Citrus Sinensis ID: 007539

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------60
MIGGASTWRCLRVRQLTRILSYNHHHHEFSTFNFGNKFNSVSLSSRSRGRTYPWNRFSPITSFLSDSASSRSILFSTSTSTKDKKDFLNKPVTKSNAPEQQIADMKIFRTLASYLWMKDNFEFRLRVITALGFLVAAKVLNVQVPFLFKLAVDWLTTATTTATALAANSTFLALFGTPAAVLIGYGIARTTASAFNELRTAVFSKVALRTIRSVSRKVFSHLHELDLRYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTILEISMVSGILAYKFGAPFAWITSLSVVAYVVFTLSVTQWRTKFRKAMNKADNDASTRAIDSLINYETVKYFNNEAFEAEQYDEFLRRYEDAALKTQRSLAFLNFGQNVIFSAALSTAMVLCSHGILSGEMTVGDLVMVNGLLFQLSLPLNFLGSVYRETVQSLVDMKSMFQLLEEKADIQDRDNAMPLNLKGGSIQFDNVHFSYLTERKILDGVSFVVPAGKSVAIVGTSGSGKSTILRLLFRSFDTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPAKYSTVVGERGLKIEGK
cccccccHHHHHHHcHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEEccccccccccccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHcccccccccccHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEEEcccccEEEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccEEEEEEccEEcHHccHHHHHHHccccccccEEEcccHHHHHHcccccccHHHHHHHHHHHcHHHHHHHccccccEEEcccccEcccc
MIGGASTWRCLRVRQLTRILSynhhhhefstfnfgnkfnsvslssrsrgrtypwnrfspitsflsdsassrsilfstststkdkkdflnkpvtksnapeqqIADMKIFRTLASYLWMKDNFEFRLRVITALGFLVAAKVLNVQVPFLFKLAVDWLTTATTTATALAANSTFLALFGTPAAVLIGYGIARTTASAFNELRTAVFSKVALRTIRSVSRKVFSHLHELDLRYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTILEISMVSGIlaykfgapfawITSLSVVAYVVFTLSVTQWRTKFRKAMNkadndastrAIDSLINYETVkyfnneafeAEQYDEFLRRYEDAALKTQRSLAFLNFGQNVIFSAALSTAMVLCShgilsgemtvGDLVMVNGLLFQLSLPLNFLGSVYRETVQSLVDMKSMFQLLEEKADiqdrdnamplnlkggsiqfdnvHFSYLTERKILDGVSFVVPAGKSVAivgtsgsgkSTILRLLFRSfdthsgsiridgqDICEVTLESLRKsigvvpqdtvlfndtifhnirygrlsateEEVYDAARRAAIHDTImnfpakystvvgerglkiegk
miggastwrcLRVRQLTRILSYNHHHHefstfnfgnkfNSVSLSSRSRGRTYPWNRFSPitsflsdsassRSILFstststkdkkdflnkpvtksnapeqqiaDMKIFRTLASYLWMKDNFEFRLRVITALGFLVAAKVLNVQVPFLFKLAVDWLTTATTTATALAANSTFLALFGTPAAVLIGYGIARTTASAFNELRTAVFSKVALRTIRSVSRKvfshlheldlryhlsretGALNRIIDRGSRAINFILSSMVFNVVPTILEISMVSGILAYKFGAPFAWITSLSVVAYVVFTLSVTQWRTKFRKamnkadndastraiDSLINYETVKYFNNEAFEAEQYDEFLRRYEDAALKTQRSLAFLNFGQNVIFSAALSTAMVLCSHGILSGEMTVGDLVMVNGLLFQLSLPLNFLGSVYRETVQSLVDMKSMFQLLEEKADIQDRDNAMPLNLKGGSIQFDNVHFSYLTERKILDGVSFVVPAGKSVAivgtsgsgksTILRLLFRSFDthsgsiridgQDICEVTLESLRKsigvvpqdtvlfndTIFHNIRYGRLSATEEEVYDAARRAAIHdtimnfpakystvvgerglkiegk
MIGGASTWRCLRVRQLTRILSYNHHHHEFSTFNFGNKFNSVSLSSRSRGRTYPWNRFSPITSFLSDsassrsilfstststKDKKDFLNKPVTKSNAPEQQIADMKIFRTLASYLWMKDNFEFRLRVITALGFLVAAKVLNVQVPFLFKlavdwlttatttatalaanstflalFGTPAAVLIGYGIARTTASAFNELRTAVFSKVALRTIRSVSRKVFSHLHELDLRYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTILEISMVSGILAYKFGAPFAWITSLSVVAYVVFTLSVTQWRTKFRKAMNKADNDASTRAIDSLINYETVKYFNNEAFEAEQYDEFLRRYEDAALKTQRSLAFLNFGQNVIFSAALSTAMVLCSHGILSGEMTVGDLVMVngllfqlslplnflgSVYRETVQSLVDMKSMFQLLEEKADIQDRDNAMPLNLKGGSIQFDNVHFSYLTERKILDGVSFVVPAGKSVAIVGTSGSGKSTILRLLFRSFDTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPAKYSTVVGERGLKIEGK
***************************************************YPWNRFS*I*****************************************IADMKIFRTLASYLWMKDNFEFRLRVITALGFLVAAKVLNVQVPFLFKLAVDWLTTATTTATALAANSTFLALFGTPAAVLIGYGIARTTASAFNELRTAVFSKVALRTIRSVSRKVFSHLHELDLRYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTILEISMVSGILAYKFGAPFAWITSLSVVAYVVFTLSVTQWRTKFRKAMNKADNDASTRAIDSLINYETVKYFNNEAFEAEQYDEFLRRYEDAALKTQRSLAFLNFGQNVIFSAALSTAMVLCSHGILSGEMTVGDLVMVNGLLFQLSLPLNFLGSVYRETVQSLVDMKSMFQLLEEKADIQ***NAMPLNLKGGSIQFDNVHFSYLTERKILDGVSFVVPAGKSVAIVGTSGSGKSTILRLLFRSFDTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPAKYSTVVGE********
**************Q******************************************************************************************KIFRTLASYLWMKDNFEFRLRVITALGFLVAAKVLNVQVPFLFKLAVDWLTTATTTATALAANSTFLALFGTPAAVLIGYGIARTTASAFNELRTAVFSKVALRTIRSVSRKVFSHLHELDLRYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTILEISMVSGILAYKFGAPFAWITSLSVVAYVVFTLSVTQWRTKFRKAMNKADNDASTRAIDSLINYETVKYFNNEAFEAEQYDEFLRRYEDAALKTQRSLAFLNFGQNVIFSAALSTAMVLCSHGILSGEMTVGDLVMVNGLLFQLSLPLNFLGSVYRETVQSLVDMKSMFQLLEEKADIQDRDNAMPLNLKGGSIQFDNVHFSYLTERKILDGVSFVVPAGKSVAIVGTSGSGKSTILRLLFRSFDTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPAKYSTVVGERGLKIE**
MIGGASTWRCLRVRQLTRILSYNHHHHEFSTFNFGNKFNSVSLSSRSRGRTYPWNRFSPITSFLSDSASSRSILFSTSTSTKDKKDFLNKPVTKSNAPEQQIADMKIFRTLASYLWMKDNFEFRLRVITALGFLVAAKVLNVQVPFLFKLAVDWLTTATTTATALAANSTFLALFGTPAAVLIGYGIARTTASAFNELRTAVFSKVALRTIRSVSRKVFSHLHELDLRYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTILEISMVSGILAYKFGAPFAWITSLSVVAYVVFTLSVTQWRTKFRKAMNKADNDASTRAIDSLINYETVKYFNNEAFEAEQYDEFLRRYEDAALKTQRSLAFLNFGQNVIFSAALSTAMVLCSHGILSGEMTVGDLVMVNGLLFQLSLPLNFLGSVYRETVQSLVDMKSMFQLLEEKADIQDRDNAMPLNLKGGSIQFDNVHFSYLTERKILDGVSFVVPAGKSVAIVGTSGSGKSTILRLLFRSFDTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPAKYSTVVGERGLKIEGK
*************R*LTRI**********************************************************************************IADMKIFRTLASYLWMKDNFEFRLRVITALGFLVAAKVLNVQVPFLFKLAVDWLTTATTTATALAANSTFLALFGTPAAVLIGYGIARTTASAFNELRTAVFSKVALRTIRSVSRKVFSHLHELDLRYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTILEISMVSGILAYKFGAPFAWITSLSVVAYVVFTLSVTQWRTKFRKAMNKADNDASTRAIDSLINYETVKYFNNEAFEAEQYDEFLRRYEDAALKTQRSLAFLNFGQNVIFSAALSTAMVLCSHGILSGEMTVGDLVMVNGLLFQLSLPLNFLGSVYRETVQSLVDMKSMFQLLEEKADIQDRDNAMPLNLKGGSIQFDNVHFSYLTERKILDGVSFVVPAGKSVAIVGTSGSGKSTILRLLFRSFDTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPAKYSTVVGER*L*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGGASTWRCLRVRQLTRILSYNHHHHEFSTFNFGNKFNSVSLSSRSRGRTYPWNRFSPITSFLSDSASSRSILFSTSTSTKDKKDFLNKPVTKSNAPEQQIADMKIFRTLASYLWMKDNFEFRLRVITALGFLVAAKVLNVQVPFLFKLAVDWLTTATTTATALAANSTFLALFGTPAAVLIGYGIARTTASAFNELRTAVFSKVALRTIRSVSRKVFSHLHELDLRYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTILEISMVSGILAYKFGAPFAWITSLSVVAYVVFTLSVTQWRTKFRKAMNKADNDASTRAIDSLINYETVKYFNNEAFEAEQYDEFLRRYEDAALKTQRSLAFLNFGQNVIFSAALSTAMVLCSHGILSGEMTVGDLVMVNGLLFQLSLPLNFLGSVYRETVQSLVDMKSMFQLLEEKADIQDRDNAMPLNLKGGSIQFDNVHFSYLTERKILDGVSFVVPAGKSVAIVGTSGSGKSTILRLLFRSFDTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPAKYSTVVGERGLKIEGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query599 2.2.26 [Sep-21-2011]
Q9LVM1 728 ABC transporter B family yes no 0.876 0.721 0.815 0.0
Q9FUT3 678 ABC transporter B family no no 0.886 0.783 0.723 0.0
Q9M0G9 680 ABC transporter B family no no 0.866 0.763 0.686 0.0
Q2ULH4 720 Iron-sulfur clusters tran yes no 0.879 0.731 0.542 1e-165
Q704E8 752 ATP-binding cassette sub- yes no 0.833 0.663 0.551 1e-163
O75027 752 ATP-binding cassette sub- yes no 0.833 0.663 0.551 1e-162
Q61102 752 ATP-binding cassette sub- yes no 0.833 0.663 0.549 1e-162
Q4HVU7 698 Iron-sulfur clusters tran yes no 0.868 0.744 0.543 1e-160
Q5B1Q2 721 Iron-sulfur clusters tran yes no 0.848 0.704 0.554 1e-159
Q4WLN7 727 Iron-sulfur clusters tran yes no 0.846 0.697 0.555 1e-158
>sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 Back     alignment and function desciption
 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/530 (81%), Positives = 473/530 (89%), Gaps = 5/530 (0%)

Query: 74  LFSTSTSTKDKKDFLNKPVTK-SNAPEQQIADMKIFRTLASYLWMKDNFEFRLRVITALG 132
           LFSTST   D+     K +   S+  +  +ADMKI RTLA YLWM+DN EFR RVI ALG
Sbjct: 89  LFSTSTPNPDQTTTKTKEIKTTSSDSDSAMADMKILRTLAGYLWMRDNPEFRFRVIAALG 148

Query: 133 FLVAAKVLNVQVPFLFKLAVDWLTTATTTATAL----AANSTFLALFGTPAAVLIGYGIA 188
           FLV AKVLNVQVPFLFKLAVDWL +AT T  +L    A N T L +F TPAAVLIGYGIA
Sbjct: 149 FLVGAKVLNVQVPFLFKLAVDWLASATGTGASLTTFAATNPTLLTVFATPAAVLIGYGIA 208

Query: 189 RTTASAFNELRTAVFSKVALRTIRSVSRKVFSHLHELDLRYHLSRETGALNRIIDRGSRA 248
           RT +SAFNELRTAVFSKVALRTIRSVSRKVFSHLH+LDLRYHLSRETG LNRIIDRGSRA
Sbjct: 209 RTGSSAFNELRTAVFSKVALRTIRSVSRKVFSHLHDLDLRYHLSRETGGLNRIIDRGSRA 268

