFPNLSVLEFRGCP 198

Query: 564 KLTDF 568
            +TDF
Sbjct: 199 LITDF 203

Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		600
KOG4341		483	consensus F-box protein containing LRR [General fu	99.86
KOG4341		483	consensus F-box protein containing LRR [General fu	99.86
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.58
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.57
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.55
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.52
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.51
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.48
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.06
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.0
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	98.97
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	98.96
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.94
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.89
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.8
PLN03210		1153	Resistant to P. syringae 6; Provisional	98.66
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.5
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.43
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.37
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.25
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.23
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.2
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.1
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.06
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	98.0
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.92
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.84
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.76
KOG3864		221	consensus Uncharacterized conserved protein [Funct	97.72
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.72
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	97.72
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	97.71
KOG3864		221	consensus Uncharacterized conserved protein [Funct	97.7
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	97.53
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	97.5
KOG4308		478	consensus LRR-containing protein [Function unknown	97.49
PRK15386		426	type III secretion protein GogB; Provisional	97.45
PRK15386		426	type III secretion protein GogB; Provisional	97.03
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	96.91
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	96.79
KOG4308		478	consensus LRR-containing protein [Function unknown	96.74
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	96.73
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	96.69
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	96.5
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	96.48
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.42
KOG4237		498	consensus Extracellular matrix protein slit, conta	96.26
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	96.16
KOG0472		565	consensus Leucine-rich repeat protein [Function un	96.04
KOG4237		498	consensus Extracellular matrix protein slit, conta	96.04
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	95.91
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	95.67
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	95.36
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	95.27
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.22
PLN03150		623	hypothetical protein; Provisional	95.06
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	94.83
KOG0617		264	consensus Ras suppressor protein (contains leucine	94.26
PLN03150		623	hypothetical protein; Provisional	93.71
KOG2123		388	consensus Uncharacterized conserved protein [Funct	93.71
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	93.43
KOG2123		388	consensus Uncharacterized conserved protein [Funct	93.4
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	93.22
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	93.03
KOG0617		264	consensus Ras suppressor protein (contains leucine	92.36
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	91.98
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	91.98
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	91.22
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	91.21
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	90.93
KOG0472		565	consensus Leucine-rich repeat protein [Function un	85.97

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

Probab=99.86  E-value=1.3e-22  Score=211.55  Aligned_cols=271  Identities=20%  Similarity=0.284  Sum_probs=217.3

Q ss_pred             cccCCchhhhhHHHHHhcCCCCCCCCCCcHHHHHHHHHHhccCCCCChhHHhhhh--CCCCcEEEecCCCCCCHHHHHHH
Q 007516          305 KLIIPSLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLF--SGSPTEIRLRDCSWLTEQEFTKA  382 (600)
Q Consensus       305 ~~~~psL~dLcL~~l~~n~~~l~sL~~Lp~~~~~kL~~~L~~~~~Lt~~~l~l~~--~~~L~~L~L~~C~~Ltd~~L~~L  382 (600)
                      -+++....+-.+..++.+|++|+.|             .+.+|.++++..+..+.  ...+++|++..|+.+|+..++.+
T Consensus       145 lrG~r~v~~sslrt~~~~CpnIehL-------------~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~l  211 (483)
T KOG4341|consen  145 LRGCRAVGDSSLRTFASNCPNIEHL-------------ALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYL  211 (483)
T ss_pred             ccccccCCcchhhHHhhhCCchhhh-------------hhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHH
Confidence            3455556666666667777776543             25677788888887774  45678899999988999989889


Q ss_pred             HhhCCCCCCceeecCCCCCCCCchhhHHHHHHHhcCCCCCCEEEcCCcccCChhhHHHHHhcCCCCcEEecCCCCCCCch
Q 007516          383 FVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPALRSINLSQCSLLSST  462 (600)
Q Consensus       383 ~~~c~l~~L~~L~Ls~c~~~~~D~~~~~~L~~~~~~l~~L~~L~Ls~c~~LtD~~l~~L~~~~p~L~~L~Ls~C~~Itd~  462 (600)
                      +..|  ++|++|++++|..     +...++..+...|..|+.+.+.||..+.++.+..+..+|+-+-.+++..|..+||.
T Consensus       212 a~gC--~kL~~lNlSwc~q-----i~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~  284 (483)
T KOG4341|consen  212 AEGC--RKLKYLNLSWCPQ-----ISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDE  284 (483)
T ss_pred             HHhh--hhHHHhhhccCch-----hhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccch
Confidence            9988  8999999999986     33445667778888888888888988888888888888888888888889889998


Q ss_pred             hHHHHHhhccccceEEEccCccCchhhhHHHHHhcCCCCCEEEccCCCCCChHHHHHHHHhcCCCccEEEecCCCCCChH
Q 007516          463 SVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDF  542 (600)
Q Consensus       463 ~L~~L~~~~~s~L~~L~Ls~c~~l~d~~i~~~l~~l~~Le~L~Ls~c~~ltd~~l~~Ll~~~~~sLk~L~Ls~C~~LtD~  542 (600)
                      ++..++..|.. |+.|+.++|..+++..+....+++++|+.|-+++|..++|.++..+. .+++.|+.|++..|..++|.
T Consensus       285 ~~~~i~~~c~~-lq~l~~s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~-rn~~~Le~l~~e~~~~~~d~  362 (483)
T KOG4341|consen  285 DLWLIACGCHA-LQVLCYSSCTDITDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLG-RNCPHLERLDLEECGLITDG  362 (483)
T ss_pred             HHHHHhhhhhH-hhhhcccCCCCCchHHHHHHhcCCCceEEEeccccchhhhhhhhhhh-cCChhhhhhcccccceehhh
Confidence            88888877774 89999999988888888788888899999999999989988886654 44588999999999888888


Q ss_pred             HHHHHHhcCCCccEEeecCCCCCChHHHHHHHh---cCCCccEEEeeCCC-CChhhhhc
Q 007516          543 SLKVIAETCPRLCTLDLSNLYKLTDFGIGYLAN---GCQAIQTLKLCRNA-FRFVFHRD  597 (600)
Q Consensus       543 ~L~~L~~~cp~L~~LdLs~C~~lTd~~l~~L~~---~c~~Lk~L~Ls~c~-isD~~i~~  597 (600)
                      .+..++.+|+.|+.|.|++|..|||+|+..+..   +...|..|.|++|+ ++|..++.
T Consensus       363 tL~sls~~C~~lr~lslshce~itD~gi~~l~~~~c~~~~l~~lEL~n~p~i~d~~Le~  421 (483)
T KOG4341|consen  363 TLASLSRNCPRLRVLSLSHCELITDEGIRHLSSSSCSLEGLEVLELDNCPLITDATLEH  421 (483)
T ss_pred             hHhhhccCCchhccCChhhhhhhhhhhhhhhhhccccccccceeeecCCCCchHHHHHH
Confidence            888888899999999999999999998887766   34578888899996 45544443

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		600
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	2e-26
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	2e-18
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	9e-18
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-12
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	8e-24
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-23
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-23
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	8e-17
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-15
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-13
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-08
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-23
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-23
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-19
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-10
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-19
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	1e-11
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	4e-09
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	1e-07
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	2e-10
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	8e-07
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	7e-04
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	9e-08
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	3e-06
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-07
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	5e-07
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	7e-05
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	1e-06
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	4e-05
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-04
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-05
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-05
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	5e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	6e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-04
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	6e-04

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

 Score =  109 bits (274), Expect = 2e-26
 Identities = 41/255 (16%), Positives = 89/255 (34%), Gaps = 16/255 (6%)

Query: 328 SLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLRDCSWLTEQEFTKAFVSCD 387
             +     L   +    C    M+              + L +   +           C 
Sbjct: 60  HPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNS-VIEVSTLHGILSQC- 117

Query: 388 TKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPA 447
              L  L L+          L   + ++L    +L  L++ G    S+   + L++S   
Sbjct: 118 -SKLQNLSLEGLR-------LSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSR 169

Query: 448 LRSINLSQCSLLSSTSVDILADKLGSFIQELYINDC-QSLNAMLILPALRKLKHLEVLSV 506
           L  +NLS C   +   V +    +   I +L ++   ++L    +   +R+  +L  L +
Sbjct: 170 LDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDL 229

Query: 507 AGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLT 566
           +    + ++  + F     + ++ L L+ C  +   +L  + E  P L TL +  +  + 
Sbjct: 230 SDSVMLKNDCFQEF--FQLNYLQHLSLSRCYDIIPETLLELGE-IPTLKTLQVFGI--VP 284

Query: 567 DFGIGYLANGCQAIQ 581
           D  +  L      +Q
Sbjct: 285 DGTLQLLKEALPHLQ 299

PyMOL of 2ast

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		600
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.85
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.85
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.84
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.83
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.8
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.77
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.72
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.69
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.68
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.67
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.58
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.57
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.48
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.47
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.4
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.33
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.31
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.29
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.25
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.24
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.21
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.18
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.16
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.16
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.15
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.15
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.15
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.15
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.13
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.12
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.11
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.11
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.1
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.1
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.09
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.09
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.09
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.08
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.08
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.07
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.06
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.06
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.05
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.04
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.04
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.03
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.03
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.03
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.03
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.01
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.01
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.01
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.0
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.0
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.99
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.99
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	98.98
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	98.97
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	98.97
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	98.96
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	98.96
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.96
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.95
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	98.95
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	98.95
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	98.93
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	98.93
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.92
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.91
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.9
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	98.9
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	98.9
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	98.89
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.87
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.87
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.87
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.86
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.83
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.82
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.81
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	98.79
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.78
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.77
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.76
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.75
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	98.75
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.74
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.73
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.73
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.73
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	98.71
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.7
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.69
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.69
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.68
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.66
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	98.66
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.65
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.63
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.63
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.62
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.58
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.56
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.54
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.47
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.43
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.42
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.36
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.34
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.33
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.32
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	98.32
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.31
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.31
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	98.28
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.26
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.23
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.12
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.12
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.1
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.09
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.09
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.06
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.03
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.02
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	97.96
3e6j_A		229	Variable lymphocyte receptor diversity region; var	97.94
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	97.88
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	97.85
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	97.8
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	97.8
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	97.78
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	97.75
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	97.7
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	97.67
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	97.49
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	97.22
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	97.15
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	97.15
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	97.13
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	96.65
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	96.56
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	96.34
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	96.25
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	95.85
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	95.45
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	95.42
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	95.28
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	95.28
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	94.61
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	86.65

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

Probab=99.85  E-value=5.3e-20  Score=190.80  Aligned_cols=212  Identities=18%  Similarity=0.320  Sum_probs=93.5

Q ss_pred             CcEEEecCCCCCCHHHHHHHHhhCCCCCCceeecCCCCCCCCchhhHHHHHHHhcCCCCCCEEEcCCcccCChhhHHHHH
Q 007516          363 PTEIRLRDCSWLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALV  442 (600)
Q Consensus       363 L~~L~L~~C~~Ltd~~L~~L~~~c~l~~L~~L~Ls~c~~~~~D~~~~~~L~~~~~~l~~L~~L~Ls~c~~LtD~~l~~L~  442 (600)
                      +++|+|++|. +++.++..++..|  ++|++|+|++|.  +.+    ... ..+..+++|++|+|++|..+++.++..+.
T Consensus        95 L~~L~L~~~~-l~~~~~~~~~~~~--~~L~~L~L~~~~--l~~----~~~-~~l~~~~~L~~L~L~~~~~l~~~~l~~~~  164 (336)
T 2ast_B           95 VQHMDLSNSV-IEVSTLHGILSQC--SKLQNLSLEGLR--LSD----PIV-NTLAKNSNLVRLNLSGCSGFSEFALQTLL  164 (336)
T ss_dssp             CCEEECTTCE-ECHHHHHHHHTTB--CCCSEEECTTCB--CCH----HHH-HHHTTCTTCSEEECTTCBSCCHHHHHHHH
T ss_pred             CCEEEccCCC-cCHHHHHHHHhhC--CCCCEEeCcCcc--cCH----HHH-HHHhcCCCCCEEECCCCCCCCHHHHHHHH
Confidence            3444444443 4444444444444  455555555443  111    111 12233455555555554445444444444


Q ss_pred             hcCCCCcEEecCCCCCCCchhHHHHHhhccccceEEEccCcc-CchhhhHHHHHhcCCCCCEEEccCCCCCChHHHHHHH
Q 007516          443 TSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQ-SLNAMLILPALRKLKHLEVLSVAGIETVTDEFVRGFV  521 (600)
Q Consensus       443 ~~~p~L~~L~Ls~C~~Itd~~L~~L~~~~~s~L~~L~Ls~c~-~l~d~~i~~~l~~l~~Le~L~Ls~c~~ltd~~l~~Ll  521 (600)
                      ..+++|++|+|++|..+++.++..+...++.+|++|+|++|. .+++..+...+..+++|+.|++++|..+++..+..+ 
T Consensus       165 ~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~l-  243 (336)
T 2ast_B          165 SSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEF-  243 (336)
T ss_dssp             HHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGG-
T ss_pred             hcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCcCCHHHHHHH-
Confidence            445555555555543344444444444444125555555543 333333444444455555555555544444333322 


Q ss_pred             HhcCCCccEEEecCCCCCChHHHHHHHhcCCCccEEeecCCCCCChHHHHHHHhcCCCccEEEeeCCCCCh
Q 007516          522 YACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAFRF  592 (600)
Q Consensus       522 ~~~~~sLk~L~Ls~C~~LtD~~L~~L~~~cp~L~~LdLs~C~~lTd~~l~~L~~~c~~Lk~L~Ls~c~isD  592 (600)
                      . .+++|++|+|++|..+++.++..+. .|++|+.|+|++|  +++.++..+...++.|+   +++|.++.
T Consensus       244 ~-~l~~L~~L~l~~~~~~~~~~~~~l~-~~~~L~~L~l~~~--i~~~~~~~l~~~l~~L~---l~~n~l~~  307 (336)
T 2ast_B          244 F-QLNYLQHLSLSRCYDIIPETLLELG-EIPTLKTLQVFGI--VPDGTLQLLKEALPHLQ---INCSHFTT  307 (336)
T ss_dssp             G-GCTTCCEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTS--SCTTCHHHHHHHSTTSE---ESCCCSCC
T ss_pred             h-CCCCCCEeeCCCCCCCCHHHHHHHh-cCCCCCEEeccCc--cCHHHHHHHHhhCcceE---EecccCcc
Confidence            1 1245555555554444444443333 3455555555554  44444444443333322   44444444

PyMOL of 2ast

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		600
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	1e-07
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	3e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	1e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	4e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	6e-04

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 51.3 bits (121), Expect = 1e-07
 Identities = 37/196 (18%), Positives = 65/196 (33%), Gaps = 10/196 (5%)

Query: 390 NLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPALR 449
            +  + L          I +STL   L+    L  LS     R+SD     L      L 
Sbjct: 47  RVQHMDLSNS------VIEVSTLHGILSQCSKLQNLS-LEGLRLSDPIVNTL-AKNSNLV 98

Query: 450 SINLSQCSLLSSTSVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLSVAGI 509
            +NLS CS  S  ++  L        +             + +      + +  L+++G 
Sbjct: 99  RLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGY 158

Query: 510 ETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLTDFG 569
                +     +     N+  L L+D V L +   +        L  L LS  Y +    
Sbjct: 159 RKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFF-QLNYLQHLSLSRCYDIIPET 217

Query: 570 IGYLANGCQAIQTLKL 585
           +  L      ++TL++
Sbjct: 218 LLELGE-IPTLKTLQV 232

PyMOL of d2astb2

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		600
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.91
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.9
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.6
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.52
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.5
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.31
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.98
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.84
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.81
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.77
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.74
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.7
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.7
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	98.69
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.68
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	98.66
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.64
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.58
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.53
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.52
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.5
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.42
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.33
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.28
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.25
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	98.22
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.21
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.12
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	97.97
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	97.91
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	97.89
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	97.83
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	97.8
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	97.75
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	97.59
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	97.55
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.02
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	96.97
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	96.93
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	96.91
d2ifga3		156	High affinity nerve growth factor receptor, N-term	95.43
d2ifga3		156	High affinity nerve growth factor receptor, N-term	95.22

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.91  E-value=3.3e-24  Score=217.60  Aligned_cols=222  Identities=17%  Similarity=0.277  Sum_probs=189.4

Q ss_pred             hCCCCcEEEecCCCCCCHHHHHHHHhhCCCCCCceeecCCCCCCCCchhhHHHHHHHhcCCCCCCEEEcCCcccCChhhH
Q 007516          359 FSGSPTEIRLRDCSWLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGF  438 (600)
Q Consensus       359 ~~~~L~~L~L~~C~~Ltd~~L~~L~~~c~l~~L~~L~Ls~c~~~~~D~~~~~~L~~~~~~l~~L~~L~Ls~c~~LtD~~l  438 (600)
                      ....+++|++++|. +++.++..++..|  ++|++|+|.+|.  +.    +..+.. +..+++|++|+|++|..++|.++
T Consensus        44 ~~~~L~~LdLs~~~-i~~~~l~~l~~~c--~~L~~L~L~~~~--l~----~~~~~~-l~~~~~L~~L~Ls~c~~itd~~l  113 (284)
T d2astb2          44 SPFRVQHMDLSNSV-IEVSTLHGILSQC--SKLQNLSLEGLR--LS----DPIVNT-LAKNSNLVRLNLSGCSGFSEFAL  113 (284)
T ss_dssp             CCBCCCEEECTTCE-ECHHHHHHHHTTB--CCCSEEECTTCB--CC----HHHHHH-HTTCTTCSEEECTTCBSCCHHHH
T ss_pred             cCCCCCEEECCCCc-cCHHHHHHHHHhC--CCcccccccccC--CC----cHHHHH-HhcCCCCcCcccccccccccccc
Confidence            34468999999996 8999999999999  899999999996  23    333443 45789999999999999999999


Q ss_pred             HHHHhcCCCCcEEecCCCCCCCchhHHHHHhhccccceEEEccCcc-CchhhhHHHHHhcCCCCCEEEccCCCCCChHHH
Q 007516          439 KALVTSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQ-SLNAMLILPALRKLKHLEVLSVAGIETVTDEFV  517 (600)
Q Consensus       439 ~~L~~~~p~L~~L~Ls~C~~Itd~~L~~L~~~~~s~L~~L~Ls~c~-~l~d~~i~~~l~~l~~Le~L~Ls~c~~ltd~~l  517 (600)
                      ..++..|++|++|+|++|..+++.++..+...++++|+.|++++|. .+++.++...+.+|++|++|++++|..++|..+
T Consensus       114 ~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~  193 (284)
T d2astb2         114 QTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCF  193 (284)
T ss_dssp             HHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGG
T ss_pred             chhhHHHHhccccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhh
Confidence            9999999999999999999999998877665554579999999974 578877888889999999999999999999888


Q ss_pred             HHHHHhcCCCccEEEecCCCCCChHHHHHHHhcCCCccEEeecCCCCCChHHHHHHHhcCCCccEEEeeCCCCChhhhhc
Q 007516          518 RGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAFRFVFHRD  597 (600)
Q Consensus       518 ~~Ll~~~~~sLk~L~Ls~C~~LtD~~L~~L~~~cp~L~~LdLs~C~~lTd~~l~~L~~~c~~Lk~L~Ls~c~isD~~i~~  597 (600)
                      ..+. . +++|++|+|++|..++|.++..++ .||+|+.|++++|  +++.++..++..||+|+   +..+++++.+...
T Consensus       194 ~~l~-~-~~~L~~L~L~~C~~i~~~~l~~L~-~~~~L~~L~l~~~--~~d~~l~~l~~~lp~L~---i~~~~ls~~~~~~  265 (284)
T d2astb2         194 QEFF-Q-LNYLQHLSLSRCYDIIPETLLELG-EIPTLKTLQVFGI--VPDGTLQLLKEALPHLQ---INCSHFTTIARPT  265 (284)
T ss_dssp             GGGG-G-CTTCCEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTS--SCTTCHHHHHHHSTTSE---ESCCCSCCTTCSS
T ss_pred             hhhc-c-cCcCCEEECCCCCCCChHHHHHHh-cCCCCCEEeeeCC--CCHHHHHHHHHhCcccc---ccCccCCCCCCCc
Confidence            6653 3 589999999999999999998887 6999999999998  89999999999999887   4566777655444


Q ss_pred             c
Q 007516          598 F  598 (600)
Q Consensus       598 f  598 (600)
                      +
T Consensus       266 ~  266 (284)
T d2astb2         266 I  266 (284)
T ss_dssp             C
T ss_pred             c
Confidence            3

PyMOL of d2astb2

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure