Citrus Sinensis ID: 007516
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 600 | ||||||
| 255550465 | 765 | rad7, putative [Ricinus communis] gi|223 | 0.958 | 0.751 | 0.488 | 1e-149 | |
| 297738570 | 832 | unnamed protein product [Vitis vinifera] | 0.85 | 0.612 | 0.519 | 1e-139 | |
| 225444746 | 905 | PREDICTED: uncharacterized protein LOC10 | 0.873 | 0.579 | 0.476 | 1e-134 | |
| 356556384 | 541 | PREDICTED: uncharacterized F-box/LRR-rep | 0.62 | 0.687 | 0.609 | 1e-126 | |
| 297835860 | 773 | hypothetical protein ARALYDRAFT_319345 [ | 0.95 | 0.737 | 0.419 | 1e-124 | |
| 51968756 | 762 | hypothetical protein [Arabidopsis thalia | 0.958 | 0.754 | 0.429 | 1e-124 | |
| 145359938 | 762 | uncharacterized protein [Arabidopsis tha | 0.961 | 0.757 | 0.429 | 1e-124 | |
| 110738495 | 762 | hypothetical protein [Arabidopsis thalia | 0.961 | 0.757 | 0.429 | 1e-123 | |
| 356565796 | 675 | PREDICTED: DNA repair protein rhp7-like | 0.601 | 0.534 | 0.569 | 1e-117 | |
| 449500555 | 875 | PREDICTED: uncharacterized LOC101209944 | 0.605 | 0.414 | 0.518 | 1e-105 |
| >gi|255550465|ref|XP_002516283.1| rad7, putative [Ricinus communis] gi|223544769|gb|EEF46285.1| rad7, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 536 bits (1380), Expect = e-149, Method: Compositional matrix adjust.
Identities = 313/641 (48%), Positives = 417/641 (65%), Gaps = 66/641 (10%)
Query: 1 MPVLRSRVI--PPTKPEIEPLKHPANKIEPAT-----PARTW--DTTRP-----ASSGDD 46
M +LRSR I P TK EP+ PA EP+T P+ D+TR AS
Sbjct: 1 MVMLRSRKILCPSTKSLPEPVT-PAQTREPSTRRLSLPSHELGSDSTRRRSLRLASKSVP 59
Query: 47 DGGDAGRKRKL-----------------DVSENLLGLEGGDSEGFLNLRSGKKVIKRIGE 89
+ RKRK+ V++N + DSE L+LRSGK+V+KR E
Sbjct: 60 RDQNGSRKRKISSIEKEKEETEEQNSAFQVNDN----DNVDSEMILSLRSGKRVVKRKVE 115
Query: 90 TDGGNSVDGKEKENGKETMDFEEVRMLREVSKDGADV-DKLDIKQNA-DGSCSEK----- 142
D G ++ + K+ ++ EE + + K A + +KL KQ+ +G+CS +
Sbjct: 116 YDSGENLVIEAKD-----LNVEEFENVSDKDKGKAKLTEKLMEKQSVVEGNCSSRLEVNK 170
Query: 143 ----------RRRRFGREEKGKAKLIDEDSTVNGSEFINLDLELGTKHSEENVGS--VSE 190
+RR+ REEKGKA L D+D N L+L+ K ++G V
Sbjct: 171 FSHESSNSMRTKRRYSREEKGKANL-DDDGLSNSIGKDELELQSKVKELGHSLGENVVLL 229
Query: 191 PRTEQRVDKKSSVRLSESRMEQFRDIARQNASKFAYFNVEEN-HLSDDNERLVVADGEVG 249
P E++ ++ +ESRM+QFRDIA +NAS+FA F+ +E+ +L + + + ++ E
Sbjct: 230 PGNERQTMNINTSNKNESRMDQFRDIATRNASRFAQFDRQEDENLPSEVDNVEISSVEEN 289
Query: 250 REIEDWPGPFSTAMKIVRDREKKLSGGQRIGSLDPKKKSNSSILWIPRKGQRQGPKLIIP 309
IEDWPGPFSTAMKI+RDR + Q +L+ K + I W+P + ++ + +P
Sbjct: 290 ERIEDWPGPFSTAMKIIRDRANMRNSQQGASTLE--KPQSVPITWVPTRNRQS--RTCVP 345
Query: 310 SLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLR 369
SL+EL M+I+V+N DA+TSL+HVPDALRH+L +LCD R+MNS FL+LL GSPTEIR++
Sbjct: 346 SLQELCMRIIVKNVDAVTSLDHVPDALRHRLCQLLCDCRKMNSSFLDLLVRGSPTEIRVK 405
Query: 370 DCSWLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICG 429
DCSW++E+E K F CDT NL+VLQLD+CGRCMPDY++ +TLA S SLP+L TLS+CG
Sbjct: 406 DCSWMSEEELVKCFEGCDTNNLSVLQLDQCGRCMPDYVIPATLARSSRSLPALITLSLCG 465
Query: 430 ACRISDVGFKALVTSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQSLNAM 489
ACR+SD+G LV SA +LRSINLSQCS L+STS+ LAD LGS ++ELYI+DCQSL+AM
Sbjct: 466 ACRLSDIGLSLLVASATSLRSINLSQCSHLTSTSIGTLADSLGSVLRELYIDDCQSLDAM 525
Query: 490 LILPALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAE 549
LILP+L+KL+HLEVLS+AGI+TV D+FVR FV ACGHN+KE L DC KLTD SLKVIAE
Sbjct: 526 LILPSLKKLEHLEVLSLAGIQTVCDDFVREFVVACGHNIKEFGLADCTKLTDSSLKVIAE 585
Query: 550 TCPRLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAF 590
TCP LC L+L NL KLTD +G+LANGC+ IQTLKLCRNAF
Sbjct: 586 TCPGLCALNLVNLRKLTDSTLGFLANGCREIQTLKLCRNAF 626
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297738570|emb|CBI27815.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225444746|ref|XP_002278147.1| PREDICTED: uncharacterized protein LOC100244043 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356556384|ref|XP_003546506.1| PREDICTED: uncharacterized F-box/LRR-repeat protein C02F5.7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297835860|ref|XP_002885812.1| hypothetical protein ARALYDRAFT_319345 [Arabidopsis lyrata subsp. lyrata] gi|297331652|gb|EFH62071.1| hypothetical protein ARALYDRAFT_319345 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|51968756|dbj|BAD43070.1| hypothetical protein [Arabidopsis thaliana] gi|62318624|dbj|BAD95072.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|145359938|ref|NP_178661.2| uncharacterized protein [Arabidopsis thaliana] gi|330250903|gb|AEC05997.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|110738495|dbj|BAF01173.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356565796|ref|XP_003551123.1| PREDICTED: DNA repair protein rhp7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449500555|ref|XP_004161129.1| PREDICTED: uncharacterized LOC101209944 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 600 | ||||||
| TAIR|locus:2051542 | 762 | AT2G06040 "AT2G06040" [Arabido | 0.646 | 0.509 | 0.520 | 1.8e-112 | |
| TAIR|locus:504956457 | 544 | AT5G21900 [Arabidopsis thalian | 0.47 | 0.518 | 0.367 | 1.4e-41 | |
| RGD|621722 | 276 | Fbxl20 "F-box and leucine-rich | 0.243 | 0.528 | 0.311 | 2.4e-10 | |
| UNIPROTKB|Q58DG6 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.243 | 0.334 | 0.317 | 3.1e-10 | |
| UNIPROTKB|Q96IG2 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.243 | 0.334 | 0.317 | 3.1e-10 | |
| POMBASE|SPCC330.02 | 563 | rhp7 "Rad7 homolog Rhp7" [Schi | 0.451 | 0.481 | 0.243 | 8.4e-10 | |
| MGI|MGI:1919444 | 436 | Fbxl20 "F-box and leucine-rich | 0.243 | 0.334 | 0.311 | 1.1e-09 | |
| UNIPROTKB|F1NHD2 | 423 | FBXL2 "Uncharacterized protein | 0.353 | 0.501 | 0.226 | 6.1e-09 | |
| TAIR|locus:2166978 | 405 | AT5G23340 [Arabidopsis thalian | 0.231 | 0.343 | 0.266 | 1.6e-08 | |
| UNIPROTKB|E1BS58 | 638 | E1BS58 "Uncharacterized protei | 0.231 | 0.217 | 0.319 | 1.6e-08 |
| TAIR|locus:2051542 AT2G06040 "AT2G06040" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1024 (365.5 bits), Expect = 1.8e-112, Sum P(2) = 1.8e-112
Identities = 207/398 (52%), Positives = 287/398 (72%)
Query: 194 EQRVDKKSSVRL-SESRMEQFRDIARQNASKFAYFNVEENHLSDDNERLVVADGEVGREI 252
EQ ++++S + ++SR + FRDIA + A +FA+F+ + ++ E L +GE +++
Sbjct: 265 EQAQNRENSNEIGNDSRTQHFRDIAERIAHRFAHFDAQV----EEEEDLSDKEGE--QQV 318
Query: 253 EDWPGPFSTAMKIVRDREKKLSGGQRIGSLDPKKKSNSSILWIPRKGQRQGPKLIIPSLK 312
EDWPGPFSTAMKI++DRE+ + IG + K++S+ +I W+PR P+ PSL+
Sbjct: 319 EDWPGPFSTAMKIIKDREEYTTPHVGIG-VSNKERSSPTI-WVPRSNFSFPPRKA-PSLQ 375
Query: 313 ELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLRDCS 372
ELS+++LV+NADAITSL++VPD LR KL +LCDSR+M+ HFL+LL GSPTEI + DCS
Sbjct: 376 ELSLRVLVKNADAITSLDYVPDTLRVKLCQLLCDSRRMDLHFLDLLVQGSPTEICVPDCS 435
Query: 373 WLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYIXXXXXXXXXXXXXXXXXXXICGACR 432
WLTE+EFT+ F +CDT NL VLQLD+CGRCMPDYI I GACR
Sbjct: 436 WLTEEEFTECFKNCDTSNLMVLQLDQCGRCMPDYILPFTLARSPKVLPMLSTLSISGACR 495
Query: 433 ISDVGFKALVTSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQSLNAMLIL 492
+SDVG + LV+SAPA+ SINL+QCSLL+S+S+D+L+D LGS ++ELYIN+CQ+++ IL
Sbjct: 496 LSDVGLRQLVSSAPAITSINLNQCSLLTSSSIDMLSDSLGSVLRELYINECQNIDMKHIL 555
Query: 493 PALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCP 552
AL+K + LEVLS+A + +V F++ FV A G +K+LILT+ KL+D S+KVI+E CP
Sbjct: 556 AALKKFEKLEVLSLADLPSVKGRFLKEFVTARGQTLKQLILTNSRKLSDSSIKVISENCP 615
Query: 553 RLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAF 590
L LDL+N+ KLTD +GYLANGCQA++ L CRN F
Sbjct: 616 NLSVLDLANVCKLTDSSLGYLANGCQALEKLIFCRNPF 653
|
|
| TAIR|locus:504956457 AT5G21900 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| RGD|621722 Fbxl20 "F-box and leucine-rich repeat protein 20" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96IG2 FBXL20 "F-box/LRR-repeat protein 20" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPCC330.02 rhp7 "Rad7 homolog Rhp7" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166978 AT5G23340 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BS58 E1BS58 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00016452001 | SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (905 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 600 | |||
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 3e-18 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 3e-08 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Score = 83.5 bits (207), Expect = 3e-18
Identities = 56/245 (22%), Positives = 88/245 (35%), Gaps = 57/245 (23%)
Query: 338 HKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLRDCSWLTEQEFTKAFVSCDTKNLTVLQLD 397
L F+L Q+ ++ L + + WL C + + QL
Sbjct: 2 DPLLFILHKLGQITQSNISQLLRILHSGLE-----WLE-------LYMCPISDPPLDQLS 49
Query: 398 RC---------GRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPAL 448
C G + D L LA S P+L L + I+D G AL T+ P L
Sbjct: 50 NCNKLKKLILPGSKLIDDEGLIALAQSC---PNLQVLDLRACENITDSGIVALATNCPKL 106
Query: 449 RSINLSQ---CSLLSSTSVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLS 505
++INL + L++ S+ L + L+ +
Sbjct: 107 QTINLGRHRNGHLITDVSLSALG---------------------------KNCTFLQTVG 139
Query: 506 VAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAET--CPRLCTLDLSNLY 563
AG + VTD+ V C +++ L L +C LTD S+ I + P L L+
Sbjct: 140 FAGCD-VTDKGVWELASGCSKSLERLSLNNCRNLTDQSIPAILASNYFPNLSVLEFRGCP 198
Query: 564 KLTDF 568
+TDF
Sbjct: 199 LITDF 203
|
Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 600 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.86 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.86 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.58 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.57 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.55 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.52 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.51 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.48 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.06 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.0 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.97 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.96 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.94 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.89 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.8 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.66 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.5 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.43 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.37 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.25 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.23 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.2 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.1 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.06 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.0 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.92 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.84 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.76 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.72 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.72 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.72 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.71 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.7 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.53 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.5 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 97.49 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.45 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.03 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 96.91 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 96.79 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.74 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 96.73 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.69 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 96.5 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 96.48 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.42 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 96.26 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.16 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 96.04 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 96.04 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 95.91 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 95.67 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.36 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 95.27 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.22 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.06 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 94.83 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 94.26 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 93.71 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 93.71 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 93.43 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 93.4 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 93.22 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 93.03 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 92.36 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 91.98 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 91.98 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 91.22 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 91.21 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 90.93 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 85.97 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.86 E-value=1.3e-22 Score=211.55 Aligned_cols=271 Identities=20% Similarity=0.284 Sum_probs=217.3
Q ss_pred cccCCchhhhhHHHHHhcCCCCCCCCCCcHHHHHHHHHHhccCCCCChhHHhhhh--CCCCcEEEecCCCCCCHHHHHHH
Q 007516 305 KLIIPSLKELSMKILVQNADAITSLEHVPDALRHKLSFMLCDSRQMNSHFLNLLF--SGSPTEIRLRDCSWLTEQEFTKA 382 (600)
Q Consensus 305 ~~~~psL~dLcL~~l~~n~~~l~sL~~Lp~~~~~kL~~~L~~~~~Lt~~~l~l~~--~~~L~~L~L~~C~~Ltd~~L~~L 382 (600)
-+++....+-.+..++.+|++|+.| .+.+|.++++..+..+. ...+++|++..|+.+|+..++.+
T Consensus 145 lrG~r~v~~sslrt~~~~CpnIehL-------------~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~l 211 (483)
T KOG4341|consen 145 LRGCRAVGDSSLRTFASNCPNIEHL-------------ALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYL 211 (483)
T ss_pred ccccccCCcchhhHHhhhCCchhhh-------------hhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHH
Confidence 3455556666666667777776543 25677788888887774 45678899999988999989889
Q ss_pred HhhCCCCCCceeecCCCCCCCCchhhHHHHHHHhcCCCCCCEEEcCCcccCChhhHHHHHhcCCCCcEEecCCCCCCCch
Q 007516 383 FVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPALRSINLSQCSLLSST 462 (600)
Q Consensus 383 ~~~c~l~~L~~L~Ls~c~~~~~D~~~~~~L~~~~~~l~~L~~L~Ls~c~~LtD~~l~~L~~~~p~L~~L~Ls~C~~Itd~ 462 (600)
+..| ++|++|++++|.. +...++..+...|..|+.+.+.||..+.++.+..+..+|+-+-.+++..|..+||.
T Consensus 212 a~gC--~kL~~lNlSwc~q-----i~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~ 284 (483)
T KOG4341|consen 212 AEGC--RKLKYLNLSWCPQ-----ISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDE 284 (483)
T ss_pred HHhh--hhHHHhhhccCch-----hhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccch
Confidence 9988 8999999999986 33445667778888888888888988888888888888888888888889889998
Q ss_pred hHHHHHhhccccceEEEccCccCchhhhHHHHHhcCCCCCEEEccCCCCCChHHHHHHHHhcCCCccEEEecCCCCCChH
Q 007516 463 SVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLSVAGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDF 542 (600)
Q Consensus 463 ~L~~L~~~~~s~L~~L~Ls~c~~l~d~~i~~~l~~l~~Le~L~Ls~c~~ltd~~l~~Ll~~~~~sLk~L~Ls~C~~LtD~ 542 (600)
++..++..|.. |+.|+.++|..+++..+....+++++|+.|-+++|..++|.++..+. .+++.|+.|++..|..++|.
T Consensus 285 ~~~~i~~~c~~-lq~l~~s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~-rn~~~Le~l~~e~~~~~~d~ 362 (483)
T KOG4341|consen 285 DLWLIACGCHA-LQVLCYSSCTDITDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLG-RNCPHLERLDLEECGLITDG 362 (483)
T ss_pred HHHHHhhhhhH-hhhhcccCCCCCchHHHHHHhcCCCceEEEeccccchhhhhhhhhhh-cCChhhhhhcccccceehhh
Confidence 88888877774 89999999988888888788888899999999999989988886654 44588999999999888888
Q ss_pred HHHHHHhcCCCccEEeecCCCCCChHHHHHHHh---cCCCccEEEeeCCC-CChhhhhc
Q 007516 543 SLKVIAETCPRLCTLDLSNLYKLTDFGIGYLAN---GCQAIQTLKLCRNA-FRFVFHRD 597 (600)
Q Consensus 543 ~L~~L~~~cp~L~~LdLs~C~~lTd~~l~~L~~---~c~~Lk~L~Ls~c~-isD~~i~~ 597 (600)
.+..++.+|+.|+.|.|++|..|||+|+..+.. +...|..|.|++|+ ++|..++.
T Consensus 363 tL~sls~~C~~lr~lslshce~itD~gi~~l~~~~c~~~~l~~lEL~n~p~i~d~~Le~ 421 (483)
T KOG4341|consen 363 TLASLSRNCPRLRVLSLSHCELITDEGIRHLSSSSCSLEGLEVLELDNCPLITDATLEH 421 (483)
T ss_pred hHhhhccCCchhccCChhhhhhhhhhhhhhhhhccccccccceeeecCCCCchHHHHHH
Confidence 888888899999999999999999998887766 34578888899996 45544443
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 600 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-26 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-18 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 9e-18 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-12 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 8e-24 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-23 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-23 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 8e-17 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-15 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-13 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-08 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-23 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-23 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-19 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-10 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-19 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-11 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 4e-09 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-07 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-10 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 8e-07 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 7e-04 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 9e-08 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 3e-06 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-07 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 5e-07 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 7e-05 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 1e-06 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 4e-05 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-04 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-06 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-04 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 5e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 5e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 6e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-04 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 9e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 109 bits (274), Expect = 2e-26
Identities = 41/255 (16%), Positives = 89/255 (34%), Gaps = 16/255 (6%)
Query: 328 SLEHVPDALRHKLSFMLCDSRQMNSHFLNLLFSGSPTEIRLRDCSWLTEQEFTKAFVSCD 387
+ L + C M+ + L + + C
Sbjct: 60 HPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNS-VIEVSTLHGILSQC- 117
Query: 388 TKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPA 447
L L L+ L + ++L +L L++ G S+ + L++S
Sbjct: 118 -SKLQNLSLEGLR-------LSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSR 169
Query: 448 LRSINLSQCSLLSSTSVDILADKLGSFIQELYINDC-QSLNAMLILPALRKLKHLEVLSV 506
L +NLS C + V + + I +L ++ ++L + +R+ +L L +
Sbjct: 170 LDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDL 229
Query: 507 AGIETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLT 566
+ + ++ + F + ++ L L+ C + +L + E P L TL + + +
Sbjct: 230 SDSVMLKNDCFQEF--FQLNYLQHLSLSRCYDIIPETLLELGE-IPTLKTLQVFGI--VP 284
Query: 567 DFGIGYLANGCQAIQ 581
D + L +Q
Sbjct: 285 DGTLQLLKEALPHLQ 299
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 600 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.85 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.85 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.84 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.83 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.8 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.77 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.72 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.69 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.68 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.67 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.58 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.57 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.48 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.47 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.4 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.33 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.31 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.29 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.25 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.24 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.21 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.18 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.16 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.16 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.15 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.15 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.15 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.15 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.13 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.12 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.11 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.11 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.1 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.1 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.09 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.09 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.09 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.09 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.08 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.08 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.07 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.06 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.06 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.05 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.04 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.03 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.03 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.03 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.03 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.01 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.01 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.01 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.0 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.0 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.0 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.99 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.99 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.98 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.97 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.97 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.96 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.96 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.96 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.95 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.95 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.95 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.93 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.93 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.92 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.91 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.9 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.9 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.9 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.89 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.87 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.87 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.87 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.86 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.83 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.82 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.81 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.79 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.78 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.77 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.76 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.75 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.75 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.74 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.73 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.73 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.73 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.71 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.7 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.69 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.69 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.68 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.66 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.66 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.65 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.63 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.63 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.62 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.58 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.56 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.54 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.47 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.43 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.42 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.36 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.34 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.33 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.32 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.32 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.31 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.31 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.28 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.26 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.23 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.12 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.12 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.1 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.09 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.09 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.06 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.05 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.03 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.02 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.96 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.94 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.88 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.85 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.8 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.8 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.78 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.75 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.7 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.67 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.49 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.22 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.15 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.15 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.13 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.65 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.56 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.34 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.25 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.85 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 95.45 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 95.42 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 95.28 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 95.28 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 94.61 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 86.65 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.85 E-value=5.3e-20 Score=190.80 Aligned_cols=212 Identities=18% Similarity=0.320 Sum_probs=93.5
Q ss_pred CcEEEecCCCCCCHHHHHHHHhhCCCCCCceeecCCCCCCCCchhhHHHHHHHhcCCCCCCEEEcCCcccCChhhHHHHH
Q 007516 363 PTEIRLRDCSWLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALV 442 (600)
Q Consensus 363 L~~L~L~~C~~Ltd~~L~~L~~~c~l~~L~~L~Ls~c~~~~~D~~~~~~L~~~~~~l~~L~~L~Ls~c~~LtD~~l~~L~ 442 (600)
+++|+|++|. +++.++..++..| ++|++|+|++|. +.+ ... ..+..+++|++|+|++|..+++.++..+.
T Consensus 95 L~~L~L~~~~-l~~~~~~~~~~~~--~~L~~L~L~~~~--l~~----~~~-~~l~~~~~L~~L~L~~~~~l~~~~l~~~~ 164 (336)
T 2ast_B 95 VQHMDLSNSV-IEVSTLHGILSQC--SKLQNLSLEGLR--LSD----PIV-NTLAKNSNLVRLNLSGCSGFSEFALQTLL 164 (336)
T ss_dssp CCEEECTTCE-ECHHHHHHHHTTB--CCCSEEECTTCB--CCH----HHH-HHHTTCTTCSEEECTTCBSCCHHHHHHHH
T ss_pred CCEEEccCCC-cCHHHHHHHHhhC--CCCCEEeCcCcc--cCH----HHH-HHHhcCCCCCEEECCCCCCCCHHHHHHHH
Confidence 3444444443 4444444444444 455555555443 111 111 12233455555555554445444444444
Q ss_pred hcCCCCcEEecCCCCCCCchhHHHHHhhccccceEEEccCcc-CchhhhHHHHHhcCCCCCEEEccCCCCCChHHHHHHH
Q 007516 443 TSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQ-SLNAMLILPALRKLKHLEVLSVAGIETVTDEFVRGFV 521 (600)
Q Consensus 443 ~~~p~L~~L~Ls~C~~Itd~~L~~L~~~~~s~L~~L~Ls~c~-~l~d~~i~~~l~~l~~Le~L~Ls~c~~ltd~~l~~Ll 521 (600)
..+++|++|+|++|..+++.++..+...++.+|++|+|++|. .+++..+...+..+++|+.|++++|..+++..+..+
T Consensus 165 ~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~l- 243 (336)
T 2ast_B 165 SSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEF- 243 (336)
T ss_dssp HHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGG-
T ss_pred hcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCcCCHHHHHHH-
Confidence 445555555555543344444444444444125555555543 333333444444455555555555544444333322
Q ss_pred HhcCCCccEEEecCCCCCChHHHHHHHhcCCCccEEeecCCCCCChHHHHHHHhcCCCccEEEeeCCCCCh
Q 007516 522 YACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAFRF 592 (600)
Q Consensus 522 ~~~~~sLk~L~Ls~C~~LtD~~L~~L~~~cp~L~~LdLs~C~~lTd~~l~~L~~~c~~Lk~L~Ls~c~isD 592 (600)
. .+++|++|+|++|..+++.++..+. .|++|+.|+|++| +++.++..+...++.|+ +++|.++.
T Consensus 244 ~-~l~~L~~L~l~~~~~~~~~~~~~l~-~~~~L~~L~l~~~--i~~~~~~~l~~~l~~L~---l~~n~l~~ 307 (336)
T 2ast_B 244 F-QLNYLQHLSLSRCYDIIPETLLELG-EIPTLKTLQVFGI--VPDGTLQLLKEALPHLQ---INCSHFTT 307 (336)
T ss_dssp G-GCTTCCEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTS--SCTTCHHHHHHHSTTSE---ESCCCSCC
T ss_pred h-CCCCCCEeeCCCCCCCCHHHHHHHh-cCCCCCEEeccCc--cCHHHHHHHHhhCcceE---EecccCcc
Confidence 1 1245555555554444444443333 3455555555554 44444444443333322 44444444
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 600 | ||||
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 1e-07 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 3e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 1e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 4e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 6e-04 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 51.3 bits (121), Expect = 1e-07
Identities = 37/196 (18%), Positives = 65/196 (33%), Gaps = 10/196 (5%)
Query: 390 NLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGFKALVTSAPALR 449
+ + L I +STL L+ L LS R+SD L L
Sbjct: 47 RVQHMDLSNS------VIEVSTLHGILSQCSKLQNLS-LEGLRLSDPIVNTL-AKNSNLV 98
Query: 450 SINLSQCSLLSSTSVDILADKLGSFIQELYINDCQSLNAMLILPALRKLKHLEVLSVAGI 509
+NLS CS S ++ L + + + + + L+++G
Sbjct: 99 RLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGY 158
Query: 510 ETVTDEFVRGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLTDFG 569
+ + N+ L L+D V L + + L L LS Y +
Sbjct: 159 RKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFF-QLNYLQHLSLSRCYDIIPET 217
Query: 570 IGYLANGCQAIQTLKL 585
+ L ++TL++
Sbjct: 218 LLELGE-IPTLKTLQV 232
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 600 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.91 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.9 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.6 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.52 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.5 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.31 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.98 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.84 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.81 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.77 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.74 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.7 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.7 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.69 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.68 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.66 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.64 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.58 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.53 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.52 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.5 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.42 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.33 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.28 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.25 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.22 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.21 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.12 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.97 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.91 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.89 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.83 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.8 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.75 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.59 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.55 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.02 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.97 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.93 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 96.91 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.43 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.22 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91 E-value=3.3e-24 Score=217.60 Aligned_cols=222 Identities=17% Similarity=0.277 Sum_probs=189.4
Q ss_pred hCCCCcEEEecCCCCCCHHHHHHHHhhCCCCCCceeecCCCCCCCCchhhHHHHHHHhcCCCCCCEEEcCCcccCChhhH
Q 007516 359 FSGSPTEIRLRDCSWLTEQEFTKAFVSCDTKNLTVLQLDRCGRCMPDYILLSTLASSLNSLPSLTTLSICGACRISDVGF 438 (600)
Q Consensus 359 ~~~~L~~L~L~~C~~Ltd~~L~~L~~~c~l~~L~~L~Ls~c~~~~~D~~~~~~L~~~~~~l~~L~~L~Ls~c~~LtD~~l 438 (600)
....+++|++++|. +++.++..++..| ++|++|+|.+|. +. +..+.. +..+++|++|+|++|..++|.++
T Consensus 44 ~~~~L~~LdLs~~~-i~~~~l~~l~~~c--~~L~~L~L~~~~--l~----~~~~~~-l~~~~~L~~L~Ls~c~~itd~~l 113 (284)
T d2astb2 44 SPFRVQHMDLSNSV-IEVSTLHGILSQC--SKLQNLSLEGLR--LS----DPIVNT-LAKNSNLVRLNLSGCSGFSEFAL 113 (284)
T ss_dssp CCBCCCEEECTTCE-ECHHHHHHHHTTB--CCCSEEECTTCB--CC----HHHHHH-HTTCTTCSEEECTTCBSCCHHHH
T ss_pred cCCCCCEEECCCCc-cCHHHHHHHHHhC--CCcccccccccC--CC----cHHHHH-HhcCCCCcCcccccccccccccc
Confidence 34468999999996 8999999999999 899999999996 23 333443 45789999999999999999999
Q ss_pred HHHHhcCCCCcEEecCCCCCCCchhHHHHHhhccccceEEEccCcc-CchhhhHHHHHhcCCCCCEEEccCCCCCChHHH
Q 007516 439 KALVTSAPALRSINLSQCSLLSSTSVDILADKLGSFIQELYINDCQ-SLNAMLILPALRKLKHLEVLSVAGIETVTDEFV 517 (600)
Q Consensus 439 ~~L~~~~p~L~~L~Ls~C~~Itd~~L~~L~~~~~s~L~~L~Ls~c~-~l~d~~i~~~l~~l~~Le~L~Ls~c~~ltd~~l 517 (600)
..++..|++|++|+|++|..+++.++..+...++++|+.|++++|. .+++.++...+.+|++|++|++++|..++|..+
T Consensus 114 ~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~ 193 (284)
T d2astb2 114 QTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCF 193 (284)
T ss_dssp HHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGG
T ss_pred chhhHHHHhccccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhh
Confidence 9999999999999999999999998877665554579999999974 578877888889999999999999999999888
Q ss_pred HHHHHhcCCCccEEEecCCCCCChHHHHHHHhcCCCccEEeecCCCCCChHHHHHHHhcCCCccEEEeeCCCCChhhhhc
Q 007516 518 RGFVYACGHNMKELILTDCVKLTDFSLKVIAETCPRLCTLDLSNLYKLTDFGIGYLANGCQAIQTLKLCRNAFRFVFHRD 597 (600)
Q Consensus 518 ~~Ll~~~~~sLk~L~Ls~C~~LtD~~L~~L~~~cp~L~~LdLs~C~~lTd~~l~~L~~~c~~Lk~L~Ls~c~isD~~i~~ 597 (600)
..+. . +++|++|+|++|..++|.++..++ .||+|+.|++++| +++.++..++..||+|+ +..+++++.+...
T Consensus 194 ~~l~-~-~~~L~~L~L~~C~~i~~~~l~~L~-~~~~L~~L~l~~~--~~d~~l~~l~~~lp~L~---i~~~~ls~~~~~~ 265 (284)
T d2astb2 194 QEFF-Q-LNYLQHLSLSRCYDIIPETLLELG-EIPTLKTLQVFGI--VPDGTLQLLKEALPHLQ---INCSHFTTIARPT 265 (284)
T ss_dssp GGGG-G-CTTCCEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTS--SCTTCHHHHHHHSTTSE---ESCCCSCCTTCSS
T ss_pred hhhc-c-cCcCCEEECCCCCCCChHHHHHHh-cCCCCCEEeeeCC--CCHHHHHHHHHhCcccc---ccCccCCCCCCCc
Confidence 6653 3 589999999999999999998887 6999999999998 89999999999999887 4566777655444
Q ss_pred c
Q 007516 598 F 598 (600)
Q Consensus 598 f 598 (600)
+
T Consensus 266 ~ 266 (284)
T d2astb2 266 I 266 (284)
T ss_dssp C
T ss_pred c
Confidence 3
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|