Query: 249 INFILSSMVFNVVPTILEISMVSGILAYKFGAPFAWITSLSVVAYVVFTLSVTQWRTKFR 308
           INFILS+MVFNVVPTILEISMVSGILAYKFGA FAWITSLSV +Y+VFTL+VTQWRTKFR
Sbjct: 269 INFILSAMVFNVVPTILEISMVSGILAYKFGAAFAWITSLSVGSYIVFTLAVTQWRTKFR 328

Query: 309 KAMNKADNDASTRAIDSLINYETVKYFNNEAFEAEQYDEFLRRYEDAALKTQRSLAFLNF 368
           KAMNKADNDASTRAIDSLINYETVKYFNNE +EAE+YD+FL++YEDAAL+TQRSLAFLNF
Sbjct: 329 KAMNKADNDASTRAIDSLINYETVKYFNNEGYEAEKYDQFLKKYEDAALQTQRSLAFLNF 388

Query: 369 GQNVIFSAALSTAMVLCSHGILSGEMTVGDLVMVNGLLFQLSLPLNFLGSVYRETVQSLV 428
           GQ++IFS ALSTAMVLCS GI++G+MTVGDLVMVNGLLFQLSLPLNFLGSVYRET+QSLV
Sbjct: 389 GQSIIFSTALSTAMVLCSQGIMNGQMTVGDLVMVNGLLFQLSLPLNFLGSVYRETIQSLV 448

Query: 429 DMKSMFQLLEEKADIQDRDNAMPLNLKGGSIQFDNVHFSYLTERKILDGVSFVVPAGKSV 488
           DMKSMFQLLEEK+DI +  +A PL LKGG+I+F+NVHFSYL ERKILDG+SFVVPAGKSV
Sbjct: 449 DMKSMFQLLEEKSDITNTSDAKPLVLKGGNIEFENVHFSYLPERKILDGISFVVPAGKSV 508

Query: 489 AIVGTSGSGKSTILRLLFRSFDTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFNDT 548
           AIVGTSGSGKSTILR+LFR FDT SG+IRIDGQDI EV L+SLR SIGVVPQDTVLFNDT
Sbjct: 509 AIVGTSGSGKSTILRMLFRFFDTDSGNIRIDGQDIKEVRLDSLRSSIGVVPQDTVLFNDT 568

Query: 549 IFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPAKYSTVVGERGLKIEG 598
           IFHNI YGRLSATEEEVY+AARRAAIH+TI NFP KYST+VGERGLK+ G
Sbjct: 569 IFHNIHYGRLSATEEEVYEAARRAAIHETISNFPDKYSTIVGERGLKLSG 618
Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins. Mediates a glutathione-dependent resistance to heavy metals such as cadmium and lead, as well as their transport from roots to leaves. Regulates nonprotein thiols (NPSH) and glutathione (GSH) cellular level.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 Back     alignment and function description
>sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=1 SV=1 Back     alignment and function description
>sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 Back     alignment and function description
>sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=2 SV=1 Back     alignment and function description
>sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 Back     alignment and function description
>sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 Back     alignment and function description
>sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 Back     alignment and function description
>sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 Back     alignment and function description
>sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query599
255584390 720 Transporter ATM1, mitochondrial precurso 0.986 0.820 0.782 0.0
224127021 762 ABC transporter family of the mitochondr 0.964 0.758 0.759 0.0
224145391641 ABC transporter family of the mitochondr 0.833 0.778 0.866 0.0
312283245 725 unnamed protein product [Thellungiella h 0.956 0.790 0.762 0.0
359478597 726 PREDICTED: ABC transporter B family memb 0.871 0.719 0.834 0.0
449444328 762 PREDICTED: ABC transporter B family memb 0.846 0.665 0.844 0.0
297793349 728 hypothetical protein ARALYDRAFT_495937 [ 0.876 0.721 0.816 0.0
449475813 764 PREDICTED: LOW QUALITY PROTEIN: ABC tran 0.846 0.663 0.842 0.0
356499042 748 PREDICTED: ABC transporter B family memb 0.931 0.745 0.750 0.0
15237155 728 ABC transporter B family member 25 [Arab 0.876 0.721 0.815 0.0
>gi|255584390|ref|XP_002532928.1| Transporter ATM1, mitochondrial precursor, putative [Ricinus communis] gi|223527304|gb|EEF29455.1| Transporter ATM1, mitochondrial precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  932 bits (2410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/611 (78%), Positives = 524/611 (85%), Gaps = 20/611 (3%)

Query: 4   GASTWRCLRVRQLTRILSYNHHHHE----FSTFNFGNKFNSVSLSSRSRGRTYPWNRFSP 59
           GA+ W   R R+L  I+  NH   +     ST+N     +S S S +S   ++PW +   
Sbjct: 3   GAAKWFRFRAREL--IILRNHSQTKPISLTSTYNLNPNLHSSSCSYKSYSTSFPWKKNLN 60

Query: 60  ITSFLSDS------ASSRSILFSTSTSTKDKKDFLNKPV--TKSNAPEQQIADMKIFRTL 111
           I + LS+S       + R +  S+S+S  D K+   KP+  T   + ++Q+ADMKI RTL
Sbjct: 61  INALLSNSRPPSAMLNGRVLFSSSSSSNSDLKN--AKPLVGTAKLSEDKQVADMKILRTL 118

Query: 112 ASYLWMKDNFEFRLRVITALGFLVAAKVLNVQVPFLFKLAVDWLTTATTTATALA----A 167
           ASYLWMKDN EFRLRVITAL FLV AKVLNVQVPFLFKLAVDWLTTA+  ATALA    A
Sbjct: 119 ASYLWMKDNLEFRLRVITALAFLVGAKVLNVQVPFLFKLAVDWLTTASGNATALASFTSA 178

Query: 168 NSTFLALFGTPAAVLIGYGIARTTASAFNELRTAVFSKVALRTIRSVSRKVFSHLHELDL 227
           NST LALF TPA+VLIGYGIART ASAFNELRTAVFS VALRTIR VSRKVFSHLH+LDL
Sbjct: 179 NSTLLALFATPASVLIGYGIARTGASAFNELRTAVFSNVALRTIRQVSRKVFSHLHDLDL 238

Query: 228 RYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTILEISMVSGILAYKFGAPFAWITS 287
           RYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTILEISMVSGILAYKFGAPFAWITS
Sbjct: 239 RYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTILEISMVSGILAYKFGAPFAWITS 298

Query: 288 LSVVAYVVFTLSVTQWRTKFRKAMNKADNDASTRAIDSLINYETVKYFNNEAFEAEQYDE 347
           +SV AYV FTLSVTQWRTKFRKAMNKADNDASTRAIDSLINYETVKYFNNEAFEA++YDE
Sbjct: 299 ISVAAYVAFTLSVTQWRTKFRKAMNKADNDASTRAIDSLINYETVKYFNNEAFEADKYDE 358

Query: 348 FLRRYEDAALKTQRSLAFLNFGQNVIFSAALSTAMVLCSHGILSGEMTVGDLVMVNGLLF 407
           FL+RYE AALKTQRSLAFLNFGQNVIFS ALSTAMVLCS+GI++G+MTVGDLVMVNGLLF
Sbjct: 359 FLKRYEHAALKTQRSLAFLNFGQNVIFSTALSTAMVLCSNGIMNGQMTVGDLVMVNGLLF 418

Query: 408 QLSLPLNFLGSVYRETVQSLVDMKSMFQLLEEKADIQDRDNAMPLNLKGGSIQFDNVHFS 467
           QLSLPLNFLGSVYRET+QSLVDMKSMFQLLEEKA+I+D+D+A PL   GGSIQFDNVHFS
Sbjct: 419 QLSLPLNFLGSVYRETIQSLVDMKSMFQLLEEKAEIRDKDDAKPLKFNGGSIQFDNVHFS 478

Query: 468 YLTERKILDGVSFVVPAGKSVAIVGTSGSGKSTILRLLFRSFDTHSGSIRIDGQDICEVT 527
           YL+ERKILDG+SFVVPAGKSVAIVGTSGSGKSTILRL+FR FDTHSG+IRIDGQDI ++T
Sbjct: 479 YLSERKILDGISFVVPAGKSVAIVGTSGSGKSTILRLVFRFFDTHSGNIRIDGQDIRDIT 538

Query: 528 LESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPAKYST 587
           L SLR+SIGVVPQDTVLFNDTIFHNI YGRLSATEEEVYDAAR AAIHDTIMNFP KYST
Sbjct: 539 LNSLRRSIGVVPQDTVLFNDTIFHNIHYGRLSATEEEVYDAARHAAIHDTIMNFPEKYST 598

Query: 588 VVGERGLKIEG 598
           VVGERGLK+ G
Sbjct: 599 VVGERGLKLSG 609

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224127021|ref|XP_002319987.1| ABC transporter family of the mitochondria family [Populus trichocarpa] gi|222858363|gb|EEE95910.1| ABC transporter family of the mitochondria family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145391|ref|XP_002325625.1| ABC transporter family of the mitochondria family [Populus trichocarpa] gi|222862500|gb|EEF00007.1| ABC transporter family of the mitochondria family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|312283245|dbj|BAJ34488.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|359478597|ref|XP_002275902.2| PREDICTED: ABC transporter B family member 25, mitochondrial-like [Vitis vinifera] gi|297745734|emb|CBI15790.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449444328|ref|XP_004139927.1| PREDICTED: ABC transporter B family member 25, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297793349|ref|XP_002864559.1| hypothetical protein ARALYDRAFT_495937 [Arabidopsis lyrata subsp. lyrata] gi|297310394|gb|EFH40818.1| hypothetical protein ARALYDRAFT_495937 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449475813|ref|XP_004154559.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 25, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356499042|ref|XP_003518353.1| PREDICTED: ABC transporter B family member 25, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|15237155|ref|NP_200635.1| ABC transporter B family member 25 [Arabidopsis thaliana] gi|75335558|sp|Q9LVM1.1|AB25B_ARATH RecName: Full=ABC transporter B family member 25, mitochondrial; Short=ABC transporter ABCB.25; Short=AtABCB25; AltName: Full=ABC transporter of the mitochondrion 3; Short=AtATM3; Short=Iron-sulfur clusters transporter ATM3; AltName: Full=Protein STARIK 1; Flags: Precursor gi|9964121|gb|AAG09829.1|AF287699_1 half-molecule ABC transporter ATM3 [Arabidopsis thaliana] gi|13430844|gb|AAK26044.1|AF360334_1 putative ABC transporter protein [Arabidopsis thaliana] gi|8777328|dbj|BAA96918.1| ABC transporter-like protein [Arabidopsis thaliana] gi|23297027|gb|AAN13224.1| putative ABC transporter protein [Arabidopsis thaliana] gi|332009644|gb|AED97027.1| ABC transporter B family member 25 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query599
TAIR|locus:2161183 728 ABCB25 "ATP-binding cassette B 0.844 0.695 0.776 2.1e-203
TAIR|locus:2139875 678 ABCB23 "ATP-binding cassette B 0.843 0.744 0.713 2.8e-187
UNIPROTKB|Q658I3 733 P0538C01.5 "Os06g0128300 prote 0.861 0.703 0.685 2.6e-182
TAIR|locus:2139870 680 ABCB24 "ATP-binding cassette B 0.838 0.738 0.675 2.5e-175
UNIPROTKB|E1C0W9 684 ABCB7 "Uncharacterized protein 0.829 0.726 0.538 4.4e-139
UNIPROTKB|E1BPL3 753 ABCB7 "Uncharacterized protein 0.833 0.662 0.509 3.2e-136
UNIPROTKB|E2RST1 752 ABCB7 "Uncharacterized protein 0.833 0.663 0.509 1.7e-135
UNIPROTKB|F1RPJ8 752 ABCB7 "Uncharacterized protein 0.833 0.663 0.503 2.8e-135
UNIPROTKB|K7GM11 702 ABCB7 "Uncharacterized protein 0.833 0.710 0.503 2.8e-135
UNIPROTKB|B4DGL8 702 ABCB7 "ATP-binding cassette su 0.833 0.710 0.509 5.9e-135
TAIR|locus:2161183 ABCB25 "ATP-binding cassette B25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1968 (697.8 bits), Expect = 2.1e-203, P = 2.1e-203
 Identities = 396/510 (77%), Positives = 432/510 (84%)

Query:    93 TKSNAPEQQIADMKIFRTLASYLWMKDNFEFRLRVITALGFLVAAKVLNVQVPFLFKXX- 151
             T S+  +  +ADMKI RTLA YLWM+DN EFR RVI ALGFLV AKVLNVQVPFLFK   
Sbjct:   109 TTSSDSDSAMADMKILRTLAGYLWMRDNPEFRFRVIAALGFLVGAKVLNVQVPFLFKLAV 168

Query:   152 ---XXXXXXXXXXXXXXXXXXXXXXXFGTPAAVLIGYGIARTTASAFNELRTAVFSKVAL 208
                                       F TPAAVLIGYGIART +SAFNELRTAVFSKVAL
Sbjct:   169 DWLASATGTGASLTTFAATNPTLLTVFATPAAVLIGYGIARTGSSAFNELRTAVFSKVAL 228

Query:   209 RTIRSVSRKVFSHLHELDLRYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTILEIS 268
             RTIRSVSRKVFSHLH+LDLRYHLSRETG LNRIIDRGSRAINFILS+MVFNVVPTILEIS
Sbjct:   229 RTIRSVSRKVFSHLHDLDLRYHLSRETGGLNRIIDRGSRAINFILSAMVFNVVPTILEIS 288

Query:   269 MVSGILAYKFGAPFAWITSLSVVAYVVFTLSVTQWRTKFRKAMNKADNDASTRAIDSLIN 328
             MVSGILAYKFGA FAWITSLSV +Y+VFTL+VTQWRTKFRKAMNKADNDASTRAIDSLIN
Sbjct:   289 MVSGILAYKFGAAFAWITSLSVGSYIVFTLAVTQWRTKFRKAMNKADNDASTRAIDSLIN 348

Query:   329 YETVKYFNNEAFEAEQYDEFLRRYEDAALKTQRSLAFLNFGQNVIFSAALSTAMVLCSHG 388
             YETVKYFNNE +EAE+YD+FL++YEDAAL+TQRSLAFLNFGQ++IFS ALSTAMVLCS G
Sbjct:   349 YETVKYFNNEGYEAEKYDQFLKKYEDAALQTQRSLAFLNFGQSIIFSTALSTAMVLCSQG 408

Query:   389 ILSGEMTVGDLVMVXXXXXXXXXXXXXXXSVYRETVQSLVDMKSMFQLLEEKADIQDRDN 448
             I++G+MTVGDLVMV               SVYRET+QSLVDMKSMFQLLEEK+DI +  +
Sbjct:   409 IMNGQMTVGDLVMVNGLLFQLSLPLNFLGSVYRETIQSLVDMKSMFQLLEEKSDITNTSD 468

Query:   449 AMPLNLKGGSIQFDNVHFSYLTERKILDGVSFVVPAGKSVAIVGTSGSGKSTILRLLFRS 508
             A PL LKGG+I+F+NVHFSYL ERKILDG+SFVVPAGKSVAIVGTSGSGKSTILR+LFR 
Sbjct:   469 AKPLVLKGGNIEFENVHFSYLPERKILDGISFVVPAGKSVAIVGTSGSGKSTILRMLFRF 528

Query:   509 FDTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSATEEEVYDA 568
             FDT SG+IRIDGQDI EV L+SLR SIGVVPQDTVLFNDTIFHNI YGRLSATEEEVY+A
Sbjct:   529 FDTDSGNIRIDGQDIKEVRLDSLRSSIGVVPQDTVLFNDTIFHNIHYGRLSATEEEVYEA 588

Query:   569 ARRAAIHDTIMNFPAKYSTVVGERGLKIEG 598
             ARRAAIH+TI NFP KYST+VGERGLK+ G
Sbjct:   589 ARRAAIHETISNFPDKYSTIVGERGLKLSG 618
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005215 "transporter activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0005743 "mitochondrial inner membrane" evidence=IBA
GO:0006200 "ATP catabolic process" evidence=IBA
GO:0006810 "transport" evidence=IEA
GO:0006879 "cellular iron ion homeostasis" evidence=IGI;IMP;IBA
GO:0016021 "integral to membrane" evidence=IEA;IBA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=IEA;ISS;IBA
GO:0055085 "transmembrane transport" evidence=IEA;IBA
GO:0040014 "regulation of multicellular organism growth" evidence=IGI
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0010288 "response to lead ion" evidence=IMP
GO:0046686 "response to cadmium ion" evidence=IMP
GO:0009507 "chloroplast" evidence=IDA
GO:0009555 "pollen development" evidence=IMP
GO:0009658 "chloroplast organization" evidence=IMP
GO:0010380 "regulation of chlorophyll biosynthetic process" evidence=IMP
GO:0048364 "root development" evidence=IMP
GO:0050790 "regulation of catalytic activity" evidence=IMP
GO:0006777 "Mo-molybdopterin cofactor biosynthetic process" evidence=IMP
GO:0009630 "gravitropism" evidence=RCA
TAIR|locus:2139875 ABCB23 "ATP-binding cassette B23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q658I3 P0538C01.5 "Os06g0128300 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2139870 ABCB24 "ATP-binding cassette B24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0W9 ABCB7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPL3 ABCB7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RST1 ABCB7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RPJ8 ABCB7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GM11 ABCB7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|B4DGL8 ABCB7 "ATP-binding cassette sub-family B member 7, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4WLN7ATM1_ASPFUNo assigned EC number0.55550.84640.6973yesno
Q2ULH4ATM1_ASPORNo assigned EC number0.54290.87970.7319yesno
O14286ATM1_SCHPONo assigned EC number0.51450.84640.7316yesno
O75027ABCB7_HUMANNo assigned EC number0.55130.83300.6635yesno
Q704E8ABCB7_RATNo assigned EC number0.55130.83300.6635yesno
Q4HVU7ATM1_GIBZENo assigned EC number0.54350.86810.7449yesno
Q5B1Q2ATM1_EMENINo assigned EC number0.55400.84800.7045yesno
Q61102ABCB7_MOUSENo assigned EC number0.54940.83300.6635yesno
Q2HIE9ATM1_CHAGBNo assigned EC number0.55480.80630.8009N/Ano
P0CL92ATM1_CRYNJNo assigned EC number0.55490.83130.6784yesno
Q8T9W2ABCB5_DICDINo assigned EC number0.5260.81460.7001yesno
Q6C6N0ATM1_YARLINo assigned EC number0.5060.81960.6915yesno
Q9LVM1AB25B_ARATHNo assigned EC number0.81500.87640.7211yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00131305
ABC transporter family of the mitochondria family (762 aa)
(Populus trichocarpa)
Predicted Functional Partners:
ACT8
actin 8 (376 aa)
      • 0.512
ACT1
SubName- Full=Putative uncharacterized protein;; Actins are highly conserved proteins that are [...] (378 aa)
      • 0.510

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query599
COG5265497 COG5265, ATM1, ABC-type transport system involved 1e-177
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 4e-95
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 7e-86
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 1e-65
PRK13657 588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 2e-62
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 8e-60
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 5e-56
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 6e-55
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 2e-52
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 9e-52
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 2e-47
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 2e-40
COG4987573 COG4987, CydC, ABC-type transport system involved 3e-40
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 7e-39
COG4988559 COG4988, CydD, ABC-type transport system involved 9e-39
TIGR01192 585 TIGR01192, chvA, glucan exporter ATP-binding prote 2e-38
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 6e-38
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 7e-36
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 4e-35
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 3e-34
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 1e-33
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 1e-33
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 3e-33
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 7e-32
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 8e-32
COG4618 580 COG4618, ArpD, ABC-type protease/lipase transport 9e-31
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 2e-30
PRK10789 569 PRK10789, PRK10789, putative multidrug transporter 8e-30
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 1e-27
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 1e-27
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 4e-25
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 7e-25
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 1e-24
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 3e-24
PRK10790 592 PRK10790, PRK10790, putative multidrug transporter 5e-23
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 6e-23
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 2e-22
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 8e-22
COG1127 263 COG1127, Ttg2A, ABC-type transport system involved 1e-21
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 2e-21
COG1125 309 COG1125, OpuBA, ABC-type proline/glycine betaine t 4e-20
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 5e-20
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 2e-19
COG1120 258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 2e-19
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 4e-19
COG1117253 COG1117, PstB, ABC-type phosphate transport system 9e-19
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 9e-19
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 2e-18
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 3e-18
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 4e-18
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 6e-18
COG1131 293 COG1131, CcmA, ABC-type multidrug transport system 7e-18
COG3638 258 COG3638, COG3638, ABC-type phosphate/phosphonate t 1e-17
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 1e-17
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 2e-17
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 2e-17
PRK13637 287 PRK13637, cbiO, cobalt transporter ATP-binding sub 6e-17
PRK13632 271 PRK13632, cbiO, cobalt transporter ATP-binding sub 9e-17
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 1e-16
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 2e-16
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 2e-16
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 3e-16
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 4e-16
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 4e-16
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 5e-16
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 7e-16
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 1e-15
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 1e-15
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 2e-15
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 3e-15
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 5e-15
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 7e-15
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 1e-14
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 2e-14
COG0444 316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 2e-14
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 2e-14
COG4559 259 COG4559, COG4559, ABC-type hemin transport system, 2e-14
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine tran 2e-14
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 2e-14
cd03289 275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 2e-14
COG1135 339 COG1135, AbcC, ABC-type metal ion transport system 3e-14
PRK13647 274 PRK13647, cbiO, cobalt transporter ATP-binding sub 3e-14
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 4e-14
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 4e-14
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 7e-14
PRK13548 258 PRK13548, hmuV, hemin importer ATP-binding subunit 8e-14
COG1123 539 COG1123, COG1123, ATPase components of various ABC 1e-13
COG1116 248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 2e-13
PRK13641 287 PRK13641, cbiO, cobalt transporter ATP-binding sub 4e-13
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 4e-13
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 5e-13
COG0488530 COG0488, Uup, ATPase components of ABC transporter 6e-13
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 6e-13
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 7e-13
PRK13635 279 PRK13635, cbiO, cobalt transporter ATP-binding sub 8e-13
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 8e-13
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 2e-12
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 2e-12
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 2e-12
COG3839 338 COG3839, MalK, ABC-type sugar transport systems, A 2e-12
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 2e-12
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 3e-12
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 3e-12
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 5e-12
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 6e-12
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 6e-12
COG4608 268 COG4608, AppF, ABC-type oligopeptide transport sys 6e-12
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 6e-12
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 7e-12
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 8e-12
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 9e-12
PRK13648 269 PRK13648, cbiO, cobalt transporter ATP-binding sub 1e-11
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 1e-11
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 1e-11
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 2e-11
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 2e-11
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 2e-11
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 2e-11
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; 3e-11
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 3e-11
COG1121 254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 3e-11
PRK11831 269 PRK11831, PRK11831, putative ABC transporter ATP-b 3e-11
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 4e-11
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine tr 4e-11
PRK11308 327 PRK11308, dppF, dipeptide transporter ATP-binding 5e-11
PRK13652 277 PRK13652, cbiO, cobalt transporter ATP-binding sub 5e-11
PRK11231 255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 6e-11
PRK13636 283 PRK13636, cbiO, cobalt transporter ATP-binding sub 7e-11
PRK13650 279 PRK13650, cbiO, cobalt transporter ATP-binding sub 8e-11
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 9e-11
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 9e-11
PRK14259 269 PRK14259, PRK14259, phosphate ABC transporter ATP- 1e-10
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 1e-10
COG1118 345 COG1118, CysA, ABC-type sulfate/molybdate transpor 1e-10
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 1e-10
COG1123 539 COG1123, COG1123, ATPase components of various ABC 2e-10
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 2e-10
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 2e-10
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 2e-10
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 2e-10
pfam00005119 pfam00005, ABC_tran, ABC transporter 2e-10
PRK13642 277 PRK13642, cbiO, cobalt transporter ATP-binding sub 4e-10
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 5e-10
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 8e-10
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 8e-10
PRK10851 353 PRK10851, PRK10851, sulfate/thiosulfate transporte 8e-10
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 8e-10
COG4604 252 COG4604, CeuD, ABC-type enterochelin transport sys 9e-10
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 1e-09
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 1e-09
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 1e-09
PRK11153 343 PRK11153, metN, DL-methionine transporter ATP-bind 1e-09
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 1e-09
PRK13640 282 PRK13640, cbiO, cobalt transporter ATP-binding sub 1e-09
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 1e-09
PRK14258 261 PRK14258, PRK14258, phosphate ABC transporter ATP- 2e-09
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 2e-09
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 2e-09
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transpo 2e-09
PRK13649 280 PRK13649, cbiO, cobalt transporter ATP-binding sub 2e-09
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 3e-09
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 4e-09
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 5e-09
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 6e-09
PRK13634 290 PRK13634, cbiO, cobalt transporter ATP-binding sub 6e-09
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 6e-09
PRK13646 286 PRK13646, cbiO, cobalt transporter ATP-binding sub 6e-09
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 6e-09
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 7e-09
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 9e-09
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 1e-08
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 1e-08
PRK13536 340 PRK13536, PRK13536, nodulation factor exporter sub 1e-08
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 1e-08
PRK13639 275 PRK13639, cbiO, cobalt transporter ATP-binding sub 1e-08
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 1e-08
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 2e-08
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 2e-08
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 2e-08
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 2e-08
PRK13537 306 PRK13537, PRK13537, nodulation ABC transporter Nod 2e-08
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 3e-08
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 3e-08
cd03234226 cd03234, ABCG_White, White pigment protein homolog 3e-08
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 3e-08
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 3e-08
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 4e-08
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 4e-08
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 4e-08
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transpor 5e-08
PRK14269 246 PRK14269, PRK14269, phosphate ABC transporter ATP- 5e-08
COG4152 300 COG4152, COG4152, ABC-type uncharacterized transpo 5e-08
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 5e-08
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 5e-08
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 5e-08
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 6e-08
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 6e-08
PRK11247 257 PRK11247, ssuB, aliphatic sulfonates transport ATP 7e-08
COG4598256 COG4598, HisP, ABC-type histidine transport system 8e-08
PRK13645 289 PRK13645, cbiO, cobalt transporter ATP-binding sub 8e-08
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 8e-08
TIGR01187 325 TIGR01187, potA, spermidine/putrescine ABC transpo 9e-08
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 1e-07
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 1e-07
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter AT 1e-07
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 1e-07
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 1e-07
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 1e-07
COG0396 251 COG0396, sufC, Cysteine desulfurase activator ATPa 1e-07
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 2e-07
TIGR01188 302 TIGR01188, drrA, daunorubicin resistance ABC trans 2e-07
COG4555 245 COG4555, NatA, ABC-type Na+ transport system, ATPa 2e-07
TIGR03522 301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 2e-07
TIGR02314 343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 2e-07
TIGR02769 265 TIGR02769, nickel_nikE, nickel import ATP-binding 3e-07
PRK14265 274 PRK14265, PRK14265, phosphate ABC transporter ATP- 5e-07
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 5e-07
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 5e-07
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 6e-07
PRK10575 265 PRK10575, PRK10575, iron-hydroxamate transporter A 7e-07
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-bi 7e-07
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 7e-07
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-bind 7e-07
PRK14243 264 PRK14243, PRK14243, phosphate transporter ATP-bind 7e-07
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 8e-07
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 8e-07
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 8e-07
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 1e-06
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 1e-06
COG1101 263 COG1101, PhnK, ABC-type uncharacterized transport 1e-06
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 1e-06
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 1e-06
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 1e-06
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding 1e-06
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 1e-06
PRK11650 356 PRK11650, ugpC, glycerol-3-phosphate transporter A 2e-06
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 2e-06
PRK11432 351 PRK11432, fbpC, ferric transporter ATP-binding sub 2e-06
cd03291 282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 2e-06
TIGR01288 303 TIGR01288, nodI, ATP-binding ABC transporter famil 2e-06
PRK10419 268 PRK10419, nikE, nickel transporter ATP-binding pro 3e-06
COG0411 250 COG0411, LivG, ABC-type branched-chain amino acid 3e-06
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 4e-06
PRK13644 274 PRK13644, cbiO, cobalt transporter ATP-binding sub 4e-06
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 4e-06
TIGR03873 256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 4e-06
PRK15056 272 PRK15056, PRK15056, manganese/iron transporter ATP 5e-06
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding 5e-06
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP bindi 6e-06
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 6e-06
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 6e-06
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 6e-06
PRK11701 258 PRK11701, phnK, phosphonate C-P lyase system prote 7e-06
PRK14263 261 PRK14263, PRK14263, phosphate ABC transporter ATP- 7e-06
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 1e-05
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 1e-05
PRK10619 257 PRK10619, PRK10619, histidine/lysine/arginine/orni 1e-05
PRK13643 288 PRK13643, cbiO, cobalt transporter ATP-binding sub 1e-05
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 1e-05
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 1e-05
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP 1e-05
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP 2e-05
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 2e-05
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisio 2e-05
CHL00131 252 CHL00131, ycf16, sulfate ABC transporter protein; 2e-05
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 2e-05
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 2e-05
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 2e-05
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 2e-05
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 3e-05
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 3e-05
PRK10253 265 PRK10253, PRK10253, iron-enterobactin transporter 3e-05
COG4525 259 COG4525, TauB, ABC-type taurine transport system, 4e-05
PRK15079 331 PRK15079, PRK15079, oligopeptide ABC transporter A 4e-05
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 5e-05
COG4133209 COG4133, CcmA, ABC-type transport system involved 5e-05
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 5e-05
TIGR02770 230 TIGR02770, nickel_nikD, nickel import ATP-binding 5e-05
COG4148 352 COG4148, ModC, ABC-type molybdate transport system 5e-05
TIGR02142 354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 6e-05
COG4167 267 COG4167, SapF, ABC-type antimicrobial peptide tran 6e-05
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 7e-05
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 8e-05
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 8e-05
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-b 8e-05
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 9e-05
PRK13651 305 PRK13651, PRK13651, cobalt transporter ATP-binding 9e-05
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 1e-04
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 1e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-04
PRK13631 320 PRK13631, cbiO, cobalt transporter ATP-binding sub 1e-04
PRK09544 251 PRK09544, znuC, high-affinity zinc transporter ATP 1e-04
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter 1e-04
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 2e-04
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 2e-04
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase compone 3e-04
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside t 3e-04
PRK13633 280 PRK13633, PRK13633, cobalt transporter ATP-binding 3e-04
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-bindi 3e-04
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding 4e-04
PRK15112 267 PRK15112, PRK15112, antimicrobial peptide ABC syst 6e-04
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding pr 6e-04
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 7e-04
PRK11000 369 PRK11000, PRK11000, maltose/maltodextrin transport 0.001
TIGR01184 230 TIGR01184, ntrCD, nitrate transport ATP-binding su 0.001
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 0.001
PRK14241 258 PRK14241, PRK14241, phosphate transporter ATP-bind 0.001
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 0.002
PRK10938490 PRK10938, PRK10938, putative molybdenum transport 0.002
PRK10418 254 PRK10418, nikD, nickel transporter ATP-binding pro 0.003
PRK09580 248 PRK09580, sufC, cysteine desulfurase ATPase compon 0.003
PRK11300 255 PRK11300, livG, leucine/isoleucine/valine transpor 0.004
COG4586 325 COG4586, COG4586, ABC-type uncharacterized transpo 0.004
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 0.004
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 0.004
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  509 bits (1313), Expect = e-177
 Identities = 221/402 (54%), Positives = 289/402 (71%), Gaps = 1/402 (0%)

Query: 198 LRTAVFSKVALRTIRSVSRKVFSHLHELDLRYHLSRETGALNRIIDRGSRAINFILSSMV 257
           LR  +FS V    +R ++   F HLH L LR+HL R TG L+R I+RG++ I  IL  ++
Sbjct: 1   LRDRLFSPVGQIAVRVLAYVTFFHLHSLSLRFHLERRTGGLSRAIERGTKGIETILRWIL 60

Query: 258 FNVVPTILEISMVSGILAYKFGAPFAWITSLSVVAYVVFTLSVTQWRTKFRKAMNKADND 317
           FN++PT++EIS+V+ IL   +G  FA  T ++V+ Y++FT+ V+ WRT FR+ MN AD+D
Sbjct: 61  FNILPTLVEISLVAVILWRVYGWWFALTTLVTVILYLLFTVIVSDWRTDFRRLMNNADSD 120

Query: 318 ASTRAIDSLINYETVKYFNNEAFEAEQYDEFLRRYEDAALKTQRSLAFLNFGQNVIFSAA 377
           A+ +AIDSL+N+ETVKYF NE +EA +YD  L  YE AA+K   SL  LNFGQ  IFS  
Sbjct: 121 ANAKAIDSLLNFETVKYFGNEEYEAVRYDHALETYEKAAIKVHVSLLVLNFGQTAIFSTG 180

Query: 378 LSTAMVLCSHGILSGEMTVGDLVMVNGLLFQLSLPLNFLGSVYRETVQSLVDMKSMFQLL 437
           L   M + + G+  G++TVGDLV VN LLFQLS+PLNFLG  YRE  Q+L DM+ MF LL
Sbjct: 181 LRVMMTMSALGVEEGQLTVGDLVNVNALLFQLSIPLNFLGFSYREIRQALTDMEKMFDLL 240

Query: 438 EEKADIQDRDNAMPL-NLKGGSIQFDNVHFSYLTERKILDGVSFVVPAGKSVAIVGTSGS 496
           + +A++ D  +A PL  ++ G++ F NV F+Y   R IL+G+SF +P GK+VAIVG SG+
Sbjct: 241 DVEAEVSDAPDAPPLWPVRLGAVAFINVSFAYDPRRPILNGISFTIPLGKTVAIVGESGA 300

Query: 497 GKSTILRLLFRSFDTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFNDTIFHNIRYG 556
           GKSTILRLLFR +D +SGSI IDGQDI +VT +SLR++IG+VPQDTVLFNDTI +NI+YG
Sbjct: 301 GKSTILRLLFRFYDVNSGSITIDGQDIRDVTQQSLRRAIGIVPQDTVLFNDTIAYNIKYG 360

Query: 557 RLSATEEEVYDAARRAAIHDTIMNFPAKYSTVVGERGLKIEG 598
           R  AT EEV  AA  A IHD I + P  Y T VGERGLK+ G
Sbjct: 361 RPDATAEEVGAAAEAAQIHDFIQSLPEGYDTGVGERGLKLSG 402

Length = 497
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 599
KOG0058 716 consensus Peptide exporter, ABC superfamily [Intra 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
KOG0056 790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
PRK10790 592 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
TIGR01192 585 chvA glucan exporter ATP-binding protein. This mod 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
PRK10789 569 putative multidrug transporter membrane\ATP-bindin 100.0
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PTZ00243 1560 ABC transporter; Provisional 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
KOG0054 1381 consensus Multidrug resistance-associated protein/ 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
COG4618 580 ArpD ABC-type protease/lipase transport system, AT 100.0
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
KOG0054 1381 consensus Multidrug resistance-associated protein/ 100.0
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 100.0
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PTZ00243 1560 ABC transporter; Provisional 100.0
COG4615546 PvdE ABC-type siderophore export system, fused ATP 100.0
COG4178604 ABC-type uncharacterized transport system, permeas 99.97
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.97
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.95
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.95
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.95
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.95
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.95
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.94
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.94
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.94
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.94
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.94
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.94
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 99.94
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.94
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.93
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.93
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 99.93
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.93
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.92
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.92
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.92
COG3638 258 ABC-type phosphate/phosphonate transport system, A 99.92
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.91
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.91
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.91
PRK13647 274 cbiO cobalt transporter ATP-binding subunit; Provi 99.91
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 99.91
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.91
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.91
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 99.91
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.91
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 99.91
cd03291 282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.91
COG1127 263 Ttg2A ABC-type transport system involved in resist 99.91
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.91
PF00664275 ABC_membrane: ABC transporter transmembrane region 99.91
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.91
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.9
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.9
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
PRK10908222 cell division protein FtsE; Provisional 99.9
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.9
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.9
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.9
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.9
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.9
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.9
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.9
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.9
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.9
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.9
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 99.9
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.9
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.9
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.9
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.9
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.89
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.89
COG4619223 ABC-type uncharacterized transport system, ATPase 99.89
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 99.89
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.89
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.89
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.89
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.89
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.89
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.89
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.89
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.89
PRK13640 282 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.89
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.89
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.89
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.89
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.89
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 99.89
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.89
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.89
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 99.89
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.89
PRK11231 255 fecE iron-dicitrate transporter ATP-binding subuni 99.89
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.89
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 99.89
PRK13633 280 cobalt transporter ATP-binding subunit; Provisiona 99.89
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 99.89
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.89
PRK13548 258 hmuV hemin importer ATP-binding subunit; Provision 99.89
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.89
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.89
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.89
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.89
PRK13642 277 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.89
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.88
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.88
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.88
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.88
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.88
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.88
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
TIGR03873 256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.88
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.88
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.88
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 99.88
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.88
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.88
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.88
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.88
PRK14254 285 phosphate ABC transporter ATP-binding protein; Pro 99.88
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.88
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.88
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.88
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
PRK10253 265 iron-enterobactin transporter ATP-binding protein; 99.88
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.88
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 99.88
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.88
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.88
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.88
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.88
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 99.88
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.88
PRK14260 259 phosphate ABC transporter ATP-binding protein; Pro 99.88
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.88
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 99.88
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.88
cd03246173 ABCC_Protease_Secretion This family represents the 99.88
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; 99.88
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.88
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 99.88
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.88
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.88
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.88
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.87
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.87
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.87
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK14243 264 phosphate transporter ATP-binding protein; Provisi 99.87
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.87
PRK14264 305 phosphate ABC transporter ATP-binding protein; Pro 99.87
PRK14271 276 phosphate ABC transporter ATP-binding protein; Pro 99.87
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.87
cd03234226 ABCG_White The White subfamily represents ABC tran 99.87
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.87
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 99.87
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.87
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.87
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.87
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 99.87
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.87
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.87
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.87
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.87
PRK13547 272 hmuV hemin importer ATP-binding subunit; Provision 99.87
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.87
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.87
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 99.87
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.87
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.87
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK14258 261 phosphate ABC transporter ATP-binding protein; Pro 99.87
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.87
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 99.87
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 99.87
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 99.87
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 99.87
PRK14265 274 phosphate ABC transporter ATP-binding protein; Pro 99.87
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.86
PRK13537 306 nodulation ABC transporter NodI; Provisional 99.86
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.86
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.86
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 99.86
PRK14263 261 phosphate ABC transporter ATP-binding protein; Pro 99.86
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.86
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.86
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.86
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.86
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 99.86
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 99.86
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.86
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.86
PRK09984262 phosphonate/organophosphate ester transporter subu 99.86
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.85
COG0410237 LivF ABC-type branched-chain amino acid transport 99.85
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.85
PRK13536 340 nodulation factor exporter subunit NodI; Provision 99.85
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.85
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 99.85
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.85
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 99.85
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 99.85
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.85
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 99.85
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.84
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.84
PRK10419 268 nikE nickel transporter ATP-binding protein NikE; 99.84
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.84
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 99.84
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.84
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.84
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Pr 99.83
KOG0064 728 consensus Peroxisomal long-chain acyl-CoA transpor 99.83
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.83
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 99.83
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.83
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 99.83
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 99.83
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.83
PRK09544 251 znuC high-affinity zinc transporter ATPase; Review 99.83
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.82
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.82
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.82
CHL00131 252 ycf16 sulfate ABC transporter protein; Validated 99.82
PRK09473 330 oppD oligopeptide transporter ATP-binding componen 99.82
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.82
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 99.82
PRK09580 248 sufC cysteine desulfurase ATPase component; Review 99.81
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.81
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.81
PRK03695 248 vitamin B12-transporter ATPase; Provisional 99.81
COG4559 259 ABC-type hemin transport system, ATPase component 99.81
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.81
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.81
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.81
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.81
COG4181228 Predicted ABC-type transport system involved in ly 99.8
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.8
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.79
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.79
PRK10938 490 putative molybdenum transport ATP-binding protein 99.79
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.79
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.79
PLN03211 659 ABC transporter G-25; Provisional 99.79
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.79
COG0411 250 LivG ABC-type branched-chain amino acid transport 99.79
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.78
COG4525 259 TauB ABC-type taurine transport system, ATPase com 99.78
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.78
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.77
TIGR01184 230 ntrCD nitrate transport ATP-binding subunits C and 99.77
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.77
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 99.77
COG4604 252 CeuD ABC-type enterochelin transport system, ATPas 99.77
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.77
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.77
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.76
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.76
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.76
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.76
COG4136213 ABC-type uncharacterized transport system, ATPase 99.76
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.76
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.76
cd03236 255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.75
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.75
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.75
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 99.75
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.75
TIGR02770 230 nickel_nikD nickel import ATP-binding protein NikD 99.74
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.74
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.74
COG1101 263 PhnK ABC-type uncharacterized transport system, AT 99.74
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.73
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.73
COG4148 352 ModC ABC-type molybdate transport system, ATPase c 99.73
cd03237 246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.72
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.72
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.72
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.72
PRK10938490 putative molybdenum transport ATP-binding protein 99.72
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.72
COG0444 316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.7
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 99.7
PLN03140 1470 ABC transporter G family member; Provisional 99.7
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.7
COG1123539 ATPase components of various ABC-type transport sy 99.7
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.69
COG4133209 CcmA ABC-type transport system involved in cytochr 99.69
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.69
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.69
PRK13546 264 teichoic acids export protein ATP-binding subunit; 99.68
PRK11147 635 ABC transporter ATPase component; Reviewed 99.68
PLN03073718 ABC transporter F family; Provisional 99.68
COG1123 539 ATPase components of various ABC-type transport sy 99.67
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.67
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.67
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.67
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.65
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.65
PRK15177 213 Vi polysaccharide export ATP-binding protein VexC; 99.65
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.64
PRK13409 590 putative ATPase RIL; Provisional 99.64
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.62
COG4172534 ABC-type uncharacterized transport system, duplica 99.61
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.61
COG4152 300 ABC-type uncharacterized transport system, ATPase 99.6
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 99.6
PLN03140 1470 ABC transporter G family member; Provisional 99.6
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.6
PRK13409 590 putative ATPase RIL; Provisional 99.59
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.59
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 99.59
COG4167 267 SapF ABC-type antimicrobial peptide transport syst 99.58
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.58
COG0488530 Uup ATPase components of ABC transporters with dup 99.57
COG0488 530 Uup ATPase components of ABC transporters with dup 99.57
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.56
PRK11147 635 ABC transporter ATPase component; Reviewed 99.52
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.52
PLN03073 718 ABC transporter F family; Provisional 99.42
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.41
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.34
COG4172 534 ABC-type uncharacterized transport system, duplica 99.33
COG4107 258 PhnK ABC-type phosphonate transport system, ATPase 99.33
COG4138 248 BtuD ABC-type cobalamin transport system, ATPase c 99.31
COG4586 325 ABC-type uncharacterized transport system, ATPase 99.3
KOG0059 885 consensus Lipid exporter ABCA1 and related protein 99.3
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.23
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 99.2
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.2
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 99.17
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.14
TIGR00767 415 rho transcription termination factor Rho. Members 99.1
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.08
KOG2355 291 consensus Predicted ABC-type transport, ATPase com 99.04
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.02
PRK00300205 gmk guanylate kinase; Provisional 98.92
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 98.91
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 98.9
COG1129500 MglA ABC-type sugar transport system, ATPase compo 98.89
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 98.87
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 98.84
PRK11098409 microcin B17 transporter; Reviewed 98.84
PRK12369326 putative transporter; Reviewed 98.79
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.79
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 98.75
PF06472281 ABC_membrane_2: ABC transporter transmembrane regi 98.74
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 98.71
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 98.7
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 98.7
PRK01889356 GTPase RsgA; Reviewed 98.69
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 98.67
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 98.65
PRK07196 434 fliI flagellum-specific ATP synthase; Validated 98.65
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 98.64
COG4170 330 SapD ABC-type antimicrobial peptide transport syst 98.62
PRK07721 438 fliI flagellum-specific ATP synthase; Validated 98.57
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 98.53
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 98.53
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.47
PRK08149 428 ATP synthase SpaL; Validated 98.47
KOG0062582 consensus ATPase component of ABC transporters wit 98.45
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.44
PRK09825176 idnK D-gluconate kinase; Provisional 98.44
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 98.43
KOG0062 582 consensus ATPase component of ABC transporters wit 98.42
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 98.39
cd01128 249 rho_factor Transcription termination factor rho is 98.39
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.37
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 98.36
PF13748237 ABC_membrane_3: ABC transporter transmembrane regi 98.34
PLN02796 347 D-glycerate 3-kinase 98.33
PRK06315 442 type III secretion system ATPase; Provisional 98.33
PRK15494 339 era GTPase Era; Provisional 98.3
PRK00635 1809 excinuclease ABC subunit A; Provisional 98.3
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.25
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 98.23
TIGR00235207 udk uridine kinase. Model contains a number of lon 98.21
PRK03846198 adenylylsulfate kinase; Provisional 98.2
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 98.19
PRK05480 209 uridine/cytidine kinase; Provisional 98.17
TIGR03497 413 FliI_clade2 flagellar protein export ATPase FliI. 98.14
KOG0927 614 consensus Predicted transporter (ABC superfamily) 98.11
cd01136 326 ATPase_flagellum-secretory_path_III Flagellum-spec 98.1
PRK07594 433 type III secretion system ATPase SsaN; Validated 98.09
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 98.04
PRK09862 506 putative ATP-dependent protease; Provisional 98.04
TIGR02546 422 III_secr_ATP type III secretion apparatus H+-trans 98.04
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 97.99
PRK09270229 nucleoside triphosphate hydrolase domain-containin 97.99
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 97.98
PRK10416318 signal recognition particle-docking protein FtsY; 97.98
PLN02318 656 phosphoribulokinase/uridine kinase 97.96
PRK07261171 topology modulation protein; Provisional 97.96
PF1355562 AAA_29: P-loop containing region of AAA domain 97.94
PRK07960 455 fliI flagellum-specific ATP synthase; Validated 97.92
cd02026 273 PRK Phosphoribulokinase (PRK) is an enzyme involve 97.92
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 97.91
TIGR01026 440 fliI_yscN ATPase FliI/YscN family. This family of 97.89
TIGR03496 411 FliI_clade1 flagellar protein export ATPase FliI. 97.88
PRK08472 434 fliI flagellum-specific ATP synthase; Validated 97.87
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 97.86
PRK09099 441 type III secretion system ATPase; Provisional 97.86
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. 97.85
PRK00023225 cmk cytidylate kinase; Provisional 97.83
PRK05688 451 fliI flagellum-specific ATP synthase; Validated 97.8
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 97.8
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 97.79
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 97.78
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.76
PRK05922 434 type III secretion system ATPase; Validated 97.75
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 97.75
PTZ00035 337 Rad51 protein; Provisional 97.72
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 97.7
PRK00635 1809 excinuclease ABC subunit A; Provisional 97.69
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 97.67
PLN03046 460 D-glycerate 3-kinase; Provisional 97.66
PRK00098298 GTPase RsgA; Reviewed 97.66
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 97.63
PRK14530 215 adenylate kinase; Provisional 97.63
PF05992315 SbmA_BacA: SbmA/BacA-like family; InterPro: IPR009 97.63
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 97.62
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 97.6
KOG0063 592 consensus RNAse L inhibitor, ABC superfamily [RNA 97.6
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.59
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 97.58
PRK08972 444 fliI flagellum-specific ATP synthase; Validated 97.56
cd02025 220 PanK Pantothenate kinase (PanK) catalyzes the phos 97.56
PRK11545163 gntK gluconate kinase 1; Provisional 97.55
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 97.55
PRK05541176 adenylylsulfate kinase; Provisional 97.55
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.55
PRK06820 440 type III secretion system ATPase; Validated 97.55
PRK00889175 adenylylsulfate kinase; Provisional 97.54
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 97.52
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.51
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 97.51
PRK07429 327 phosphoribulokinase; Provisional 97.49
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.49
cd01123 235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.49
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 97.47
TIGR00954 659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 97.45
PRK06936 439 type III secretion system ATPase; Provisional 97.44
PLN02165 334 adenylate isopentenyltransferase 97.43
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 97.43
TIGR02239 316 recomb_RAD51 DNA repair protein RAD51. This eukary 97.4
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.4
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.38
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 97.36
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 97.36
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Pr 97.35
PRK13851344 type IV secretion system protein VirB11; Provision 97.35
PRK09183259 transposase/IS protein; Provisional 97.29
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-81  Score=669.68  Aligned_cols=474  Identities=26%  Similarity=0.370  Sum_probs=412.0

Q ss_pred             HHHHHHHHHhhcccChhhHHHHHHHHHHHHHHHHHHhHHHHHHHHHhhhhhcccchhhhhhhhhHHHHHHhHHHHHHHHH
Q 007539          106 KIFRTLASYLWMKDNFEFRLRVITALGFLVAAKVLNVQVPFLFKLAVDWLTTATTTATALAANSTFLALFGTPAAVLIGY  185 (599)
Q Consensus       106 ~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~p~l~~~~iD~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  185 (599)
                      ..+++++.|.+     +.++++..+++++++.++..+..|.+.+.++|.+.........+.   ..  .+     .   +
T Consensus       133 ~~~~rl~~l~~-----~~~~~l~~a~~~l~vss~~~~~iP~~~G~~id~~~~~~~~~~~~~---~~--~~-----~---l  194 (716)
T KOG0058|consen  133 TLLKRLLGLLK-----PEWKWLVAAFVLLLVSSLINMFIPYYLGKLIDTISEGDDSADALK---RA--CT-----I---L  194 (716)
T ss_pred             hHHHHHHHHhc-----hhHHHHHHHHHHHHHHHhhcchhhHHHHHHHHHHHhccchHHHHH---HH--HH-----H---H
Confidence            36778888887     457778888888889999999999999999998864111111000   00  00     1   1


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcccccccChhhHHHHHhhhHHHHHHHHHHHHHHHHHHHH
Q 007539          186 GIARTTASAFNELRTAVFSKVALRTIRSVSRKVFSHLHELDLRYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTIL  265 (599)
Q Consensus       186 ~i~~~~~~~~~~lr~~~~~~~~~~~~~~lr~~lf~~ll~l~~~~f~~~~~G~l~~~~~~~~~~i~~~~~~~~~~~~~~~~  265 (599)
                      .++..+..+++.+|.+++..++.++..++|..+|+++++++.+|||.+.+||+.+|++.|+..+...+...+...+..++
T Consensus       195 ~~l~~~~a~~~~~r~~~~~~a~~rv~~rlR~~lF~sil~QdiaFFD~nktGeL~SRLtsD~~~vs~svs~nls~~lR~~~  274 (716)
T KOG0058|consen  195 LGLFLIGALANAIRGGLLQYAGERVVARLRTDLFRSLLRQDIAFFDENKTGELISRLTSDTQIVSNSVSQNLSDGLRNLV  274 (716)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhccCCccHHHhhhhhhHHHHHHHHHHHHHHHHHHHH
Confidence            11122345778899999999999999999999999999999999999999999999999999988887777777777766


Q ss_pred             HHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccHHHHHHhhhhHHHHHHH
Q 007539          266 EISMVSGILAYKFGAPFAWITSLSVVAYVVFTLSVTQWRTKFRKAMNKADNDASTRAIDSLINYETVKYFNNEAFEAEQY  345 (599)
Q Consensus       266 ~~~~~~~il~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~~i~~Ik~~~~e~~~~~~~  345 (599)
                      ..+..+ .++++++|.++.+.++.+++++++...+.++.++..++.+++.++.++...|.+++++|||+|+.|+.+.+||
T Consensus       275 ~~~g~~-~~M~~~S~~Ltlv~~i~~P~v~~~~~~yG~~~rklS~~~Q~a~A~a~~vaeE~ls~~rTVRsfa~E~~E~~ry  353 (716)
T KOG0058|consen  275 QGFGGL-GFMFSLSWRLTLVTLIVVPIVALVAKIYGKYLRKLSKQTQDALARANQVAEEVLSAMRTVRSFAAEEQEVKRY  353 (716)
T ss_pred             HHHHhH-HHHhhhhHHHHHHHHHHhcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHhhhhHHHHHHH
Confidence            554433 4556678999998888888888888888899999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 007539          346 DEFLRRYEDAALKTQRSLAFLNFGQNVIFSAALSTAMVLCSHGILSGEMTVGDLVMVNGLLFQLSLPLNFLGSVYRETVQ  425 (599)
Q Consensus       346 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~g~lt~G~l~~~~~~~~~~~~pl~~l~~~~~~~~~  425 (599)
                      .+..++..+...|.....+.+....++........++++|++++.+|+||.|++++|+.|...+..++..++.+|.++++
T Consensus       354 ~~~l~~~~~i~~k~a~a~~~f~~~~~~~~~~~~~siL~~Gg~Lv~~g~mt~g~L~sFllY~~~~g~sl~~ls~~ys~lmk  433 (716)
T KOG0058|consen  354 NKKLREVLKLSKKEAVAYGIFFGSTNLLGNLAVLSILFYGGHLVLTGSLTSGALSSFLLYQVQLGSSLSGLSSFYSELMK  433 (716)
T ss_pred             HHHHHHHHHHHHHHHHHhhHhHhHHHHHHhHHHHHHHHhccchhhcCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999988888777766666666666666677778888999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcccccccCCCCCCCCCCCCceEEEEEEEEeecC--CCcccccceeEeeCCCEEEEEcCCCCcHHHHHH
Q 007539          426 SLVDMKSMFQLLEEKADIQDRDNAMPLNLKGGSIQFDNVHFSYLT--ERKILDGVSFVVPAGKSVAIVGTSGSGKSTILR  503 (599)
Q Consensus       426 ~~~~~~ri~~~l~~~~~~~~~~~~~~~~~~~~~I~f~nVsF~Y~~--~~~vL~~isl~I~~G~~vaIVG~SGSGKSTL~~  503 (599)
                      +.++.+|++|+++++|..+......|. ...|.|+|+||+|+||.  +.+||+|+||+|+|||+||+||||||||||+++
T Consensus       434 gvGAs~rvFel~dr~P~i~~~G~~~p~-~~~G~IeF~~VsFaYP~Rp~~~Vlk~lsfti~pGe~vALVGPSGsGKSTias  512 (716)
T KOG0058|consen  434 GVGASERVFELMDRKPRIPLTGTLAPD-HLQGVIEFEDVSFAYPTRPDVPVLKNLSFTIRPGEVVALVGPSGSGKSTIAS  512 (716)
T ss_pred             hcchHHHHHHHhccCCCCCCCCccccc-cccceEEEEEeeeecCCCCCchhhcCceeeeCCCCEEEEECCCCCCHHHHHH
Confidence            999999999999999876554222232 45689999999999984  558999999999999999999999999999999


Q ss_pred             HHhcCCCCCCceEEECCEeCCCCCHHHHhhhceeeCCCCCCchhhHHHHhhcCCCCCCHHHHHHHHHHcCchHHHhcCcC
Q 007539          504 LLFRSFDTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPA  583 (599)
Q Consensus       504 LL~gly~p~~G~I~idG~di~~~~~~~lR~~i~~V~Qd~~LF~gTIreNI~~g~~~~sdeei~~A~~~a~l~d~I~~Lp~  583 (599)
                      ||.|||+|++|+|++||+||++++..+||++||+|.|||.||++||+|||.||.++++||||++|+++|++||||.++|+
T Consensus       513 LL~rfY~PtsG~IllDG~~i~~~~~~~lr~~Ig~V~QEPvLFs~sI~eNI~YG~~~~t~e~i~~AAk~ANah~FI~~~p~  592 (716)
T KOG0058|consen  513 LLLRFYDPTSGRILLDGVPISDINHKYLRRKIGLVGQEPVLFSGSIRENIAYGLDNATDEEIEAAAKMANAHEFITNFPD  592 (716)
T ss_pred             HHHHhcCCCCCeEEECCeehhhcCHHHHHHHeeeeeccceeecccHHHHHhcCCCCCCHHHHHHHHHHhChHHHHHhCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccccCcccCCCC
Q 007539          584 KYSTVVGERGLKIEGK  599 (599)
Q Consensus       584 G~dT~vgE~G~~LSG~  599 (599)
                      ||||.|||+|.+||||
T Consensus       593 gY~T~VGEkG~qLSGG  608 (716)
T KOG0058|consen  593 GYNTVVGEKGSQLSGG  608 (716)
T ss_pred             ccccccCCccccccch
Confidence            9999999999999998

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PF00664 ABC_membrane: ABC transporter transmembrane region; InterPro: IPR001140 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK11098 microcin B17 transporter; Reviewed Back     alignment and domain information
>PRK12369 putative transporter; Reviewed Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PF06472 ABC_membrane_2: ABC transporter transmembrane region 2; InterPro: IPR010509 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF13748 ABC_membrane_3: ABC transporter transmembrane region Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF05992 SbmA_BacA: SbmA/BacA-like family; InterPro: IPR009248 The Rhizobium meliloti (Sinorhizobium meliloti) bacA gene encodes a function that is essential for bacterial differentiation into bacteroids within plant cells in the symbiosis between R Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query599
3nh6_A 306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 1e-54
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 4e-44
3qf4_A 587 Crystal Structure Of A Heterodimeric Abc Transporte 1e-33
4ayw_A 619 Structure Of The Human Mitochondrial Abc Transporte 5e-33
4ayt_A 595 Structure Of The Human Mitochondrial Abc Transporte 8e-33
2ghi_A 260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 1e-32
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-32
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 3e-26
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 2e-32
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-32
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-26
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 1e-29
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 1e-29
3qf4_B 598 Crystal Structure Of A Heterodimeric Abc Transporte 4e-29
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 2e-28
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 2e-20
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 2e-20
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 2e-20
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 3e-20
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 3e-20
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 3e-20
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 6e-20
2ixe_A 271 Crystal Structure Of The Atpase Domain Of Tap1 With 3e-19
2ixf_A 271 Crystal Structure Of The Atpase Domain Of Tap1 With 3e-19
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 9e-19
2ixg_A 271 Crystal Structure Of The Atpase Domain Of Tap1 With 1e-18
1jj7_A 260 Crystal Structure Of The C-Terminal Atpase Domain O 6e-16
3gd7_A 390 Crystal Structure Of Human Nbd2 Complexed With N6- 1e-13
2cbz_A 237 Structure Of The Human Multidrug Resistance Protein 4e-10
1z47_A 355 Structure Of The Atpase Subunit Cysa Of The Putativ 1e-07
2yyz_A 359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 3e-07
3dhw_C 343 Crystal Structure Of Methionine Importer Metni Leng 2e-06
3tui_C 366 Inward Facing Conformations Of The Metni Methionine 2e-06
2onk_A 240 Abc Transporter Modbc In Complex With Its Binding P 2e-06
3tuj_C 366 Inward Facing Conformations Of The Metni Methionine 4e-06
1q3h_A 286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 1e-05
1r0z_A 286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 1e-05
4g1u_C 266 X-Ray Structure Of The Bacterial Heme Transporter H 1e-05
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 2e-05
1vpl_A256 Crystal Structure Of Abc Transporter Atp-binding Pr 2e-05
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 2e-05
1xf9_A 283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 4e-05
1xfa_A 283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 4e-05
3fvq_A 359 Crystal Structure Of The Nucleotide Binding Domain 5e-05
2d2e_A 250 Crystal Structure Of Atypical Cytoplasmic Abc-Atpas 8e-05
1ji0_A240 Crystal Structure Analysis Of The Abc Transporter F 8e-05
2it1_A 362 Structure Of Ph0203 Protein From Pyrococcus Horikos 8e-05
4hlu_A 268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 1e-04
3gfo_A 275 Structure Of Cbio1 From Clostridium Perfringens: Pa 2e-04
2yz2_A 266 Crystal Structure Of The Abc Transporter In The Cob 2e-04
3si7_A 285 The Crystal Structure Of The Nbd1 Domain Of The Mou 3e-04
4fwi_B 334 Crystal Structure Of The Nucleotide-binding Domain 5e-04
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure 
Iteration: 1

 Score =  211 bits (536), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 127/171 (74%)
Query: 428 VDMKSMFQLLEEKADIQDRDNAMPLNLKGGSIQFDNVHFSYLTERKILDGVSFVVPAGKS 487
           +DM++MF LL+E+ +++D   A PL  + G I+F+NVHFSY   R+ L  VSF V  G++
Sbjct: 23  IDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYADGRETLQDVSFTVMPGQT 82
Query: 488 VAIVGTSGSGKSTILRLLFRSFDTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFND 547
           +A+VG SG+GKSTILRLLFR +D  SG IRIDGQDI +VT  SLR  IGVVPQDTVLFND
Sbjct: 83  LALVGPSGAGKSTILRLLFRFYDISSGCIRIDGQDISQVTQASLRSHIGVVPQDTVLFND 142
Query: 548 TIFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPAKYSTVVGERGLKIEG 598
           TI  NIRYGR++A  +EV  AA+ A IHD IM FP  Y T VGERGLK+ G
Sbjct: 143 TIADNIRYGRVTAGNDEVEAAAQAAGIHDAIMAFPEGYRTQVGERGLKLSG 193
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 Back     alignment and structure
>pdb|2D2E|A Chain A, Crystal Structure Of Atypical Cytoplasmic Abc-Atpase Sufc From Thermus Thermophilus Hb8 Length = 250 Back     alignment and structure
>pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query599
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 1e-109
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 1e-105
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-98
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 4e-97
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 5e-88
2ghi_A 260 Transport protein; multidrug resistance protein, M 2e-83
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 4e-81
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 2e-77
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 1e-69
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 7e-69
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 6e-68
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 5e-66
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 2e-59
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 7e-30
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 4e-20
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 3e-19
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 1e-18
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 2e-18
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 7e-18
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 2e-17
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 5e-17
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 9e-16
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 5e-15
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 7e-15
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 3e-13
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 3e-13
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 8e-13
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 7e-08
1sgw_A214 Putative ABC transporter; structural genomics, P p 3e-12
1ji0_A240 ABC transporter; ATP binding protein, structural g 3e-12
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 1e-11
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 1e-11
1b0u_A 262 Histidine permease; ABC transporter, transport pro 2e-11
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 2e-11
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 5e-11
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 4e-09
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 5e-09
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 8e-09
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 2e-08
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 2e-08
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 7e-05
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 2e-08
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 6e-08
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 3e-06
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 4e-06
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 7e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-05
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 4e-05
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 5e-05
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 6e-05
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 9e-05
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 3e-04
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 2e-04
1g6h_A 257 High-affinity branched-chain amino acid transport 3e-04
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
 Score =  329 bits (847), Expect = e-109
 Identities = 106/194 (54%), Positives = 133/194 (68%), Gaps = 2/194 (1%)

Query: 406 LFQLSLPLN-FLGSVYRETVQSLVDMKSMFQLLEEKADIQDRDNAMPLNLKGGSIQFDNV 464
           +       +   G V R +    +DM++MF LL+E+ +++D   A PL  + G I+F+NV
Sbjct: 1   MGSSHHHHHHSSGLVPRGS-HMFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENV 59

Query: 465 HFSYLTERKILDGVSFVVPAGKSVAIVGTSGSGKSTILRLLFRSFDTHSGSIRIDGQDIC 524
           HFSY   R+ L  VSF V  G+++A+VG SG+GKSTILRLLFR +D  SG IRIDGQDI 
Sbjct: 60  HFSYADGRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFRFYDISSGCIRIDGQDIS 119

Query: 525 EVTLESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPAK 584
           +VT  SLR  IGVVPQDTVLFNDTI  NIRYGR++A  +EV  AA+ A IHD IM FP  
Sbjct: 120 QVTQASLRSHIGVVPQDTVLFNDTIADNIRYGRVTAGNDEVEAAAQAAGIHDAIMAFPEG 179

Query: 585 YSTVVGERGLKIEG 598
           Y T VGERGLK+ G
Sbjct: 180 YRTQVGERGLKLSG 193
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query599
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 100.0
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 100.0
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 100.0
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 100.0
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 100.0
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 100.0
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.97
2ghi_A 260 Transport protein; multidrug resistance protein, M 99.97
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.97
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 99.96
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.95
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 99.94
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.93
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 99.93
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.93
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 99.93
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 99.92
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 99.92
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.92
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.92
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 99.92
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.92
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 99.92
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 99.91
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 99.91
1g6h_A 257 High-affinity branched-chain amino acid transport 99.91
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.91
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.91
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 99.91
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 99.91
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.91
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 99.91
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 99.91
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 99.9
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.9
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 99.9
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 99.9
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.89
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 99.89
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 99.89
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 99.88
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 99.88
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 99.84
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 99.69
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.63
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.62
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.6
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.6
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.59
2ewv_A372 Twitching motility protein PILT; pilus retraction 99.59
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.58
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.54
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.54
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.5
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.49
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 99.48
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 99.45
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.45
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.44
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.43
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.42
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.4
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.39
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.34
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 99.32
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.3
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.28
2og2_A359 Putative signal recognition particle receptor; nuc 99.28
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.27
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.27
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 99.25
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 99.24
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.24
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 99.23
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.23
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.23
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 99.23
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.22
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.19
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 99.19
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 99.18
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 99.18
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.16
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 99.15
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.14
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.12
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 99.12
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.11
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.1
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.08
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 99.08
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.05
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 99.04
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 99.03
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 99.03
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.03
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.02
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 99.0
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.99
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 98.99
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.98
1p9r_A 418 General secretion pathway protein E; bacterial typ 98.98
1e69_A 322 Chromosome segregation SMC protein; structural mai 98.97
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.95
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 98.94
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 98.93
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.92
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.91
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.9
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 98.89
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 98.86
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 98.85
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 98.78
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.78
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 98.76
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 98.75
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.72
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 98.7
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.69
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 98.69
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 98.68
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.66
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 98.66
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.6
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.59
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.58
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 98.57
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.52
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 98.51
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 98.5
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.5
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.49
3ice_A 422 Transcription termination factor RHO; transcriptio 98.47
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.46
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.41
3kta_A182 Chromosome segregation protein SMC; structural mai 98.4
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.38
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 98.38
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.38
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 98.37
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.36
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.34
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.29
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.23
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.22
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 98.12
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.07
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.07
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 98.07
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 98.06
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.04
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 97.98
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 97.95
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.95
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.94
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.92
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 97.91
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.89
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 97.88
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 97.87
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 97.83
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.8
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.79
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.75
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.74
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.74
3r20_A233 Cytidylate kinase; structural genomics, seattle st 97.73
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 97.72
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 97.72
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.68
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.68
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.67
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 97.66
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.64
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.64
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 97.63
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 97.6
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 97.57
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 97.55
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.52
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 97.49
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 97.44
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 97.44
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.42
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.41
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 97.41
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 97.38
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.35
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.33
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.3
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.3
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 97.28
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.26
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 97.26
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 97.15
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 97.14
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 97.13
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.12
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.11
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 97.08
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 97.08
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 97.08
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.05
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 97.03
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 97.01
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.97
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.96
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.96
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.9
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.9
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.9
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 96.83
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.8
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 96.77
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.73
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 96.72
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.72
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 96.71
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.67
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 96.57
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 96.56
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.53
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 96.53
2z43_A 324 DNA repair and recombination protein RADA; archaea 96.52
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.51
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.5
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.5
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 96.5
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 96.44
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 96.43
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 96.4
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.39
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.39
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.37
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 96.36
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.36
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 96.34
3lxx_A239 GTPase IMAP family member 4; structural genomics c 96.31
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 96.3
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.28
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.27
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.26
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.21
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.19
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 96.16
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.16
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.16
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.15
1via_A175 Shikimate kinase; structural genomics, transferase 96.15
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 96.11
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 96.02
2vli_A183 Antibiotic resistance protein; transferase, tunica 95.99
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 95.97
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.95
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 95.94
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 95.9
2r6a_A 454 DNAB helicase, replicative helicase; replication, 95.86
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.85
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 95.84
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 95.83
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.82
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 95.82
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 95.76
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 95.76
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.75
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 95.72
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 95.69
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 95.68
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.67
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 95.67
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.65
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.64
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 95.64
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.63
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 95.62
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 95.62
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 95.61
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 95.59
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 95.59
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.57
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 95.55
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 95.54
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 95.53
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 95.52
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.48
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 95.45
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 95.42
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 95.42
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 95.42
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 95.4
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 95.4
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 95.39
2ged_A193 SR-beta, signal recognition particle receptor beta 95.35
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.34
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 95.34
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 95.33
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 95.33
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 95.33
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 95.32
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 95.32
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 95.3
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 95.29
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 95.29
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 95.28
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 95.28
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 95.28
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 95.26
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 95.25
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 95.24
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 95.23
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 95.22
3t1o_A198 Gliding protein MGLA; G domain containing protein, 95.21
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 95.21
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 95.21
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 95.21
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 95.2
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 95.14
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 95.13
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 95.13
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 95.08
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 95.07
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 95.06
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 95.03
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 95.01
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 95.01
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.01
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 95.01
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 94.99
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 94.97
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 94.95
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 94.94
2h92_A 219 Cytidylate kinase; rossmann fold, transferase; HET 94.93
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 94.93
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 94.93
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 94.92
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 94.91
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 94.91
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 94.9
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 94.9
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 94.86
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 94.85
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 94.85
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 94.85
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 94.83
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 94.83
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 94.82
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 94.82
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 94.82
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 94.79
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 94.79
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 94.78
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 94.77
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 94.75
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 94.72
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 94.71
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 94.7
3bos_A242 Putative DNA replication factor; P-loop containing 94.69
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 94.69
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.69
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 94.69
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 94.68
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 94.66
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 94.65
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 94.65
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 94.64
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 94.64
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 94.63
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 94.63
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 94.62
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 94.62
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 94.62
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 94.6
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 94.59
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 94.57
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 94.57
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 94.55
3llu_A196 RAS-related GTP-binding protein C; structural geno 94.55
1nrj_B218 SR-beta, signal recognition particle receptor beta 94.53
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 94.5
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 94.5
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 94.49
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 94.49
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 94.47
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 94.46
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 94.46
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 94.45
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 94.45
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 94.44
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 94.43
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 94.39
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 94.39
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 94.38
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 94.37
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 94.36
3cnl_A262 YLQF, putative uncharacterized protein; circular p 94.35
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 94.34
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 94.34
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 94.34
3l0o_A 427 Transcription termination factor RHO; helicase, RH 94.34
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 94.33
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 94.33
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 94.33
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 94.3
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 94.29
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 94.29
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 94.28
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 94.27
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.27
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 94.26
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 94.25
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 94.25
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 94.2
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 94.2
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 94.19
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 94.19
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 94.16
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 94.16
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 94.15
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 94.12
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 94.09
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 94.08
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 94.08
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 94.08
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.04
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 94.0
2fh5_B214 SR-beta, signal recognition particle receptor beta 94.0
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 93.91
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 93.91
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 93.84
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 93.83
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 93.67
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 93.66
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 93.64
2hf9_A226 Probable hydrogenase nickel incorporation protein 93.62
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 93.57
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 93.56
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 93.53
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 93.47
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 93.47
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 93.46
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 93.42
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 93.42
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 93.35
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 93.32
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 93.31
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 93.3
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 93.3
1u94_A 356 RECA protein, recombinase A; homologous recombinat 93.28
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 93.23
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 93.14
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 93.12
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 93.06
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 93.0
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 92.93
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 92.82
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 92.8
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 92.8
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 92.79
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 92.71
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 92.62
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 92.6
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 92.55
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 92.54
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 92.54
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 92.47
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 92.47
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 92.47
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 92.41
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 92.32
1wxq_A 397 GTP-binding protein; structural genomics, riken st 92.25
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 92.24
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 91.45
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 92.21
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 92.2
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 92.13
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 92.06
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 92.02
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 91.94
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 91.92
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 91.82
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 91.81
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 91.68
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 91.67
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 91.65
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 91.62
3co5_A143 Putative two-component system transcriptional RES 91.53
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 91.5
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 91.43
1tue_A212 Replication protein E1; helicase, replication, E1E 91.43
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 91.41
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 91.32
2chg_A226 Replication factor C small subunit; DNA-binding pr 91.28
2iut_A 574 DNA translocase FTSK; nucleotide-binding, chromoso 91.17
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 91.12
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
Probab=100.00  E-value=1.1e-68  Score=643.64  Aligned_cols=406  Identities=23%  Similarity=0.316  Sum_probs=355.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcccccccChhhHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 007539          193 SAFNELRTAVFSKVALRTIRSVSRKVFSHLHELDLRYHLSRETGALNRIIDRGSRAINFILSSMVFNVVPTILEISMVSG  272 (599)
Q Consensus       193 ~~~~~lr~~~~~~~~~~~~~~lr~~lf~~ll~l~~~~f~~~~~G~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~  272 (599)
                      .++.+++.+++.++++++..++|.++|+|++++|++||+++++|++.+++++|.+.++..+...+..++..++.++. ..
T Consensus       150 ~~~~~~~~~~~~~~~~r~~~~lR~~~~~~ll~~~~~~fd~~~~G~l~sr~~~D~~~i~~~~~~~l~~~~~~~~~~i~-~~  228 (1321)
T 4f4c_A          150 WAAGQITVTCYLYVAEQMNNRLRREFVKSILRQEISWFDTNHSGTLATKLFDNLERVKEGTGDKIGMAFQYLSQFIT-GF  228 (1321)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCHHHHHHTCCTTHHHHHHHHHHHHHHTSSHHHHHHHHHHHHHHH-HH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HH
Confidence            45678888999999999999999999999999999999999999999999999998887765555555555544333 33


Q ss_pred             HHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccHHHHHHhhhhHHHHHHHHHHHHHH
Q 007539          273 ILAYKFGAPFAWITSLSVVAYVVFTLSVTQWRTKFRKAMNKADNDASTRAIDSLINYETVKYFNNEAFEAEQYDEFLRRY  352 (599)
Q Consensus       273 il~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~~i~~Ik~~~~e~~~~~~~~~~~~~~  352 (599)
                      ++++.++|.+++++++++++++++...+.+..++..++.++..++..+.+.|.++|+++||+|++|+.+.++|.+..+++
T Consensus       229 i~~~~~~~~l~lv~l~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~gi~~ik~~~~e~~~~~~~~~~~~~~  308 (1321)
T 4f4c_A          229 IVAFTHSWQLTLVMLAVTPIQALCGFAIAKSMSTFAIRETLRYAKAGKVVEETISSIRTVVSLNGLRYELERYSTAVEEA  308 (1321)
T ss_dssp             HHHHHHCHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHTTCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHhcccHHHHHHHHHHHHHH
Confidence            45566788888887777777777777777777777777777788888999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 007539          353 EDAALKTQRSLAFLNFGQNVIFSAALSTAMVLCSHGILSGEMTVGDLVMVNGLLFQLSLPLNFLGSVYRETVQSLVDMKS  432 (599)
Q Consensus       353 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~g~lt~G~l~~~~~~~~~~~~pl~~l~~~~~~~~~~~~~~~r  432 (599)
                      .+...+.....+.......++..+..++++++|++++.+|.+|+|+++++..++..+..|+..++..+..++++.++++|
T Consensus       309 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~v~~g~lt~g~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~s~~r  388 (1321)
T 4f4c_A          309 KKAGVLKGLFLGISFGAMQASNFISFALAFYIGVGWVHDGSLNFGDMLTTFSSVMMGSMALGLAGPQLAVLGTAQGAASG  388 (1321)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            88888877777666666666666666777788999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcccccccCCCCC-CCCCCCCceEEEEEEEEeecC--CCcccccceeEeeCCCEEEEEcCCCCcHHHHHHHHhcCC
Q 007539          433 MFQLLEEKADIQDRDNA-MPLNLKGGSIQFDNVHFSYLT--ERKILDGVSFVVPAGKSVAIVGTSGSGKSTILRLLFRSF  509 (599)
Q Consensus       433 i~~~l~~~~~~~~~~~~-~~~~~~~~~I~f~nVsF~Y~~--~~~vL~~isl~I~~G~~vaIVG~SGSGKSTL~~LL~gly  509 (599)
                      +.++++.+++.++.... .......++|+|+||+|+||+  ++++|+|+||+|+|||++|||||||||||||+++|+|+|
T Consensus       389 i~~~l~~~~~~~~~~~~~~~~~~~~g~I~~~nvsF~Y~~~~~~~vL~~isl~i~~G~~vaivG~sGsGKSTll~ll~~~~  468 (1321)
T 4f4c_A          389 IYEVLDRKPVIDSSSKAGRKDMKIKGDITVENVHFTYPSRPDVPILRGMNLRVNAGQTVALVGSSGCGKSTIISLLLRYY  468 (1321)
T ss_dssp             HHHHTTTSCCSSCSSSCCCCCCCCCCCEEEEEEEECCSSSTTSCSEEEEEEEECTTCEEEEEECSSSCHHHHHHHHTTSS
T ss_pred             HHHHHcCCccccccccccccCCCCCCcEEEEEeeeeCCCCCCCceeeceEEeecCCcEEEEEecCCCcHHHHHHHhcccc
Confidence            99999887654433221 222234568999999999974  568999999999999999999999999999999999999


Q ss_pred             CCCCceEEECCEeCCCCCHHHHhhhceeeCCCCCCchhhHHHHhhcCCCCCCHHHHHHHHHHcCchHHHhcCcCcccccc
Q 007539          510 DTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPAKYSTVV  589 (599)
Q Consensus       510 ~p~~G~I~idG~di~~~~~~~lR~~i~~V~Qd~~LF~gTIreNI~~g~~~~sdeei~~A~~~a~l~d~I~~Lp~G~dT~v  589 (599)
                      +|++|+|++||+|+++++.++||++|+||+|||+||+|||||||+||+|++++|++++||+.|++||||++||+||||+|
T Consensus       469 ~~~~G~I~idG~~i~~~~~~~lr~~i~~v~Q~~~Lf~~TI~eNI~~g~~~~~~~~v~~a~~~a~l~~~i~~lp~G~~T~v  548 (1321)
T 4f4c_A          469 DVLKGKITIDGVDVRDINLEFLRKNVAVVSQEPALFNCTIEENISLGKEGITREEMVAACKMANAEKFIKTLPNGYNTLV  548 (1321)
T ss_dssp             CCSEEEEEETTEETTTSCHHHHHHHEEEECSSCCCCSEEHHHHHHTTCTTCCHHHHHHHHHHTTCHHHHHHSTTTTSSEE
T ss_pred             ccccCcccCCCccchhccHHHHhhcccccCCcceeeCCchhHHHhhhcccchHHHHHHHHHHccchhHHHcCCCCCccEe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCcccCCCC
Q 007539          590 GERGLKIEGK  599 (599)
Q Consensus       590 gE~G~~LSG~  599 (599)
                      ||+|.+||||
T Consensus       549 Ge~G~~LSGG  558 (1321)
T 4f4c_A          549 GDRGTQLSGG  558 (1321)
T ss_dssp             SSSSCCCCHH
T ss_pred             cCCCCCCCHH
Confidence            9999999997
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 599
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 4e-54
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 1e-44
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 4e-41
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 9e-40
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 2e-38
d1r0wa_ 281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 1e-33
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 5e-22
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 9e-22
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 8e-21
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 1e-20
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 1e-20
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 2e-20
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 8e-19
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 4e-18
d1g6ha_ 254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 1e-17
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 2e-17
d2hyda2323 f.37.1.1 (A:1-323) Putative multidrug export ATP-b 6e-17
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 1e-16
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 6e-16
d3b60a2319 f.37.1.1 (A:10-328) Multidrug resistance ABC trans 3e-15
d2onka1 240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 1e-13
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 3e-12
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 7e-12
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 2e-07
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 3e-04
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 8e-04
d1kkma_176 c.91.1.2 (A:) HPr kinase HprK C-terminal domain {L 0.002
d1kaga_169 c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia 0.002
g1f2t.1 292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 0.003
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 0.003
d1y63a_174 c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma 0.004
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]

 Score =  182 bits (464), Expect = 4e-54
 Identities = 73/157 (46%), Positives = 99/157 (63%), Gaps = 1/157 (0%)

Query: 443 IQDRDNAMPLNLKGGSIQFDNVHFSYL-TERKILDGVSFVVPAGKSVAIVGTSGSGKSTI 501
           I++   A P+ +K G I  D+V F Y   E  IL  ++  +  G++VA VG SG GKST+
Sbjct: 1   IKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTL 60

Query: 502 LRLLFRSFDTHSGSIRIDGQDICEVTLESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSAT 561
           + L+ R +D  SG I IDG +I +    SLR  IG+V QD +LF+DT+  NI  GR +AT
Sbjct: 61  INLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILLGRPTAT 120

Query: 562 EEEVYDAARRAAIHDTIMNFPAKYSTVVGERGLKIEG 598
           +EEV +AA+ A  HD IMN P  Y T VGERG+K+ G
Sbjct: 121 DEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG 157
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 323 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 319 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Length = 176 Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query599
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 99.97
d2hyda2323 Putative multidrug export ATP-binding/permease pro 99.97
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 99.96
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.95
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.95
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.94
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.94
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.94
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.94
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.94
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.92
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.92
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.91
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.91
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.91
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.88
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 99.83
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.69
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.54
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.45
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.33
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.21
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.17
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.17
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.1
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.07
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.04
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.99
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.98
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.97
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.96
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 96.92
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.89
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.88
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.87
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.85
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.84
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.82
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.81
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.8
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.78
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.76
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 96.75
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.73
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.67
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.61
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.53
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.5
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.49
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.47
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.4
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.39
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.36
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.29
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.24
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 96.23
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.2
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.19
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.19
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 96.18
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 96.15
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.14
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.1
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 96.08
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.07
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.06
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 96.06
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.01
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.01
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.01
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.99
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.98
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.98
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.97
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.95
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.94
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.93
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.92
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 95.9
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.9
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.88
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.86
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.83
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 95.82
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 95.78
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 95.78
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 95.77
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.75
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.75
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.73
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.7
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.61
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 95.59
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.59
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 95.55
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 95.54
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.54
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.5
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 95.46
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 95.42
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 95.4
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.34
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 95.3
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.27
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.26
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.25
d1okkd2207 GTPase domain of the signal recognition particle r 95.19
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 95.17
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.12
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.08
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.08
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.05
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 95.03
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 95.0
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 95.0
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 94.94
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.93
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 94.93
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.85
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 94.83
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 94.78
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.77
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 94.76
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.71
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 94.71
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 94.69
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 94.66
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 94.59
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 94.59
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 94.59
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 94.55
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.53
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.45
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 94.42
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 94.42
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 94.39
d2qy9a2211 GTPase domain of the signal recognition particle r 94.37
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.34
d2hyda2323 Putative multidrug export ATP-binding/permease pro 94.34
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.32
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 94.31
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.31
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.31
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 94.28
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 94.26
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 94.2
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 94.18
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 94.15
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 94.12
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.11
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 94.07
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.07
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 94.04
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.04
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.01
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.97
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 93.97
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 93.95
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 93.89
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 93.87
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 93.85
d1xpua3 289 Transcription termination factor Rho, ATPase domai 93.85
d1vmaa2213 GTPase domain of the signal recognition particle r 93.8
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 93.79
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 93.79
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.78
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 93.67
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.67
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 93.65
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 93.59
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.59
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 93.58
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 93.57
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 93.51
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 93.47
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 93.43
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 93.4
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 93.4
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 93.4
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 93.33
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 93.3
d1j8yf2211 GTPase domain of the signal sequence recognition p 93.28
d1ls1a2207 GTPase domain of the signal sequence recognition p 93.28
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.26
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.13
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 93.08
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 92.97
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.95
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.83
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 92.82
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 92.74
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.72
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 92.71
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 92.6
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 92.46
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 92.37
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 92.37
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 92.34
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 92.17
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 92.15
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 92.11
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 92.09
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 92.07
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 91.99
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 91.88
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 91.73
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.61
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.53
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 91.4
d1svma_362 Papillomavirus large T antigen helicase domain {Si 91.25
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 91.16
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 91.1
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 91.07
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 91.01
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.7
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 90.65
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 90.11
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 89.87
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 89.85
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 89.82
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 89.76
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 89.32
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 88.54
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.38
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 88.19
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 88.12
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 87.65
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 87.62
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 87.34
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 87.33
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 87.18
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 87.14
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 87.03
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 86.92
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 86.91
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 86.64
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 86.15
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 85.98
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 85.64
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 85.07
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 85.06
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 84.36
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 83.9
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 83.89
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 83.79
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 82.76
d1jnya3 224 Elongation factor eEF-1alpha, N-terminal (G) domai 82.68
d1tuea_205 Replication protein E1 helicase domain {Human papi 82.65
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]

Probab=100.00  E-value=9e-44  Score=348.93  Aligned_cols=150  Identities=47%  Similarity=0.757  Sum_probs=143.6

Q ss_pred             CCCCCCCceEEEEEEEEeecCC-CcccccceeEeeCCCEEEEEcCCCCcHHHHHHHHhcCCCCCCceEEECCEeCCCCCH
Q 007539          450 MPLNLKGGSIQFDNVHFSYLTE-RKILDGVSFVVPAGKSVAIVGTSGSGKSTILRLLFRSFDTHSGSIRIDGQDICEVTL  528 (599)
Q Consensus       450 ~~~~~~~~~I~f~nVsF~Y~~~-~~vL~~isl~I~~G~~vaIVG~SGSGKSTL~~LL~gly~p~~G~I~idG~di~~~~~  528 (599)
                      .|.+...|.|+|+||+|+|+++ +++|+||||+|++||++||||+||||||||+++|+|+|+|++|+|.+||+|+++++.
T Consensus         8 ~pl~~~~g~I~~~nvsf~Y~~~~~~vL~~isl~i~~Ge~vaivG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~   87 (255)
T d2hyda1           8 QPIEIKQGRIDIDHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLT   87 (255)
T ss_dssp             CCCCCCSCCEEEEEEEECSCSSSCCSEEEEEEEECTTCEEEEECSTTSSHHHHHTTTTTSSCCSEEEEEETTEEGGGSCH
T ss_pred             CCCCCCCCEEEEEEEEEEeCCCCCcceeceEEEEcCCCEEEEECCCCCcHHHHHHHHHhcCCccccccccCCEEcccCCH
Confidence            3444556799999999999854 689999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhhceeeCCCCCCchhhHHHHhhcCCCCCCHHHHHHHHHHcCchHHHhcCcCccccccccCcccCCCC
Q 007539          529 ESLRKSIGVVPQDTVLFNDTIFHNIRYGRLSATEEEVYDAARRAAIHDTIMNFPAKYSTVVGERGLKIEGK  599 (599)
Q Consensus       529 ~~lR~~i~~V~Qd~~LF~gTIreNI~~g~~~~sdeei~~A~~~a~l~d~I~~Lp~G~dT~vgE~G~~LSG~  599 (599)
                      +++|++|+||+|++++|++||+|||++|+|+++++++++|++.+++++++.+||+||||.+||+|.+||||
T Consensus        88 ~~lr~~i~~v~Q~~~lf~~Ti~eNi~~g~~~~~~~~~~~al~~~~l~~~i~~lp~gl~t~i~~~g~~LSgG  158 (255)
T d2hyda1          88 GSLRNQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGG  158 (255)
T ss_dssp             HHHHHTEEEECSSCCCCSSBHHHHHGGGCSSCCHHHHHHHHHHTTCHHHHHTSTTGGGCBCCGGGTTSCHH
T ss_pred             HHhhheeeeeeccccCCCCCHHHHHhccCcCCCHHHHHHHHHHhCCHHHHHhccccccchhcCCCCCcCHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999997
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure